1SCZA

Improved structural model for the catalytic domain of e.coli dihydrolipoamide succinyltransferase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
233
structure length
233
Chain Sequence
b'ARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrolipoamide Succinyltransferase
publication title Improved structural model for the catalytic domain of E.coli dihydrolipoamide succinyltransferase
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 233
sequence length 233
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1sczA00
5KJUA 2II3A 3B30A 2I9DA 1SCZA 1XMCA 2E1TA 4KECA 1EABA 1XL8A 1NOCB 5KJVA 2E1UA 2RKVA 2ZBAA 1PD5A 2II4A 3FOTA 4G22A 4G2MA 4N72A 2IHWA 1Q9JA 3B2SA 5FALA 1EAEA 1DPDA 1L5AA 3CLAA 1EADA 4JN3A 5T3EA 2CLAA 2E1VA 1XL7A 3FP0A 1CLAA 1E2OA 3L60A 5FANA 1QCAA 1XMDA 2JGPA 2BGHA 2XHGA 2XR7A 3U9FA 1EAFA 1CIAA 3U9BA 5DU9A 5KJWA 4KE4A 4HVMA 5KJTA 1EAAA 1DPBA 4JN5A 2VSQA 3MAEA 2RKTA 4G0BA 1EACA 5DUAA 4CLAA 1Q23A 1C4TA 5KJSA 2II5A 1DPCA
chains in the Genus database with same CATH superfamily
5KJUA 2II3A 2I9DA 1SCZA 2FY5A 2ZBAA 2II4A 4G22A 4N72A 1T7OA 1EAEA 2FY3A 2CLAA 3L60A 5FANA 1QCAA 2H3WA 2BGHA 3U9FA 4EP9A 3U9BA 1DPBA 2VSQA 5KJSA 4CLAA 1Q23A 1C4TA 2XHGA 1DPCA 1T7QA 4KECA 2FW3A 2E1UA 2IHWA 1NDBA 3CLAA 1XL7A 1E2OA 1EAFA 2DEBA 1NDFA 4KE4A 3MAEA 2RKTA 2II5A 2H3PA 3B30A 2H3UA 2E1TA 1EABA 1NOCB 3FOTA 3B2SA 1EADA 5T3EA 3FP0A 1CLAA 1NM8A 1NDIA 2FY4A 1XMDA 2FYOA 2JGPA 1S5OA 2XR7A 4EPHA 1CIAA 5DU9A 5KJWA 4HVMA 5KJTA 1Q6XA 1T7NA 4G0BA 5DUAA 4EYWA 5FALA 2RCUA 1XMCA 1XL8A 5KJVA 2RKVA 1PD5A 2FY2A 4G2MA 1Q9JA 1DPDA 1L5AA 4JN3A 2E1VA 2H4TA 1EAAA 4JN5A 1T1UA 1EACA
chains in the Genus database with same CATH topology
5KJUA 2II3A 3B30A 2I9DA 1SCZA 1XMCA 2E1TA 4KECA 1EABA 1XL8A 1NOCB 5KJVA 2E1UA 2RKVA 2ZBAA 1PD5A 2II4A 3FOTA 4G22A 4G2MA 4N72A 2IHWA 1Q9JA 3B2SA 5FALA 1EAEA 1DPDA 1L5AA 3CLAA 1EADA 4JN3A 5T3EA 2CLAA 2E1VA 1XL7A 3FP0A 1CLAA 1E2OA 3L60A 5FANA 1QCAA 1XMDA 2JGPA 2BGHA 2XHGA 2XR7A 3U9FA 1EAFA 1CIAA 3U9BA 5DU9A 5KJWA 4KE4A 4HVMA 5KJTA 1EAAA 1DPBA 4JN5A 2VSQA 3MAEA 2RKTA 4G0BA 1EACA 5DUAA 4CLAA 1Q23A 1C4TA 5KJSA 2II5A 1DPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJU A;  2II3 A;  3B30 A;  2I9D A;  1SCZ A;  1XMC A;  2E1T A;  4KEC A;  1EAB A;  1XL8 A;  1NOC B;  5KJV A;  2E1U A;  2RKV A;  2ZBA A;  1PD5 A;  2II4 A;  3FOT A;  4G22 A;  4G2M A;  4N72 A;  2IHW A;  1Q9J A;  3B2S A;  5FAL A;  1EAE A;  1DPD A;  1L5A A;  3CLA A;  1EAD A;  4JN3 A;  5T3E A;  2CLA A;  2E1V A;  1XL7 A;  3FP0 A;  1CLA A;  1E2O A;  3L60 A;  5FAN A;  1QCA A;  1XMD A;  2JGP A;  2BGH A;  2XHG A;  2XR7 A;  3U9F A;  1EAF A;  1CIA A;  3U9B A;  5DU9 A;  5KJW A;  4KE4 A;  4HVM A;  5KJT A;  1EAA A;  1DPB A;  4JN5 A;  2VSQ A;  3MAE A;  2RKT A;  4G0B A;  1EAC A;  5DUA A;  4CLA A;  1Q23 A;  1C4T A;  5KJS A;  2II5 A;  1DPC A; 
#chains in the Genus database with same CATH topology
 5KJU A;  2II3 A;  2I9D A;  1SCZ A;  2FY5 A;  2ZBA A;  2II4 A;  4G22 A;  4N72 A;  1T7O A;  1EAE A;  2FY3 A;  2CLA A;  3L60 A;  5FAN A;  1QCA A;  2H3W A;  2BGH A;  3U9F A;  4EP9 A;  3U9B A;  1DPB A;  2VSQ A;  5KJS A;  4CLA A;  1Q23 A;  1C4T A;  2XHG A;  1DPC A;  1T7Q A;  4KEC A;  2FW3 A;  2E1U A;  2IHW A;  1NDB A;  3CLA A;  1XL7 A;  1E2O A;  1EAF A;  2DEB A;  1NDF A;  4KE4 A;  3MAE A;  2RKT A;  2II5 A;  2H3P A;  3B30 A;  2H3U A;  2E1T A;  1EAB A;  1NOC B;  3FOT A;  3B2S A;  1EAD A;  5T3E A;  3FP0 A;  1CLA A;  1NM8 A;  1NDI A;  2FY4 A;  1XMD A;  2FYO A;  2JGP A;  1S5O A;  2XR7 A;  4EPH A;  1CIA A;  5DU9 A;  5KJW A;  4HVM A;  5KJT A;  1Q6X A;  1T7N A;  4G0B A;  5DUA A;  4EYW A;  5FAL A;  2RCU A;  1XMC A;  1XL8 A;  5KJV A;  2RKV A;  1PD5 A;  2FY2 A;  4G2M A;  1Q9J A;  1DPD A;  1L5A A;  4JN3 A;  2E1V A;  2H4T A;  1EAA A;  4JN5 A;  1T1U A;  1EAC A; 
#chains in the Genus database with same CATH homology
 5KJU A;  2II3 A;  3B30 A;  2I9D A;  1SCZ A;  1XMC A;  2E1T A;  4KEC A;  1EAB A;  1XL8 A;  1NOC B;  5KJV A;  2E1U A;  2RKV A;  2ZBA A;  1PD5 A;  2II4 A;  3FOT A;  4G22 A;  4G2M A;  4N72 A;  2IHW A;  1Q9J A;  3B2S A;  5FAL A;  1EAE A;  1DPD A;  1L5A A;  3CLA A;  1EAD A;  4JN3 A;  5T3E A;  2CLA A;  2E1V A;  1XL7 A;  3FP0 A;  1CLA A;  1E2O A;  3L60 A;  5FAN A;  1QCA A;  1XMD A;  2JGP A;  2BGH A;  2XHG A;  2XR7 A;  3U9F A;  1EAF A;  1CIA A;  3U9B A;  5DU9 A;  5KJW A;  4KE4 A;  4HVM A;  5KJT A;  1EAA A;  1DPB A;  4JN5 A;  2VSQ A;  3MAE A;  2RKT A;  4G0B A;  1EAC A;  5DUA A;  4CLA A;  1Q23 A;  1C4T A;  5KJS A;  2II5 A;  1DPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...