1CLAA

Evidence for transition-state stabilization by serine-148 in the catalytic mechanism of chloramphenicol acetyltransferase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
213
structure length
213
Chain Sequence
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNIAALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLLLPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE III CHLORAMPHENICOL ACETYLTRANSFERASE
publication title Evidence for transition-state stabilization by serine-148 in the catalytic mechanism of chloramphenicol acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (acyltransferase)
total genus 57
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1989-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1claA00
2E1UA 3B30A 1PD5A 4KECA 5KJSA 5KJTA 2JGPA 4G22A 5FANA 5KJWA 3L60A 4HVMA 1Q23A 1XL7A 1EAEA 2II4A 5KJVA 1XMCA 2VSQA 2BGHA 5DU9A 3B2SA 5DUAA 1SCZA 4G0BA 3MAEA 4JN3A 1DPCA 1QCAA 3CLAA 4JN5A 2XHGA 3FOTA 4KE4A 1CIAA 5KJUA 5FALA 2RKTA 4N72A 2ZBAA 1NOCB 1L5AA 1EAFA 1XMDA 2XR7A 2II3A 2RKVA 1EADA 4G2MA 5T3EA 4CLAA 3U9FA 1EAAA 2I9DA 1DPBA 2E1VA 2CLAA 2II5A 3FP0A 1EABA 2IHWA 3U9BA 1E2OA 1DPDA 1Q9JA 1EACA 2E1TA 1XL8A 1CLAA 1C4TA
chains in the Genus database with same CATH superfamily
3B30A 2FW3A 1PD5A 5KJTA 5FANA 1Q6XA 5KJWA 1XL7A 2DEBA 2FY5A 1NDBA 2H3WA 4N72A 1XMDA 2XR7A 1EADA 5T3EA 4CLAA 3U9FA 1EAAA 1DPBA 2II5A 1EABA 1T7OA 2E1TA 2ZBAA 3B2SA 4KECA 1NDFA 1Q23A 1NDIA 2FY2A 4EYWA 5DU9A 4G0BA 4JN3A 4KE4A 5KJUA 1T1UA 4EP9A 1NOCB 2FYOA 4G2MA 1Q9JA 2RKVA 3L60A 1C4TA 5KJSA 2JGPA 4EPHA 2II4A 2H3PA 1XMCA 2BGHA 2FY3A 1SCZA 1DPCA 1QCAA 3CLAA 2XHGA 3FOTA 1S5OA 2RCUA 1T7NA 2IHWA 3U9BA 1E2OA 1DPDA 1EACA 1CLAA 2E1UA 4G22A 2H4TA 4HVMA 1EAEA 5KJVA 2VSQA 5DUAA 1NM8A 3MAEA 4JN5A 1CIAA 2FY4A 5FALA 2RKTA 1L5AA 1EAFA 2II3A 2I9DA 2E1VA 2CLAA 2H3UA 3FP0A 1T7QA 1XL8A
chains in the Genus database with same CATH topology
2E1UA 3B30A 1PD5A 4KECA 5KJSA 5KJTA 2JGPA 4G22A 5FANA 5KJWA 3L60A 4HVMA 1Q23A 1XL7A 1EAEA 2II4A 5KJVA 1XMCA 2VSQA 2BGHA 5DU9A 3B2SA 5DUAA 1SCZA 4G0BA 3MAEA 4JN3A 1DPCA 1QCAA 3CLAA 4JN5A 2XHGA 3FOTA 4KE4A 1CIAA 5KJUA 5FALA 2RKTA 4N72A 2ZBAA 1NOCB 1L5AA 1EAFA 1XMDA 2XR7A 2II3A 2RKVA 1EADA 4G2MA 5T3EA 4CLAA 3U9FA 1EAAA 2I9DA 1DPBA 2E1VA 2CLAA 2II5A 3FP0A 1EABA 2IHWA 3U9BA 1E2OA 1DPDA 1Q9JA 1EACA 2E1TA 1XL8A 1CLAA 1C4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1U A;  3B30 A;  1PD5 A;  4KEC A;  5KJS A;  5KJT A;  2JGP A;  4G22 A;  5FAN A;  5KJW A;  3L60 A;  4HVM A;  1Q23 A;  1XL7 A;  1EAE A;  2II4 A;  5KJV A;  1XMC A;  2VSQ A;  2BGH A;  5DU9 A;  3B2S A;  5DUA A;  1SCZ A;  4G0B A;  3MAE A;  4JN3 A;  1DPC A;  1QCA A;  3CLA A;  4JN5 A;  2XHG A;  3FOT A;  4KE4 A;  1CIA A;  5KJU A;  5FAL A;  2RKT A;  4N72 A;  2ZBA A;  1NOC B;  1L5A A;  1EAF A;  1XMD A;  2XR7 A;  2II3 A;  2RKV A;  1EAD A;  4G2M A;  5T3E A;  4CLA A;  3U9F A;  1EAA A;  2I9D A;  1DPB A;  2E1V A;  2CLA A;  2II5 A;  3FP0 A;  1EAB A;  2IHW A;  3U9B A;  1E2O A;  1DPD A;  1Q9J A;  1EAC A;  2E1T A;  1XL8 A;  1CLA A;  1C4T A; 
#chains in the Genus database with same CATH topology
 3B30 A;  2FW3 A;  1PD5 A;  5KJT A;  5FAN A;  1Q6X A;  5KJW A;  1XL7 A;  2DEB A;  2FY5 A;  1NDB A;  2H3W A;  4N72 A;  1XMD A;  2XR7 A;  1EAD A;  5T3E A;  4CLA A;  3U9F A;  1EAA A;  1DPB A;  2II5 A;  1EAB A;  1T7O A;  2E1T A;  2ZBA A;  3B2S A;  4KEC A;  1NDF A;  1Q23 A;  1NDI A;  2FY2 A;  4EYW A;  5DU9 A;  4G0B A;  4JN3 A;  4KE4 A;  5KJU A;  1T1U A;  4EP9 A;  1NOC B;  2FYO A;  4G2M A;  1Q9J A;  2RKV A;  3L60 A;  1C4T A;  5KJS A;  2JGP A;  4EPH A;  2II4 A;  2H3P A;  1XMC A;  2BGH A;  2FY3 A;  1SCZ A;  1DPC A;  1QCA A;  3CLA A;  2XHG A;  3FOT A;  1S5O A;  2RCU A;  1T7N A;  2IHW A;  3U9B A;  1E2O A;  1DPD A;  1EAC A;  1CLA A;  2E1U A;  4G22 A;  2H4T A;  4HVM A;  1EAE A;  5KJV A;  2VSQ A;  5DUA A;  1NM8 A;  3MAE A;  4JN5 A;  1CIA A;  2FY4 A;  5FAL A;  2RKT A;  1L5A A;  1EAF A;  2II3 A;  2I9D A;  2E1V A;  2CLA A;  2H3U A;  3FP0 A;  1T7Q A;  1XL8 A; 
#chains in the Genus database with same CATH homology
 2E1U A;  3B30 A;  1PD5 A;  4KEC A;  5KJS A;  5KJT A;  2JGP A;  4G22 A;  5FAN A;  5KJW A;  3L60 A;  4HVM A;  1Q23 A;  1XL7 A;  1EAE A;  2II4 A;  5KJV A;  1XMC A;  2VSQ A;  2BGH A;  5DU9 A;  3B2S A;  5DUA A;  1SCZ A;  4G0B A;  3MAE A;  4JN3 A;  1DPC A;  1QCA A;  3CLA A;  4JN5 A;  2XHG A;  3FOT A;  4KE4 A;  1CIA A;  5KJU A;  5FAL A;  2RKT A;  4N72 A;  2ZBA A;  1NOC B;  1L5A A;  1EAF A;  1XMD A;  2XR7 A;  2II3 A;  2RKV A;  1EAD A;  4G2M A;  5T3E A;  4CLA A;  3U9F A;  1EAA A;  2I9D A;  1DPB A;  2E1V A;  2CLA A;  2II5 A;  3FP0 A;  1EAB A;  2IHW A;  3U9B A;  1E2O A;  1DPD A;  1Q9J A;  1EAC A;  2E1T A;  1XL8 A;  1CLA A;  1C4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...