1CLAA

Evidence for transition-state stabilization by serine-148 in the catalytic mechanism of chloramphenicol acetyltransferase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
213
structure length
213
Chain Sequence
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNIAALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLLLPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (acyltransferase)
molecule keywords TYPE III CHLORAMPHENICOL ACETYLTRANSFERASE
publication title Evidence for transition-state stabilization by serine-148 in the catalytic mechanism of chloramphenicol acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
total genus 57
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1989-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1claA00
2E1TA 4CLAA 4G0BA 2E1UA 1EAFA 1CIAA 2E1VA 3L60A 1L5AA 3U9FA 2II3A 4KECA 5T3EA 2VSQA 4G22A 3B2SA 1XMDA 2IHWA 3CLAA 1Q23A 1EADA 1XL8A 1EABA 4N72A 2CLAA 1EAAA 4KE4A 4JN3A 2RKVA 4HVMA 1Q9JA 5KJVA 1XL7A 5FANA 1DPDA 3MAEA 3U9BA 2BGHA 2II5A 2II4A 2I9DA 5DU9A 5KJWA 5KJTA 1DPBA 1PD5A 2JGPA 2RKTA 2XHGA 1EACA 1NOCB 1E2OA 5FALA 3B30A 4JN5A 5KJUA 4G2MA 2XR7A 1C4TA 1CLAA 1EAEA 5DUAA 1SCZA 1QCAA 3FOTA 5KJSA 1XMCA 3FP0A 2ZBAA 1DPCA
chains in the Genus database with same CATH superfamily
2H4TA 1EAFA 5T3EA 1T7OA 1XMDA 1NDIA 1Q23A 1EADA 1EAAA 4HVMA 2H3WA 1XL7A 5KJTA 2FW3A 2RKTA 1EACA 2FY3A 2H3UA 3B30A 1NM8A 2FYOA 1CLAA 1SCZA 1T7QA 2E1TA 4G0BA 2E1VA 3U9FA 2FY4A 4KECA 2VSQA 4G22A 1EABA 4N72A 2RKVA 1Q9JA 5KJVA 2RCUA 2II5A 2XHGA 4JN5A 5DUAA 1S5OA 1XMCA 4CLAA 1CIAA 3B2SA 1XL8A 1T1UA 1Q6XA 4JN3A 5KJWA 2II4A 1DPBA 1PD5A 4EP9A 5FALA 5KJUA 1C4TA 1QCAA 3FOTA 3FP0A 2DEBA 2FY5A 1NDBA 2E1UA 3L60A 1L5AA 2II3A 2IHWA 3CLAA 1NDFA 1T7NA 2CLAA 4KE4A 4EYWA 4EPHA 5FANA 1DPDA 3MAEA 3U9BA 2BGHA 2I9DA 5DU9A 2H3PA 2FY2A 2JGPA 1NOCB 1E2OA 4G2MA 2XR7A 1EAEA 5KJSA 2ZBAA 1DPCA
chains in the Genus database with same CATH topology
2E1TA 4CLAA 4G0BA 2E1UA 1EAFA 1CIAA 2E1VA 3L60A 1L5AA 3U9FA 2II3A 4KECA 5T3EA 2VSQA 4G22A 3B2SA 1XMDA 2IHWA 3CLAA 1Q23A 1EADA 1XL8A 1EABA 4N72A 2CLAA 1EAAA 4KE4A 4JN3A 2RKVA 4HVMA 1Q9JA 5KJVA 1XL7A 5FANA 1DPDA 3MAEA 3U9BA 2BGHA 2II5A 2II4A 2I9DA 5DU9A 5KJWA 5KJTA 1DPBA 1PD5A 2JGPA 2RKTA 2XHGA 1EACA 1NOCB 1E2OA 5FALA 3B30A 4JN5A 5KJUA 4G2MA 2XR7A 1C4TA 1CLAA 1EAEA 5DUAA 1SCZA 1QCAA 3FOTA 5KJSA 1XMCA 3FP0A 2ZBAA 1DPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1T A;  4CLA A;  4G0B A;  2E1U A;  1EAF A;  1CIA A;  2E1V A;  3L60 A;  1L5A A;  3U9F A;  2II3 A;  4KEC A;  5T3E A;  2VSQ A;  4G22 A;  3B2S A;  1XMD A;  2IHW A;  3CLA A;  1Q23 A;  1EAD A;  1XL8 A;  1EAB A;  4N72 A;  2CLA A;  1EAA A;  4KE4 A;  4JN3 A;  2RKV A;  4HVM A;  1Q9J A;  5KJV A;  1XL7 A;  5FAN A;  1DPD A;  3MAE A;  3U9B A;  2BGH A;  2II5 A;  2II4 A;  2I9D A;  5DU9 A;  5KJW A;  5KJT A;  1DPB A;  1PD5 A;  2JGP A;  2RKT A;  2XHG A;  1EAC A;  1NOC B;  1E2O A;  5FAL A;  3B30 A;  4JN5 A;  5KJU A;  4G2M A;  2XR7 A;  1C4T A;  1CLA A;  1EAE A;  5DUA A;  1SCZ A;  1QCA A;  3FOT A;  5KJS A;  1XMC A;  3FP0 A;  2ZBA A;  1DPC A; 
#chains in the Genus database with same CATH topology
 2H4T A;  1EAF A;  5T3E A;  1T7O A;  1XMD A;  1NDI A;  1Q23 A;  1EAD A;  1EAA A;  4HVM A;  2H3W A;  1XL7 A;  5KJT A;  2FW3 A;  2RKT A;  1EAC A;  2FY3 A;  2H3U A;  3B30 A;  1NM8 A;  2FYO A;  1CLA A;  1SCZ A;  1T7Q A;  2E1T A;  4G0B A;  2E1V A;  3U9F A;  2FY4 A;  4KEC A;  2VSQ A;  4G22 A;  1EAB A;  4N72 A;  2RKV A;  1Q9J A;  5KJV A;  2RCU A;  2II5 A;  2XHG A;  4JN5 A;  5DUA A;  1S5O A;  1XMC A;  4CLA A;  1CIA A;  3B2S A;  1XL8 A;  1T1U A;  1Q6X A;  4JN3 A;  5KJW A;  2II4 A;  1DPB A;  1PD5 A;  4EP9 A;  5FAL A;  5KJU A;  1C4T A;  1QCA A;  3FOT A;  3FP0 A;  2DEB A;  2FY5 A;  1NDB A;  2E1U A;  3L60 A;  1L5A A;  2II3 A;  2IHW A;  3CLA A;  1NDF A;  1T7N A;  2CLA A;  4KE4 A;  4EYW A;  4EPH A;  5FAN A;  1DPD A;  3MAE A;  3U9B A;  2BGH A;  2I9D A;  5DU9 A;  2H3P A;  2FY2 A;  2JGP A;  1NOC B;  1E2O A;  4G2M A;  2XR7 A;  1EAE A;  5KJS A;  2ZBA A;  1DPC A; 
#chains in the Genus database with same CATH homology
 2E1T A;  4CLA A;  4G0B A;  2E1U A;  1EAF A;  1CIA A;  2E1V A;  3L60 A;  1L5A A;  3U9F A;  2II3 A;  4KEC A;  5T3E A;  2VSQ A;  4G22 A;  3B2S A;  1XMD A;  2IHW A;  3CLA A;  1Q23 A;  1EAD A;  1XL8 A;  1EAB A;  4N72 A;  2CLA A;  1EAA A;  4KE4 A;  4JN3 A;  2RKV A;  4HVM A;  1Q9J A;  5KJV A;  1XL7 A;  5FAN A;  1DPD A;  3MAE A;  3U9B A;  2BGH A;  2II5 A;  2II4 A;  2I9D A;  5DU9 A;  5KJW A;  5KJT A;  1DPB A;  1PD5 A;  2JGP A;  2RKT A;  2XHG A;  1EAC A;  1NOC B;  1E2O A;  5FAL A;  3B30 A;  4JN5 A;  5KJU A;  4G2M A;  2XR7 A;  1C4T A;  1CLA A;  1EAE A;  5DUA A;  1SCZ A;  1QCA A;  3FOT A;  5KJS A;  1XMC A;  3FP0 A;  2ZBA A;  1DPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...