2ZBAA

Crystal structure of f. sporotrichioides tri101 complexed with coenzyme a and t-2
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
449
structure length
435
Chain Sequence
SFDIELDIIGQQPPLLSIYTQISLVYPVSDPSQYPTIVSTLEEGLKRLSQTFPWVAGQVKTEGISEGNTGTSKIIPYEETPRLVVKDLRDSAPTIEGLRKAGFPLEMFDENVVAPRKTLAIGPGPNDPKPVLLLQLNFIKGGLILTVNGQHGAMDMTGQDAIIRLLSKACRNESFTEEEISAMNLDRKTVVPLLENYKVGPELDHQIAKPAKATWAFFSFTPKALSELKDAATKTLDASSKFVSTDDALSAFIWQSTSRVRLARLDASTPTEFCRAVDMRGPMGVSSTYPGLLQNMTYHDSTVAEIANEPLGATASRLRSELNSDRLRRRTQALATYMHGLPDKSSVSLTADANPSSSIMLSSWAKVGCWEYDFGFGLGKPESVRRPRFEPFESLMYFMPKKPDGEFTASISLRDEDMERLKADEEWTKYAKYIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Fusarium sporotrichioides
molecule tags Transferase
total genus 136
structure length 435
sequence length 449
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2zbaA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2zbaA02
5DUAA 5FALA 1C4TA 1DPDA 5KJTA 2I9DA 1Q23A 4CLAA 1XL7A 1EAAA 2RKTA 3B2SA 5KJVA 1XMDA 1NOCB 1XMCA 2JGPA 4HVMA 2II4A 5KJSA 2VSQA 4KE4A 1EADA 1CIAA 2E1UA 4JN3A 2BGHA 2IHWA 2RKVA 1CLAA 3L60A 1EAFA 4G0BA 4G22A 1EABA 3CLAA 1Q9JA 5T3EA 2CLAA 3MAEA 4JN5A 1EACA 3FOTA 1DPBA 1EAEA 1L5AA 3U9FA 1QCAA 2XHGA 3B30A 5FANA 1DPCA 2E1TA 1XL8A 2ZBAA 5KJUA 5DU9A 2E1VA 4KECA 4G2MA 2II5A 3U9BA 1E2OA 2II3A 4N72A 3FP0A 2XR7A 1PD5A 1SCZA 5KJWA
chains in the Genus database with same CATH superfamily
1T7QA 5FALA 5KJTA 1XL7A 1NDBA 4JN3A 2RCUA 4G0BA 1Q9JA 2CLAA 1L5AA 2H4TA 1S5OA 5FANA 2E1TA 4EPHA 2FY3A 2FYOA 1E2OA 1T7NA 5T3EA 1C4TA 1Q23A 5KJVA 2FW3A 5KJSA 2E1UA 2IHWA 1EABA 1EACA 1EAEA 4EP9A 1T1UA 2FY2A 1QCAA 1T7OA 2XHGA 2ZBAA 5DU9A 2E1VA 4N72A 4EYWA 5DUAA 1Q6XA 1EAAA 2RKTA 3B2SA 2FY4A 1XMDA 1NOCB 2JGPA 4HVMA 2VSQA 1EADA 1CIAA 2RKVA 3L60A 4G22A 2H3UA 2DEBA 3CLAA 4JN5A 3FOTA 3B30A 1NDFA 2H3WA 1XL8A 5KJUA 2II5A 2FY5A 3U9BA 1PD5A 1NDIA 1DPDA 2I9DA 4CLAA 1XMCA 2II4A 4KE4A 2BGHA 1CLAA 1EAFA 3MAEA 3U9FA 1DPBA 2H3PA 1DPCA 4KECA 4G2MA 2II3A 3FP0A 2XR7A 1NM8A 1SCZA 5KJWA
chains in the Genus database with same CATH topology
5DUAA 5FALA 1C4TA 1DPDA 5KJTA 2I9DA 1Q23A 4CLAA 1XL7A 1EAAA 2RKTA 3B2SA 5KJVA 1XMDA 1NOCB 1XMCA 2JGPA 4HVMA 2II4A 5KJSA 2VSQA 4KE4A 1EADA 1CIAA 2E1UA 4JN3A 2BGHA 2IHWA 2RKVA 1CLAA 3L60A 1EAFA 4G0BA 4G22A 1EABA 3CLAA 1Q9JA 5T3EA 2CLAA 3MAEA 4JN5A 1EACA 3FOTA 1DPBA 1EAEA 1L5AA 3U9FA 1QCAA 2XHGA 3B30A 5FANA 1DPCA 2E1TA 1XL8A 2ZBAA 5KJUA 5DU9A 2E1VA 4KECA 4G2MA 2II5A 3U9BA 1E2OA 2II3A 4N72A 3FP0A 2XR7A 1PD5A 1SCZA 5KJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DUA A;  5FAL A;  1C4T A;  1DPD A;  5KJT A;  2I9D A;  1Q23 A;  4CLA A;  1XL7 A;  1EAA A;  2RKT A;  3B2S A;  5KJV A;  1XMD A;  1NOC B;  1XMC A;  2JGP A;  4HVM A;  2II4 A;  5KJS A;  2VSQ A;  4KE4 A;  1EAD A;  1CIA A;  2E1U A;  4JN3 A;  2BGH A;  2IHW A;  2RKV A;  1CLA A;  3L60 A;  1EAF A;  4G0B A;  4G22 A;  1EAB A;  3CLA A;  1Q9J A;  5T3E A;  2CLA A;  3MAE A;  4JN5 A;  1EAC A;  3FOT A;  1DPB A;  1EAE A;  1L5A A;  3U9F A;  1QCA A;  2XHG A;  3B30 A;  5FAN A;  1DPC A;  2E1T A;  1XL8 A;  2ZBA A;  5KJU A;  5DU9 A;  2E1V A;  4KEC A;  4G2M A;  2II5 A;  3U9B A;  1E2O A;  2II3 A;  4N72 A;  3FP0 A;  2XR7 A;  1PD5 A;  1SCZ A;  5KJW A; 
#chains in the Genus database with same CATH topology
 1T7Q A;  5FAL A;  5KJT A;  1XL7 A;  1NDB A;  4JN3 A;  2RCU A;  4G0B A;  1Q9J A;  2CLA A;  1L5A A;  2H4T A;  1S5O A;  5FAN A;  2E1T A;  4EPH A;  2FY3 A;  2FYO A;  1E2O A;  1T7N A;  5T3E A;  1C4T A;  1Q23 A;  5KJV A;  2FW3 A;  5KJS A;  2E1U A;  2IHW A;  1EAB A;  1EAC A;  1EAE A;  4EP9 A;  1T1U A;  2FY2 A;  1QCA A;  1T7O A;  2XHG A;  2ZBA A;  5DU9 A;  2E1V A;  4N72 A;  4EYW A;  5DUA A;  1Q6X A;  1EAA A;  2RKT A;  3B2S A;  2FY4 A;  1XMD A;  1NOC B;  2JGP A;  4HVM A;  2VSQ A;  1EAD A;  1CIA A;  2RKV A;  3L60 A;  4G22 A;  2H3U A;  2DEB A;  3CLA A;  4JN5 A;  3FOT A;  3B30 A;  1NDF A;  2H3W A;  1XL8 A;  5KJU A;  2II5 A;  2FY5 A;  3U9B A;  1PD5 A;  1NDI A;  1DPD A;  2I9D A;  4CLA A;  1XMC A;  2II4 A;  4KE4 A;  2BGH A;  1CLA A;  1EAF A;  3MAE A;  3U9F A;  1DPB A;  2H3P A;  1DPC A;  4KEC A;  4G2M A;  2II3 A;  3FP0 A;  2XR7 A;  1NM8 A;  1SCZ A;  5KJW A; 
#chains in the Genus database with same CATH homology
 5DUA A;  5FAL A;  1C4T A;  1DPD A;  5KJT A;  2I9D A;  1Q23 A;  4CLA A;  1XL7 A;  1EAA A;  2RKT A;  3B2S A;  5KJV A;  1XMD A;  1NOC B;  1XMC A;  2JGP A;  4HVM A;  2II4 A;  5KJS A;  2VSQ A;  4KE4 A;  1EAD A;  1CIA A;  2E1U A;  4JN3 A;  2BGH A;  2IHW A;  2RKV A;  1CLA A;  3L60 A;  1EAF A;  4G0B A;  4G22 A;  1EAB A;  3CLA A;  1Q9J A;  5T3E A;  2CLA A;  3MAE A;  4JN5 A;  1EAC A;  3FOT A;  1DPB A;  1EAE A;  1L5A A;  3U9F A;  1QCA A;  2XHG A;  3B30 A;  5FAN A;  1DPC A;  2E1T A;  1XL8 A;  2ZBA A;  5KJU A;  5DU9 A;  2E1V A;  4KEC A;  4G2M A;  2II5 A;  3U9B A;  1E2O A;  2II3 A;  4N72 A;  3FP0 A;  2XR7 A;  1PD5 A;  1SCZ A;  5KJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...