2ZBAA

Crystal structure of f. sporotrichioides tri101 complexed with coenzyme a and t-2
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
449
structure length
435
Chain Sequence
SFDIELDIIGQQPPLLSIYTQISLVYPVSDPSQYPTIVSTLEEGLKRLSQTFPWVAGQVKTEGISEGNTGTSKIIPYEETPRLVVKDLRDSAPTIEGLRKAGFPLEMFDENVVAPRKTLAIGPGPNDPKPVLLLQLNFIKGGLILTVNGQHGAMDMTGQDAIIRLLSKACRNESFTEEEISAMNLDRKTVVPLLENYKVGPELDHQIAKPAKATWAFFSFTPKALSELKDAATKTLDASSKFVSTDDALSAFIWQSTSRVRLARLDASTPTEFCRAVDMRGPMGVSSTYPGLLQNMTYHDSTVAEIANEPLGATASRLRSELNSDRLRRRTQALATYMHGLPDKSSVSLTADANPSSSIMLSSWAKVGCWEYDFGFGLGKPESVRRPRFEPFESLMYFMPKKPDGEFTASISLRDEDMERLKADEEWTKYAKYIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Fusarium sporotrichioides
total genus 136
structure length 435
sequence length 449
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2zbaA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2zbaA02
3U9FA 2IHWA 4CLAA 2E1UA 5DU9A 3U9BA 5FANA 2XR7A 2RKTA 5KJVA 1Q9JA 1SCZA 1XL7A 2XHGA 3FP0A 1Q23A 2RKVA 1EACA 1NOCB 4KECA 1DPBA 2BGHA 4G0BA 1XMCA 1XMDA 4HVMA 1QCAA 2CLAA 2E1VA 4KE4A 5KJUA 5KJTA 2I9DA 1DPDA 1PD5A 4JN3A 1DPCA 5FALA 3MAEA 3B30A 3CLAA 4G2MA 5KJWA 5DUAA 5KJSA 1EAAA 4JN5A 3L60A 1EAEA 1EADA 4G22A 1CIAA 2ZBAA 3FOTA 4N72A 1EABA 2II4A 1E2OA 1XL8A 1C4TA 3B2SA 5T3EA 2II3A 1L5AA 2VSQA 1EAFA 1CLAA 2JGPA 2II5A 2E1TA
chains in the Genus database with same CATH superfamily
4CLAA 2E1UA 4EP9A 1XMCA 4HVMA 2CLAA 5KJUA 1EAFA 5KJSA 4JN5A 1EAEA 4G22A 4N72A 1EABA 3B2SA 1C4TA 2H3WA 1T7QA 1NDBA 1L5AA 2FY5A 1CLAA 1T7OA 2IHWA 1NM8A 5DU9A 3U9BA 2RKTA 1SCZA 3FP0A 1EACA 5KJTA 4JN3A 2H3UA 3B30A 2FY3A 5KJWA 1Q6XA 1EAAA 1T7NA 1EADA 3FOTA 1XL8A 2FYOA 2JGPA 2II5A 2XR7A 5KJVA 1NDFA 1Q9JA 1XL7A 2XHGA 1T1UA 1Q23A 2RKVA 4KECA 1DPBA 4G0BA 1QCAA 4KE4A 1DPDA 1DPCA 3MAEA 4G2MA 3U9FA 2H3PA 2II4A 2II3A 4EPHA 2VSQA 2FY2A 5FANA 2FW3A 1NDIA 1NOCB 2RCUA 2BGHA 2DEBA 1XMDA 2E1VA 2I9DA 1PD5A 4EYWA 1S5OA 5FALA 5DUAA 2FY4A 3L60A 1CIAA 2ZBAA 1E2OA 5T3EA 3CLAA 2H4TA 2E1TA
chains in the Genus database with same CATH topology
3U9FA 2IHWA 4CLAA 2E1UA 5DU9A 3U9BA 5FANA 2XR7A 2RKTA 5KJVA 1Q9JA 1SCZA 1XL7A 2XHGA 3FP0A 1Q23A 2RKVA 1EACA 1NOCB 4KECA 1DPBA 2BGHA 4G0BA 1XMCA 1XMDA 4HVMA 1QCAA 2CLAA 2E1VA 4KE4A 5KJUA 5KJTA 2I9DA 1DPDA 1PD5A 4JN3A 1DPCA 5FALA 3MAEA 3B30A 3CLAA 4G2MA 5KJWA 5DUAA 5KJSA 1EAAA 4JN5A 3L60A 1EAEA 1EADA 4G22A 1CIAA 2ZBAA 3FOTA 4N72A 1EABA 2II4A 1E2OA 1XL8A 1C4TA 3B2SA 5T3EA 2II3A 1L5AA 2VSQA 1EAFA 1CLAA 2JGPA 2II5A 2E1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9F A;  2IHW A;  4CLA A;  2E1U A;  5DU9 A;  3U9B A;  5FAN A;  2XR7 A;  2RKT A;  5KJV A;  1Q9J A;  1SCZ A;  1XL7 A;  2XHG A;  3FP0 A;  1Q23 A;  2RKV A;  1EAC A;  1NOC B;  4KEC A;  1DPB A;  2BGH A;  4G0B A;  1XMC A;  1XMD A;  4HVM A;  1QCA A;  2CLA A;  2E1V A;  4KE4 A;  5KJU A;  5KJT A;  2I9D A;  1DPD A;  1PD5 A;  4JN3 A;  1DPC A;  5FAL A;  3MAE A;  3B30 A;  3CLA A;  4G2M A;  5KJW A;  5DUA A;  5KJS A;  1EAA A;  4JN5 A;  3L60 A;  1EAE A;  1EAD A;  4G22 A;  1CIA A;  2ZBA A;  3FOT A;  4N72 A;  1EAB A;  2II4 A;  1E2O A;  1XL8 A;  1C4T A;  3B2S A;  5T3E A;  2II3 A;  1L5A A;  2VSQ A;  1EAF A;  1CLA A;  2JGP A;  2II5 A;  2E1T A; 
#chains in the Genus database with same CATH topology
 4CLA A;  2E1U A;  4EP9 A;  1XMC A;  4HVM A;  2CLA A;  5KJU A;  1EAF A;  5KJS A;  4JN5 A;  1EAE A;  4G22 A;  4N72 A;  1EAB A;  3B2S A;  1C4T A;  2H3W A;  1T7Q A;  1NDB A;  1L5A A;  2FY5 A;  1CLA A;  1T7O A;  2IHW A;  1NM8 A;  5DU9 A;  3U9B A;  2RKT A;  1SCZ A;  3FP0 A;  1EAC A;  5KJT A;  4JN3 A;  2H3U A;  3B30 A;  2FY3 A;  5KJW A;  1Q6X A;  1EAA A;  1T7N A;  1EAD A;  3FOT A;  1XL8 A;  2FYO A;  2JGP A;  2II5 A;  2XR7 A;  5KJV A;  1NDF A;  1Q9J A;  1XL7 A;  2XHG A;  1T1U A;  1Q23 A;  2RKV A;  4KEC A;  1DPB A;  4G0B A;  1QCA A;  4KE4 A;  1DPD A;  1DPC A;  3MAE A;  4G2M A;  3U9F A;  2H3P A;  2II4 A;  2II3 A;  4EPH A;  2VSQ A;  2FY2 A;  5FAN A;  2FW3 A;  1NDI A;  1NOC B;  2RCU A;  2BGH A;  2DEB A;  1XMD A;  2E1V A;  2I9D A;  1PD5 A;  4EYW A;  1S5O A;  5FAL A;  5DUA A;  2FY4 A;  3L60 A;  1CIA A;  2ZBA A;  1E2O A;  5T3E A;  3CLA A;  2H4T A;  2E1T A; 
#chains in the Genus database with same CATH homology
 3U9F A;  2IHW A;  4CLA A;  2E1U A;  5DU9 A;  3U9B A;  5FAN A;  2XR7 A;  2RKT A;  5KJV A;  1Q9J A;  1SCZ A;  1XL7 A;  2XHG A;  3FP0 A;  1Q23 A;  2RKV A;  1EAC A;  1NOC B;  4KEC A;  1DPB A;  2BGH A;  4G0B A;  1XMC A;  1XMD A;  4HVM A;  1QCA A;  2CLA A;  2E1V A;  4KE4 A;  5KJU A;  5KJT A;  2I9D A;  1DPD A;  1PD5 A;  4JN3 A;  1DPC A;  5FAL A;  3MAE A;  3B30 A;  3CLA A;  4G2M A;  5KJW A;  5DUA A;  5KJS A;  1EAA A;  4JN5 A;  3L60 A;  1EAE A;  1EAD A;  4G22 A;  1CIA A;  2ZBA A;  3FOT A;  4N72 A;  1EAB A;  2II4 A;  1E2O A;  1XL8 A;  1C4T A;  3B2S A;  5T3E A;  2II3 A;  1L5A A;  2VSQ A;  1EAF A;  1CLA A;  2JGP A;  2II5 A;  2E1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...