4G22A

Structure of a lys-hct mutant from coffea canephora (crystal form 1)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
434
structure length
417
Chain Sequence
MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
publication title A structural basis for the biosynthesis of the major chlorogenic acids found in coffee.
pubmed doi rcsb
source organism Coffea canephora
total genus 124
structure length 417
sequence length 434
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g22A02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g22A01
4CLAA 4JN5A 1CIAA 3CLAA 2ZBAA 5KJWA 2II5A 2IHWA 2II4A 5FALA 1XMDA 2RKVA 3B30A 4KE4A 4G0BA 2E1TA 1L5AA 1PD5A 1EABA 1EAAA 2CLAA 1XL7A 2XHGA 4G2MA 2I9DA 4N72A 2RKTA 5DUAA 3U9BA 1SCZA 1E2OA 1NOCB 1DPBA 1EADA 1EAFA 2E1UA 5T3EA 5KJSA 2JGPA 5KJVA 1Q23A 5KJTA 5KJUA 2BGHA 2VSQA 2E1VA 3MAEA 3U9FA 1EAEA 3L60A 4JN3A 5FANA 1QCAA 1XL8A 1XMCA 3B2SA 2XR7A 4KECA 3FP0A 1Q9JA 1C4TA 4G22A 3FOTA 1EACA 2II3A 1CLAA 1DPDA 1DPCA 4HVMA 5DU9A
chains in the Genus database with same CATH superfamily
1T7QA 1CIAA 1Q6XA 2FY4A 4KE4A 2FY2A 4G0BA 2XHGA 3U9FA 2CLAA 2I9DA 1E2OA 1NOCB 1DPBA 2E1UA 2DEBA 2JGPA 2VSQA 1EAEA 3L60A 4EP9A 2H4TA 4G22A 1NDFA 3FOTA 1EACA 1DPDA 4HVMA 3CLAA 2H3WA 2ZBAA 5KJWA 1PD5A 2FW3A 1Q23A 5KJUA 4JN3A 1QCAA 1XMCA 5DU9A 4CLAA 4JN5A 2II5A 2IHWA 2II4A 5FALA 2RKVA 1NDIA 2H3PA 1L5AA 1EABA 1EAAA 4EYWA 3U9BA 2FY3A 2FYOA 5KJSA 1EADA 1EAFA 5T3EA 5KJVA 2BGHA 2E1VA 1T7NA 3MAEA 1NM8A 1NDBA 3B2SA 1Q9JA 1C4TA 1DPCA 1S5OA 1T1UA 2FY5A 1XMDA 3B30A 2E1TA 4N72A 1XL7A 4G2MA 2RKTA 5DUAA 1SCZA 5KJTA 5FANA 1XL8A 2XR7A 4KECA 2RCUA 3FP0A 2H3UA 4EPHA 2II3A 1CLAA 1T7OA
chains in the Genus database with same CATH topology
4CLAA 4JN5A 1CIAA 3CLAA 2ZBAA 5KJWA 2II5A 2IHWA 2II4A 5FALA 1XMDA 2RKVA 3B30A 4KE4A 4G0BA 2E1TA 1L5AA 1PD5A 1EABA 1EAAA 2CLAA 1XL7A 2XHGA 4G2MA 2I9DA 4N72A 2RKTA 5DUAA 3U9BA 1SCZA 1E2OA 1NOCB 1DPBA 1EADA 1EAFA 2E1UA 5T3EA 5KJSA 2JGPA 5KJVA 1Q23A 5KJTA 5KJUA 2BGHA 2VSQA 2E1VA 3MAEA 3U9FA 1EAEA 3L60A 4JN3A 5FANA 1QCAA 1XL8A 1XMCA 3B2SA 2XR7A 4KECA 3FP0A 1Q9JA 1C4TA 4G22A 3FOTA 1EACA 2II3A 1CLAA 1DPDA 1DPCA 4HVMA 5DU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLA A;  4JN5 A;  1CIA A;  3CLA A;  2ZBA A;  5KJW A;  2II5 A;  2IHW A;  2II4 A;  5FAL A;  1XMD A;  2RKV A;  3B30 A;  4KE4 A;  4G0B A;  2E1T A;  1L5A A;  1PD5 A;  1EAB A;  1EAA A;  2CLA A;  1XL7 A;  2XHG A;  4G2M A;  2I9D A;  4N72 A;  2RKT A;  5DUA A;  3U9B A;  1SCZ A;  1E2O A;  1NOC B;  1DPB A;  1EAD A;  1EAF A;  2E1U A;  5T3E A;  5KJS A;  2JGP A;  5KJV A;  1Q23 A;  5KJT A;  5KJU A;  2BGH A;  2VSQ A;  2E1V A;  3MAE A;  3U9F A;  1EAE A;  3L60 A;  4JN3 A;  5FAN A;  1QCA A;  1XL8 A;  1XMC A;  3B2S A;  2XR7 A;  4KEC A;  3FP0 A;  1Q9J A;  1C4T A;  4G22 A;  3FOT A;  1EAC A;  2II3 A;  1CLA A;  1DPD A;  1DPC A;  4HVM A;  5DU9 A; 
#chains in the Genus database with same CATH topology
 1T7Q A;  1CIA A;  1Q6X A;  2FY4 A;  4KE4 A;  2FY2 A;  4G0B A;  2XHG A;  3U9F A;  2CLA A;  2I9D A;  1E2O A;  1NOC B;  1DPB A;  2E1U A;  2DEB A;  2JGP A;  2VSQ A;  1EAE A;  3L60 A;  4EP9 A;  2H4T A;  4G22 A;  1NDF A;  3FOT A;  1EAC A;  1DPD A;  4HVM A;  3CLA A;  2H3W A;  2ZBA A;  5KJW A;  1PD5 A;  2FW3 A;  1Q23 A;  5KJU A;  4JN3 A;  1QCA A;  1XMC A;  5DU9 A;  4CLA A;  4JN5 A;  2II5 A;  2IHW A;  2II4 A;  5FAL A;  2RKV A;  1NDI A;  2H3P A;  1L5A A;  1EAB A;  1EAA A;  4EYW A;  3U9B A;  2FY3 A;  2FYO A;  5KJS A;  1EAD A;  1EAF A;  5T3E A;  5KJV A;  2BGH A;  2E1V A;  1T7N A;  3MAE A;  1NM8 A;  1NDB A;  3B2S A;  1Q9J A;  1C4T A;  1DPC A;  1S5O A;  1T1U A;  2FY5 A;  1XMD A;  3B30 A;  2E1T A;  4N72 A;  1XL7 A;  4G2M A;  2RKT A;  5DUA A;  1SCZ A;  5KJT A;  5FAN A;  1XL8 A;  2XR7 A;  4KEC A;  2RCU A;  3FP0 A;  2H3U A;  4EPH A;  2II3 A;  1CLA A;  1T7O A; 
#chains in the Genus database with same CATH homology
 4CLA A;  4JN5 A;  1CIA A;  3CLA A;  2ZBA A;  5KJW A;  2II5 A;  2IHW A;  2II4 A;  5FAL A;  1XMD A;  2RKV A;  3B30 A;  4KE4 A;  4G0B A;  2E1T A;  1L5A A;  1PD5 A;  1EAB A;  1EAA A;  2CLA A;  1XL7 A;  2XHG A;  4G2M A;  2I9D A;  4N72 A;  2RKT A;  5DUA A;  3U9B A;  1SCZ A;  1E2O A;  1NOC B;  1DPB A;  1EAD A;  1EAF A;  2E1U A;  5T3E A;  5KJS A;  2JGP A;  5KJV A;  1Q23 A;  5KJT A;  5KJU A;  2BGH A;  2VSQ A;  2E1V A;  3MAE A;  3U9F A;  1EAE A;  3L60 A;  4JN3 A;  5FAN A;  1QCA A;  1XL8 A;  1XMC A;  3B2S A;  2XR7 A;  4KEC A;  3FP0 A;  1Q9J A;  1C4T A;  4G22 A;  3FOT A;  1EAC A;  2II3 A;  1CLA A;  1DPD A;  1DPC A;  4HVM A;  5DU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...