1CLAA

Evidence for transition-state stabilization by serine-148 in the catalytic mechanism of chloramphenicol acetyltransferase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
213
structure length
213
Chain Sequence
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNIAALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLLLPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE III CHLORAMPHENICOL ACETYLTRANSFERASE
publication title Evidence for transition-state stabilization by serine-148 in the catalytic mechanism of chloramphenicol acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (acyltransferase)
total genus 57
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1989-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1claA00
3U9FA 1XL8A 4KECA 5KJSA 1QCAA 1EADA 5KJTA 2JGPA 1EACA 1Q23A 1Q9JA 2CLAA 2E1TA 2IHWA 3MAEA 1EABA 4G22A 4JN5A 2II5A 2XHGA 2II4A 1CLAA 3CLAA 3FP0A 3FOTA 5DU9A 5FALA 1EAEA 3B30A 1L5AA 5KJWA 2E1VA 1XL7A 3U9BA 5KJVA 1EAAA 1DPCA 5FANA 1CIAA 1XMDA 5KJUA 1DPBA 4HVMA 4G2MA 1C4TA 5DUAA 4JN3A 2RKVA 4G0BA 2I9DA 4N72A 4CLAA 2RKTA 1PD5A 2ZBAA 3B2SA 2E1UA 2II3A 5T3EA 1XMCA 1E2OA 3L60A 2XR7A 2VSQA 1NOCB 4KE4A 1DPDA 2BGHA 1SCZA 1EAFA
chains in the Genus database with same CATH superfamily
2FY5A 3U9FA 5KJSA 1EADA 2JGPA 2CLAA 1Q9JA 5KJUA 4JN5A 2FY3A 3MAEA 3U9BA 3CLAA 2II4A 1S5OA 1EAEA 3B30A 5FANA 1T7NA 4JN3A 1NDFA 4N72A 2FW3A 2II3A 2XR7A 1NOCB 4KECA 3FOTA 4EP9A 2E1VA 1XL7A 1EAAA 1DPCA 4HVMA 2FY4A 5DUAA 2RKVA 1NDBA 2I9DA 4CLAA 1PD5A 3B2SA 5T3EA 1T7QA 1T7OA 4KE4A 1DPDA 4EYWA 1QCAA 1Q23A 1EABA 2II5A 4EPHA 5FALA 1L5AA 2DEBA 1NM8A 1Q6XA 1DPBA 2FY2A 1C4TA 4G0BA 2FYOA 3L60A 2IHWA 1SCZA 1XL8A 2H3PA 5KJTA 1EACA 2E1TA 4G22A 2H4TA 2RCUA 2XHGA 5DU9A 1CLAA 3FP0A 5KJWA 1T1UA 5KJVA 1CIAA 1XMDA 4G2MA 2RKTA 2ZBAA 2E1UA 2H3UA 2H3WA 1XMCA 1E2OA 1NDIA 2VSQA 2BGHA 1EAFA
chains in the Genus database with same CATH topology
3U9FA 1XL8A 4KECA 5KJSA 1QCAA 1EADA 5KJTA 2JGPA 1EACA 1Q23A 1Q9JA 2CLAA 2E1TA 2IHWA 3MAEA 1EABA 4G22A 4JN5A 2II5A 2XHGA 2II4A 1CLAA 3CLAA 3FP0A 3FOTA 5DU9A 5FALA 1EAEA 3B30A 1L5AA 5KJWA 2E1VA 1XL7A 3U9BA 5KJVA 1EAAA 1DPCA 5FANA 1CIAA 1XMDA 5KJUA 1DPBA 4HVMA 4G2MA 1C4TA 5DUAA 4JN3A 2RKVA 4G0BA 2I9DA 4N72A 4CLAA 2RKTA 1PD5A 2ZBAA 3B2SA 2E1UA 2II3A 5T3EA 1XMCA 1E2OA 3L60A 2XR7A 2VSQA 1NOCB 4KE4A 1DPDA 2BGHA 1SCZA 1EAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9F A;  1XL8 A;  4KEC A;  5KJS A;  1QCA A;  1EAD A;  5KJT A;  2JGP A;  1EAC A;  1Q23 A;  1Q9J A;  2CLA A;  2E1T A;  2IHW A;  3MAE A;  1EAB A;  4G22 A;  4JN5 A;  2II5 A;  2XHG A;  2II4 A;  1CLA A;  3CLA A;  3FP0 A;  3FOT A;  5DU9 A;  5FAL A;  1EAE A;  3B30 A;  1L5A A;  5KJW A;  2E1V A;  1XL7 A;  3U9B A;  5KJV A;  1EAA A;  1DPC A;  5FAN A;  1CIA A;  1XMD A;  5KJU A;  1DPB A;  4HVM A;  4G2M A;  1C4T A;  5DUA A;  4JN3 A;  2RKV A;  4G0B A;  2I9D A;  4N72 A;  4CLA A;  2RKT A;  1PD5 A;  2ZBA A;  3B2S A;  2E1U A;  2II3 A;  5T3E A;  1XMC A;  1E2O A;  3L60 A;  2XR7 A;  2VSQ A;  1NOC B;  4KE4 A;  1DPD A;  2BGH A;  1SCZ A;  1EAF A; 
#chains in the Genus database with same CATH topology
 2FY5 A;  3U9F A;  5KJS A;  1EAD A;  2JGP A;  2CLA A;  1Q9J A;  5KJU A;  4JN5 A;  2FY3 A;  3MAE A;  3U9B A;  3CLA A;  2II4 A;  1S5O A;  1EAE A;  3B30 A;  5FAN A;  1T7N A;  4JN3 A;  1NDF A;  4N72 A;  2FW3 A;  2II3 A;  2XR7 A;  1NOC B;  4KEC A;  3FOT A;  4EP9 A;  2E1V A;  1XL7 A;  1EAA A;  1DPC A;  4HVM A;  2FY4 A;  5DUA A;  2RKV A;  1NDB A;  2I9D A;  4CLA A;  1PD5 A;  3B2S A;  5T3E A;  1T7Q A;  1T7O A;  4KE4 A;  1DPD A;  4EYW A;  1QCA A;  1Q23 A;  1EAB A;  2II5 A;  4EPH A;  5FAL A;  1L5A A;  2DEB A;  1NM8 A;  1Q6X A;  1DPB A;  2FY2 A;  1C4T A;  4G0B A;  2FYO A;  3L60 A;  2IHW A;  1SCZ A;  1XL8 A;  2H3P A;  5KJT A;  1EAC A;  2E1T A;  4G22 A;  2H4T A;  2RCU A;  2XHG A;  5DU9 A;  1CLA A;  3FP0 A;  5KJW A;  1T1U A;  5KJV A;  1CIA A;  1XMD A;  4G2M A;  2RKT A;  2ZBA A;  2E1U A;  2H3U A;  2H3W A;  1XMC A;  1E2O A;  1NDI A;  2VSQ A;  2BGH A;  1EAF A; 
#chains in the Genus database with same CATH homology
 3U9F A;  1XL8 A;  4KEC A;  5KJS A;  1QCA A;  1EAD A;  5KJT A;  2JGP A;  1EAC A;  1Q23 A;  1Q9J A;  2CLA A;  2E1T A;  2IHW A;  3MAE A;  1EAB A;  4G22 A;  4JN5 A;  2II5 A;  2XHG A;  2II4 A;  1CLA A;  3CLA A;  3FP0 A;  3FOT A;  5DU9 A;  5FAL A;  1EAE A;  3B30 A;  1L5A A;  5KJW A;  2E1V A;  1XL7 A;  3U9B A;  5KJV A;  1EAA A;  1DPC A;  5FAN A;  1CIA A;  1XMD A;  5KJU A;  1DPB A;  4HVM A;  4G2M A;  1C4T A;  5DUA A;  4JN3 A;  2RKV A;  4G0B A;  2I9D A;  4N72 A;  4CLA A;  2RKT A;  1PD5 A;  2ZBA A;  3B2S A;  2E1U A;  2II3 A;  5T3E A;  1XMC A;  1E2O A;  3L60 A;  2XR7 A;  2VSQ A;  1NOC B;  4KE4 A;  1DPD A;  2BGH A;  1SCZ A;  1EAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...