2ZBAA

Crystal structure of f. sporotrichioides tri101 complexed with coenzyme a and t-2
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
449
structure length
435
Chain Sequence
b'SFDIELDIIGQQPPLLSIYTQISLVYPVSDPSQYPTIVSTLEEGLKRLSQTFPWVAGQVKTEGISEGNTGTSKIIPYEETPRLVVKDLRDSAPTIEGLRKAGFPLEMFDENVVAPRKTLAIGPGPNDPKPVLLLQLNFIKGGLILTVNGQHGAMDMTGQDAIIRLLSKACRNESFTEEEISAMNLDRKTVVPLLENYKVGPELDHQIAKPAKATWAFFSFTPKALSELKDAATKTLDASSKFVSTDDALSAFIWQSTSRVRLARLDASTPTEFCRAVDMRGPMGVSSTYPGLLQNMTYHDSTVAEIANEPLGATASRLRSELNSDRLRRRTQALATYMHGLPDKSSVSLTADANPSSSIMLSSWAKVGCWEYDFGFGLGKPESVRRPRFEPFESLMYFMPKKPDGEFTASISLRDEDMERLKADEEWTKYAKYIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Fusarium sporotrichioides
molecule tags Transferase
total genus 136
structure length 435
sequence length 449
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2zbaA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2zbaA02
3FOTA 2VSQA 2IHWA 2II5A 5T3EA 5KJVA 2JGPA 3CLAA 5KJTA 3B2SA 1SCZA 3MAEA 1PD5A 1XMCA 4N72A 4JN3A 1Q9JA 4G22A 1XMDA 2RKVA 5FANA 4KE4A 5FALA 3U9BA 2I9DA 1EAAA 5KJWA 4HVMA 2E1TA 2E1UA 1NOCB 3U9FA 1CLAA 1EAEA 2II4A 5DUAA 3B30A 2BGHA 4CLAA 1EACA 4KECA 2RKTA 1QCAA 1XL8A 1DPCA 1EAFA 1DPBA 4G0BA 1EABA 3FP0A 5DU9A 2XHGA 3L60A 4G2MA 2CLAA 5KJUA 1L5AA 5KJSA 1C4TA 1E2OA 1CIAA 1DPDA 1Q23A 1EADA 2XR7A 2ZBAA 2E1VA 1XL7A 4JN5A 2II3A
chains in the Genus database with same CATH superfamily
3FOTA 2JGPA 3MAEA 4N72A 1NDIA 1XMCA 4EPHA 1XMDA 1NOCB 3U9FA 2II4A 1T7NA 2FY3A 4KECA 1XL8A 1DPCA 1EAFA 1EABA 3FP0A 2FW3A 2CLAA 1L5AA 2FYOA 2ZBAA 2VSQA 2II5A 3CLAA 4EP9A 1SCZA 1PD5A 1Q9JA 4G22A 1EAAA 2E1TA 2BGHA 1EACA 2RKTA 1T1UA 1DPBA 4G0BA 5DU9A 5KJUA 5KJSA 1NDFA 1EADA 1T7QA 5T3EA 3B2SA 2H4TA 2RKVA 4KE4A 3U9BA 2I9DA 4HVMA 1EAEA 1QCAA 2H3PA 2H3UA 2XHGA 4G2MA 1C4TA 1E2OA 1CIAA 1DPDA 2E1VA 4JN5A 2II3A 2IHWA 5KJVA 2DEBA 5KJTA 4JN3A 1NDBA 1S5OA 5FANA 5FALA 5KJWA 2E1UA 2FY2A 1CLAA 1T7OA 5DUAA 3B30A 4CLAA 2FY4A 2H3WA 3L60A 2RCUA 1Q6XA 1NM8A 2FY5A 1Q23A 2XR7A 1XL7A 4EYWA
chains in the Genus database with same CATH topology
3FOTA 2VSQA 2IHWA 2II5A 5T3EA 5KJVA 2JGPA 3CLAA 5KJTA 3B2SA 1SCZA 3MAEA 1PD5A 1XMCA 4N72A 4JN3A 1Q9JA 4G22A 1XMDA 2RKVA 5FANA 4KE4A 5FALA 3U9BA 2I9DA 1EAAA 5KJWA 4HVMA 2E1TA 2E1UA 1NOCB 3U9FA 1CLAA 1EAEA 2II4A 5DUAA 3B30A 2BGHA 4CLAA 1EACA 4KECA 2RKTA 1QCAA 1XL8A 1DPCA 1EAFA 1DPBA 4G0BA 1EABA 3FP0A 5DU9A 2XHGA 3L60A 4G2MA 2CLAA 5KJUA 1L5AA 5KJSA 1C4TA 1E2OA 1CIAA 1DPDA 1Q23A 1EADA 2XR7A 2ZBAA 2E1VA 1XL7A 4JN5A 2II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOT A;  2VSQ A;  2IHW A;  2II5 A;  5T3E A;  5KJV A;  2JGP A;  3CLA A;  5KJT A;  3B2S A;  1SCZ A;  3MAE A;  1PD5 A;  1XMC A;  4N72 A;  4JN3 A;  1Q9J A;  4G22 A;  1XMD A;  2RKV A;  5FAN A;  4KE4 A;  5FAL A;  3U9B A;  2I9D A;  1EAA A;  5KJW A;  4HVM A;  2E1T A;  2E1U A;  1NOC B;  3U9F A;  1CLA A;  1EAE A;  2II4 A;  5DUA A;  3B30 A;  2BGH A;  4CLA A;  1EAC A;  4KEC A;  2RKT A;  1QCA A;  1XL8 A;  1DPC A;  1EAF A;  1DPB A;  4G0B A;  1EAB A;  3FP0 A;  5DU9 A;  2XHG A;  3L60 A;  4G2M A;  2CLA A;  5KJU A;  1L5A A;  5KJS A;  1C4T A;  1E2O A;  1CIA A;  1DPD A;  1Q23 A;  1EAD A;  2XR7 A;  2ZBA A;  2E1V A;  1XL7 A;  4JN5 A;  2II3 A; 
#chains in the Genus database with same CATH topology
 3FOT A;  2JGP A;  3MAE A;  4N72 A;  1NDI A;  1XMC A;  4EPH A;  1XMD A;  1NOC B;  3U9F A;  2II4 A;  1T7N A;  2FY3 A;  4KEC A;  1XL8 A;  1DPC A;  1EAF A;  1EAB A;  3FP0 A;  2FW3 A;  2CLA A;  1L5A A;  2FYO A;  2ZBA A;  2VSQ A;  2II5 A;  3CLA A;  4EP9 A;  1SCZ A;  1PD5 A;  1Q9J A;  4G22 A;  1EAA A;  2E1T A;  2BGH A;  1EAC A;  2RKT A;  1T1U A;  1DPB A;  4G0B A;  5DU9 A;  5KJU A;  5KJS A;  1NDF A;  1EAD A;  1T7Q A;  5T3E A;  3B2S A;  2H4T A;  2RKV A;  4KE4 A;  3U9B A;  2I9D A;  4HVM A;  1EAE A;  1QCA A;  2H3P A;  2H3U A;  2XHG A;  4G2M A;  1C4T A;  1E2O A;  1CIA A;  1DPD A;  2E1V A;  4JN5 A;  2II3 A;  2IHW A;  5KJV A;  2DEB A;  5KJT A;  4JN3 A;  1NDB A;  1S5O A;  5FAN A;  5FAL A;  5KJW A;  2E1U A;  2FY2 A;  1CLA A;  1T7O A;  5DUA A;  3B30 A;  4CLA A;  2FY4 A;  2H3W A;  3L60 A;  2RCU A;  1Q6X A;  1NM8 A;  2FY5 A;  1Q23 A;  2XR7 A;  1XL7 A;  4EYW A; 
#chains in the Genus database with same CATH homology
 3FOT A;  2VSQ A;  2IHW A;  2II5 A;  5T3E A;  5KJV A;  2JGP A;  3CLA A;  5KJT A;  3B2S A;  1SCZ A;  3MAE A;  1PD5 A;  1XMC A;  4N72 A;  4JN3 A;  1Q9J A;  4G22 A;  1XMD A;  2RKV A;  5FAN A;  4KE4 A;  5FAL A;  3U9B A;  2I9D A;  1EAA A;  5KJW A;  4HVM A;  2E1T A;  2E1U A;  1NOC B;  3U9F A;  1CLA A;  1EAE A;  2II4 A;  5DUA A;  3B30 A;  2BGH A;  4CLA A;  1EAC A;  4KEC A;  2RKT A;  1QCA A;  1XL8 A;  1DPC A;  1EAF A;  1DPB A;  4G0B A;  1EAB A;  3FP0 A;  5DU9 A;  2XHG A;  3L60 A;  4G2M A;  2CLA A;  5KJU A;  1L5A A;  5KJS A;  1C4T A;  1E2O A;  1CIA A;  1DPD A;  1Q23 A;  1EAD A;  2XR7 A;  2ZBA A;  2E1V A;  1XL7 A;  4JN5 A;  2II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...