1CIAA

Replacement of catalytic histidine-195 of chloramphenicol acetyltransferase: evidence for a general base role for glutamate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
213
structure length
213
Chain Sequence
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLLLPLSVQVHQAVCDGFHVARFINRLQELCNSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL ACETYLTRANSFERASE
publication title Replacement of catalytic histidine-195 of chloramphenicol acetyltransferase: evidence for a general base role for glutamate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase(acyltransferase)
total genus 59
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1993-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1ciaA00
1EAFA 1XL8A 2IHWA 1EAEA 1XMCA 5KJWA 1EABA 2E1TA 2ZBAA 2XHGA 2RKVA 2VSQA 3FP0A 1XL7A 4KE4A 5KJVA 1L5AA 5KJSA 2II5A 4JN5A 1DPCA 1SCZA 2XR7A 4G22A 5DU9A 4N72A 1EAAA 1Q9JA 1CIAA 2JGPA 5KJUA 5FANA 4KECA 2I9DA 1DPDA 2E1VA 3U9BA 5FALA 3L60A 1CLAA 4G0BA 3B30A 2E1UA 1EADA 5T3EA 2CLAA 4HVMA 1NOCB 1XMDA 2BGHA 1PD5A 4JN3A 3FOTA 1EACA 4G2MA 3MAEA 5DUAA 2RKTA 1QCAA 3B2SA 3CLAA 1DPBA 5KJTA 3U9FA 1E2OA 1Q23A 4CLAA 1C4TA 2II4A 2II3A
chains in the Genus database with same CATH superfamily
1XMCA 2VSQA 1L5AA 1NM8A 2II5A 3U9BA 5FALA 1EADA 5T3EA 2RCUA 1NOCB 3FOTA 4G2MA 3MAEA 2FY2A 2RKTA 1QCAA 5KJTA 1E2OA 2II4A 1NDFA 2II3A 1XL8A 2FY5A 2IHWA 1EAEA 2ZBAA 3FP0A 5KJSA 2H3WA 1SCZA 2XR7A 4G22A 1CIAA 5FANA 4G0BA 3B30A 2BGHA 2FW3A 1C4TA 4N72A 1NDIA 1EAFA 2H3PA 2XHGA 2RKVA 1XL7A 1T1UA 1NDBA 4EPHA 4EYWA 4JN5A 1DPCA 5DU9A 5KJUA 1EAAA 2JGPA 1DPDA 1Q6XA 2FY3A 1XMDA 1T7OA 1PD5A 1EACA 1T7QA 2H4TA 3CLAA 1DPBA 4JN3A 1T7NA 2E1TA 2H3UA 5KJWA 1EABA 2FYOA 4EP9A 2FY4A 5KJVA 4KE4A 1Q9JA 4KECA 2I9DA 2E1VA 3L60A 1CLAA 2E1UA 2CLAA 4HVMA 1S5OA 2DEBA 5DUAA 3B2SA 3U9FA 1Q23A 4CLAA
chains in the Genus database with same CATH topology
1EAFA 1XL8A 2IHWA 1EAEA 1XMCA 5KJWA 1EABA 2E1TA 2ZBAA 2XHGA 2RKVA 2VSQA 3FP0A 1XL7A 4KE4A 5KJVA 1L5AA 5KJSA 2II5A 4JN5A 1DPCA 1SCZA 2XR7A 4G22A 5DU9A 4N72A 1EAAA 1Q9JA 1CIAA 2JGPA 5KJUA 5FANA 4KECA 2I9DA 1DPDA 2E1VA 3U9BA 5FALA 3L60A 1CLAA 4G0BA 3B30A 2E1UA 1EADA 5T3EA 2CLAA 4HVMA 1NOCB 1XMDA 2BGHA 1PD5A 4JN3A 3FOTA 1EACA 4G2MA 3MAEA 5DUAA 2RKTA 1QCAA 3B2SA 3CLAA 1DPBA 5KJTA 3U9FA 1E2OA 1Q23A 4CLAA 1C4TA 2II4A 2II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAF A;  1XL8 A;  2IHW A;  1EAE A;  1XMC A;  5KJW A;  1EAB A;  2E1T A;  2ZBA A;  2XHG A;  2RKV A;  2VSQ A;  3FP0 A;  1XL7 A;  4KE4 A;  5KJV A;  1L5A A;  5KJS A;  2II5 A;  4JN5 A;  1DPC A;  1SCZ A;  2XR7 A;  4G22 A;  5DU9 A;  4N72 A;  1EAA A;  1Q9J A;  1CIA A;  2JGP A;  5KJU A;  5FAN A;  4KEC A;  2I9D A;  1DPD A;  2E1V A;  3U9B A;  5FAL A;  3L60 A;  1CLA A;  4G0B A;  3B30 A;  2E1U A;  1EAD A;  5T3E A;  2CLA A;  4HVM A;  1NOC B;  1XMD A;  2BGH A;  1PD5 A;  4JN3 A;  3FOT A;  1EAC A;  4G2M A;  3MAE A;  5DUA A;  2RKT A;  1QCA A;  3B2S A;  3CLA A;  1DPB A;  5KJT A;  3U9F A;  1E2O A;  1Q23 A;  4CLA A;  1C4T A;  2II4 A;  2II3 A; 
#chains in the Genus database with same CATH topology
 1XMC A;  2VSQ A;  1L5A A;  1NM8 A;  2II5 A;  3U9B A;  5FAL A;  1EAD A;  5T3E A;  2RCU A;  1NOC B;  3FOT A;  4G2M A;  3MAE A;  2FY2 A;  2RKT A;  1QCA A;  5KJT A;  1E2O A;  2II4 A;  1NDF A;  2II3 A;  1XL8 A;  2FY5 A;  2IHW A;  1EAE A;  2ZBA A;  3FP0 A;  5KJS A;  2H3W A;  1SCZ A;  2XR7 A;  4G22 A;  1CIA A;  5FAN A;  4G0B A;  3B30 A;  2BGH A;  2FW3 A;  1C4T A;  4N72 A;  1NDI A;  1EAF A;  2H3P A;  2XHG A;  2RKV A;  1XL7 A;  1T1U A;  1NDB A;  4EPH A;  4EYW A;  4JN5 A;  1DPC A;  5DU9 A;  5KJU A;  1EAA A;  2JGP A;  1DPD A;  1Q6X A;  2FY3 A;  1XMD A;  1T7O A;  1PD5 A;  1EAC A;  1T7Q A;  2H4T A;  3CLA A;  1DPB A;  4JN3 A;  1T7N A;  2E1T A;  2H3U A;  5KJW A;  1EAB A;  2FYO A;  4EP9 A;  2FY4 A;  5KJV A;  4KE4 A;  1Q9J A;  4KEC A;  2I9D A;  2E1V A;  3L60 A;  1CLA A;  2E1U A;  2CLA A;  4HVM A;  1S5O A;  2DEB A;  5DUA A;  3B2S A;  3U9F A;  1Q23 A;  4CLA A; 
#chains in the Genus database with same CATH homology
 1EAF A;  1XL8 A;  2IHW A;  1EAE A;  1XMC A;  5KJW A;  1EAB A;  2E1T A;  2ZBA A;  2XHG A;  2RKV A;  2VSQ A;  3FP0 A;  1XL7 A;  4KE4 A;  5KJV A;  1L5A A;  5KJS A;  2II5 A;  4JN5 A;  1DPC A;  1SCZ A;  2XR7 A;  4G22 A;  5DU9 A;  4N72 A;  1EAA A;  1Q9J A;  1CIA A;  2JGP A;  5KJU A;  5FAN A;  4KEC A;  2I9D A;  1DPD A;  2E1V A;  3U9B A;  5FAL A;  3L60 A;  1CLA A;  4G0B A;  3B30 A;  2E1U A;  1EAD A;  5T3E A;  2CLA A;  4HVM A;  1NOC B;  1XMD A;  2BGH A;  1PD5 A;  4JN3 A;  3FOT A;  1EAC A;  4G2M A;  3MAE A;  5DUA A;  2RKT A;  1QCA A;  3B2S A;  3CLA A;  1DPB A;  5KJT A;  3U9F A;  1E2O A;  1Q23 A;  4CLA A;  1C4T A;  2II4 A;  2II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...