1SCZA

Improved structural model for the catalytic domain of e.coli dihydrolipoamide succinyltransferase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
233
structure length
233
Chain Sequence
ARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrolipoamide Succinyltransferase
publication title Improved structural model for the catalytic domain of E.coli dihydrolipoamide succinyltransferase
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 233
sequence length 233
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1sczA00
2E1UA 2RKTA 3FOTA 4G22A 4JN5A 1DPCA 4CLAA 3B2SA 5KJUA 1XMCA 3L60A 1XL7A 5DU9A 2JGPA 1Q9JA 4KE4A 2E1VA 1EAEA 1DPBA 5FANA 4HVMA 5KJTA 1QCAA 1E2OA 1SCZA 4G0BA 1EAFA 4KECA 1CIAA 5KJWA 2II3A 1EACA 1L5AA 1EADA 2BGHA 2VSQA 4JN3A 5T3EA 2E1TA 1Q23A 1CLAA 1EAAA 4N72A 3U9BA 2ZBAA 2I9DA 1NOCB 4G2MA 2IHWA 1EABA 2XHGA 5KJSA 5KJVA 1PD5A 1C4TA 5DUAA 2XR7A 3FP0A 1XL8A 2CLAA 3MAEA 2II5A 5FALA 2II4A 1XMDA 3B30A 3CLAA 1DPDA 3U9FA 2RKVA
chains in the Genus database with same CATH superfamily
3FOTA 1DPCA 1Q9JA 2E1VA 1EAEA 4HVMA 1QCAA 5KJWA 2RCUA 5T3EA 2E1TA 4G2MA 5KJSA 1T7QA 3FP0A 2H3PA 1XMDA 2FY5A 3U9FA 3L60A 2RKVA 1NDBA 2FW3A 2RKTA 5KJUA 2FY4A 2JGPA 2FY3A 1DPBA 1E2OA 1SCZA 1EAFA 2FYOA 2VSQA 1Q23A 2H3WA 1S5OA 1T1UA 5DUAA 2XR7A 4KE4A 4CLAA 1XL7A 5DU9A 5KJTA 1NM8A 4KECA 1CIAA 2II3A 1EACA 1CLAA 2FY2A 2ZBAA 2I9DA 1EABA 2H3UA 1C4TA 2CLAA 5FALA 1NDFA 2II4A 3CLAA 1DPDA 2E1UA 4G22A 4EP9A 4JN5A 3B2SA 1T7OA 2DEBA 1T7NA 1Q6XA 2H4TA 5FANA 4G0BA 1L5AA 1EADA 1NDIA 2BGHA 4EPHA 4JN3A 3U9BA 1EAAA 4N72A 1NOCB 4EYWA 2IHWA 2XHGA 5KJVA 1PD5A 3MAEA 1XL8A 2II5A 3B30A 1XMCA
chains in the Genus database with same CATH topology
2E1UA 2RKTA 3FOTA 4G22A 4JN5A 1DPCA 4CLAA 3B2SA 5KJUA 1XMCA 3L60A 1XL7A 5DU9A 2JGPA 1Q9JA 4KE4A 2E1VA 1EAEA 1DPBA 5FANA 4HVMA 5KJTA 1QCAA 1E2OA 1SCZA 4G0BA 1EAFA 4KECA 1CIAA 5KJWA 2II3A 1EACA 1L5AA 1EADA 2BGHA 2VSQA 4JN3A 5T3EA 2E1TA 1Q23A 1CLAA 1EAAA 4N72A 3U9BA 2ZBAA 2I9DA 1NOCB 4G2MA 2IHWA 1EABA 2XHGA 5KJSA 5KJVA 1PD5A 1C4TA 5DUAA 2XR7A 3FP0A 1XL8A 2CLAA 3MAEA 2II5A 5FALA 2II4A 1XMDA 3B30A 3CLAA 1DPDA 3U9FA 2RKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1U A;  2RKT A;  3FOT A;  4G22 A;  4JN5 A;  1DPC A;  4CLA A;  3B2S A;  5KJU A;  1XMC A;  3L60 A;  1XL7 A;  5DU9 A;  2JGP A;  1Q9J A;  4KE4 A;  2E1V A;  1EAE A;  1DPB A;  5FAN A;  4HVM A;  5KJT A;  1QCA A;  1E2O A;  1SCZ A;  4G0B A;  1EAF A;  4KEC A;  1CIA A;  5KJW A;  2II3 A;  1EAC A;  1L5A A;  1EAD A;  2BGH A;  2VSQ A;  4JN3 A;  5T3E A;  2E1T A;  1Q23 A;  1CLA A;  1EAA A;  4N72 A;  3U9B A;  2ZBA A;  2I9D A;  1NOC B;  4G2M A;  2IHW A;  1EAB A;  2XHG A;  5KJS A;  5KJV A;  1PD5 A;  1C4T A;  5DUA A;  2XR7 A;  3FP0 A;  1XL8 A;  2CLA A;  3MAE A;  2II5 A;  5FAL A;  2II4 A;  1XMD A;  3B30 A;  3CLA A;  1DPD A;  3U9F A;  2RKV A; 
#chains in the Genus database with same CATH topology
 3FOT A;  1DPC A;  1Q9J A;  2E1V A;  1EAE A;  4HVM A;  1QCA A;  5KJW A;  2RCU A;  5T3E A;  2E1T A;  4G2M A;  5KJS A;  1T7Q A;  3FP0 A;  2H3P A;  1XMD A;  2FY5 A;  3U9F A;  3L60 A;  2RKV A;  1NDB A;  2FW3 A;  2RKT A;  5KJU A;  2FY4 A;  2JGP A;  2FY3 A;  1DPB A;  1E2O A;  1SCZ A;  1EAF A;  2FYO A;  2VSQ A;  1Q23 A;  2H3W A;  1S5O A;  1T1U A;  5DUA A;  2XR7 A;  4KE4 A;  4CLA A;  1XL7 A;  5DU9 A;  5KJT A;  1NM8 A;  4KEC A;  1CIA A;  2II3 A;  1EAC A;  1CLA A;  2FY2 A;  2ZBA A;  2I9D A;  1EAB A;  2H3U A;  1C4T A;  2CLA A;  5FAL A;  1NDF A;  2II4 A;  3CLA A;  1DPD A;  2E1U A;  4G22 A;  4EP9 A;  4JN5 A;  3B2S A;  1T7O A;  2DEB A;  1T7N A;  1Q6X A;  2H4T A;  5FAN A;  4G0B A;  1L5A A;  1EAD A;  1NDI A;  2BGH A;  4EPH A;  4JN3 A;  3U9B A;  1EAA A;  4N72 A;  1NOC B;  4EYW A;  2IHW A;  2XHG A;  5KJV A;  1PD5 A;  3MAE A;  1XL8 A;  2II5 A;  3B30 A;  1XMC A; 
#chains in the Genus database with same CATH homology
 2E1U A;  2RKT A;  3FOT A;  4G22 A;  4JN5 A;  1DPC A;  4CLA A;  3B2S A;  5KJU A;  1XMC A;  3L60 A;  1XL7 A;  5DU9 A;  2JGP A;  1Q9J A;  4KE4 A;  2E1V A;  1EAE A;  1DPB A;  5FAN A;  4HVM A;  5KJT A;  1QCA A;  1E2O A;  1SCZ A;  4G0B A;  1EAF A;  4KEC A;  1CIA A;  5KJW A;  2II3 A;  1EAC A;  1L5A A;  1EAD A;  2BGH A;  2VSQ A;  4JN3 A;  5T3E A;  2E1T A;  1Q23 A;  1CLA A;  1EAA A;  4N72 A;  3U9B A;  2ZBA A;  2I9D A;  1NOC B;  4G2M A;  2IHW A;  1EAB A;  2XHG A;  5KJS A;  5KJV A;  1PD5 A;  1C4T A;  5DUA A;  2XR7 A;  3FP0 A;  1XL8 A;  2CLA A;  3MAE A;  2II5 A;  5FAL A;  2II4 A;  1XMD A;  3B30 A;  3CLA A;  1DPD A;  3U9F A;  2RKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...