4G22A

Structure of a lys-hct mutant from coffea canephora (crystal form 1)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
434
structure length
417
Chain Sequence
MKIEVKESTMVRPAQETPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVLKDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRRLIPAVDYSQGISSYALLVLQVTYFKGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLDVTLPPFIDRTLLRARDPPQPQFQHIEYQPPPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
publication title A structural basis for the biosynthesis of the major chlorogenic acids found in coffee.
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
total genus 124
structure length 417
sequence length 434
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g22A02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 4g22A01
1Q9JA 1EADA 1EACA 1XL7A 2VSQA 5KJTA 5DU9A 2JGPA 2XHGA 1Q23A 1EAAA 1PD5A 1QCAA 2E1VA 2E1TA 2RKTA 1C4TA 1CIAA 3L60A 3U9BA 4CLAA 2IHWA 1EAFA 4KE4A 2RKVA 1CLAA 1EABA 1E2OA 1EAEA 1DPDA 2I9DA 1DPCA 3B2SA 3FP0A 5KJWA 5FALA 5KJSA 3U9FA 4KECA 3FOTA 5KJVA 2ZBAA 4G0BA 1SCZA 1XMDA 3CLAA 1DPBA 1XMCA 2E1UA 4G22A 1L5AA 4HVMA 2BGHA 4JN3A 5T3EA 2CLAA 1XL8A 1NOCB 4G2MA 4N72A 5FANA 2II4A 3B30A 2II5A 3MAEA 4JN5A 5KJUA 5DUAA 2XR7A 2II3A
chains in the Genus database with same CATH superfamily
2FY2A 1Q23A 2H3PA 1PD5A 2E1TA 2E1VA 3L60A 3FP0A 5KJWA 2FYOA 1DPCA 5KJSA 4KECA 3CLAA 1DPBA 1XMCA 2E1UA 2BGHA 1T1UA 5T3EA 2FY3A 4N72A 2FY5A 2II4A 3B30A 2II3A 5DU9A 2DEBA 1T7NA 3U9BA 4CLAA 1CLAA 1EABA 1DPDA 5FALA 3FOTA 1T7QA 2RCUA 4G22A 1L5AA 2H4TA 5KJUA 2II5A 1S5OA 5DUAA 2XR7A 1Q9JA 1EADA 1XL7A 2VSQA 5KJTA 2RKTA 1C4TA 1NDBA 2IHWA 4KE4A 1E2OA 1EAEA 2H3UA 3U9FA 5KJVA 4G0BA 1XMDA 2H3WA 4HVMA 1NDFA 2CLAA 4JN5A 1EACA 1T7OA 2JGPA 2XHGA 1NM8A 2FY4A 1EAAA 1QCAA 1CIAA 2FW3A 1EAFA 1NDIA 2RKVA 3B2SA 2I9DA 2ZBAA 1SCZA 4EPHA 4EYWA 4JN3A 1XL8A 1NOCB 1Q6XA 4G2MA 5FANA 4EP9A 3MAEA
chains in the Genus database with same CATH topology
1Q9JA 1EADA 1EACA 1XL7A 2VSQA 5KJTA 5DU9A 2JGPA 2XHGA 1Q23A 1EAAA 1PD5A 1QCAA 2E1VA 2E1TA 2RKTA 1C4TA 1CIAA 3L60A 3U9BA 4CLAA 2IHWA 1EAFA 4KE4A 2RKVA 1CLAA 1EABA 1E2OA 1EAEA 1DPDA 2I9DA 1DPCA 3B2SA 3FP0A 5KJWA 5FALA 5KJSA 3U9FA 4KECA 3FOTA 5KJVA 2ZBAA 4G0BA 1SCZA 1XMDA 3CLAA 1DPBA 1XMCA 2E1UA 4G22A 1L5AA 4HVMA 2BGHA 4JN3A 5T3EA 2CLAA 1XL8A 1NOCB 4G2MA 4N72A 5FANA 2II4A 3B30A 2II5A 3MAEA 4JN5A 5KJUA 5DUAA 2XR7A 2II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9J A;  1EAD A;  1EAC A;  1XL7 A;  2VSQ A;  5KJT A;  5DU9 A;  2JGP A;  2XHG A;  1Q23 A;  1EAA A;  1PD5 A;  1QCA A;  2E1V A;  2E1T A;  2RKT A;  1C4T A;  1CIA A;  3L60 A;  3U9B A;  4CLA A;  2IHW A;  1EAF A;  4KE4 A;  2RKV A;  1CLA A;  1EAB A;  1E2O A;  1EAE A;  1DPD A;  2I9D A;  1DPC A;  3B2S A;  3FP0 A;  5KJW A;  5FAL A;  5KJS A;  3U9F A;  4KEC A;  3FOT A;  5KJV A;  2ZBA A;  4G0B A;  1SCZ A;  1XMD A;  3CLA A;  1DPB A;  1XMC A;  2E1U A;  4G22 A;  1L5A A;  4HVM A;  2BGH A;  4JN3 A;  5T3E A;  2CLA A;  1XL8 A;  1NOC B;  4G2M A;  4N72 A;  5FAN A;  2II4 A;  3B30 A;  2II5 A;  3MAE A;  4JN5 A;  5KJU A;  5DUA A;  2XR7 A;  2II3 A; 
#chains in the Genus database with same CATH topology
 2FY2 A;  1Q23 A;  2H3P A;  1PD5 A;  2E1T A;  2E1V A;  3L60 A;  3FP0 A;  5KJW A;  2FYO A;  1DPC A;  5KJS A;  4KEC A;  3CLA A;  1DPB A;  1XMC A;  2E1U A;  2BGH A;  1T1U A;  5T3E A;  2FY3 A;  4N72 A;  2FY5 A;  2II4 A;  3B30 A;  2II3 A;  5DU9 A;  2DEB A;  1T7N A;  3U9B A;  4CLA A;  1CLA A;  1EAB A;  1DPD A;  5FAL A;  3FOT A;  1T7Q A;  2RCU A;  4G22 A;  1L5A A;  2H4T A;  5KJU A;  2II5 A;  1S5O A;  5DUA A;  2XR7 A;  1Q9J A;  1EAD A;  1XL7 A;  2VSQ A;  5KJT A;  2RKT A;  1C4T A;  1NDB A;  2IHW A;  4KE4 A;  1E2O A;  1EAE A;  2H3U A;  3U9F A;  5KJV A;  4G0B A;  1XMD A;  2H3W A;  4HVM A;  1NDF A;  2CLA A;  4JN5 A;  1EAC A;  1T7O A;  2JGP A;  2XHG A;  1NM8 A;  2FY4 A;  1EAA A;  1QCA A;  1CIA A;  2FW3 A;  1EAF A;  1NDI A;  2RKV A;  3B2S A;  2I9D A;  2ZBA A;  1SCZ A;  4EPH A;  4EYW A;  4JN3 A;  1XL8 A;  1NOC B;  1Q6X A;  4G2M A;  5FAN A;  4EP9 A;  3MAE A; 
#chains in the Genus database with same CATH homology
 1Q9J A;  1EAD A;  1EAC A;  1XL7 A;  2VSQ A;  5KJT A;  5DU9 A;  2JGP A;  2XHG A;  1Q23 A;  1EAA A;  1PD5 A;  1QCA A;  2E1V A;  2E1T A;  2RKT A;  1C4T A;  1CIA A;  3L60 A;  3U9B A;  4CLA A;  2IHW A;  1EAF A;  4KE4 A;  2RKV A;  1CLA A;  1EAB A;  1E2O A;  1EAE A;  1DPD A;  2I9D A;  1DPC A;  3B2S A;  3FP0 A;  5KJW A;  5FAL A;  5KJS A;  3U9F A;  4KEC A;  3FOT A;  5KJV A;  2ZBA A;  4G0B A;  1SCZ A;  1XMD A;  3CLA A;  1DPB A;  1XMC A;  2E1U A;  4G22 A;  1L5A A;  4HVM A;  2BGH A;  4JN3 A;  5T3E A;  2CLA A;  1XL8 A;  1NOC B;  4G2M A;  4N72 A;  5FAN A;  2II4 A;  3B30 A;  2II5 A;  3MAE A;  4JN5 A;  5KJU A;  5DUA A;  2XR7 A;  2II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...