1SCZA

Improved structural model for the catalytic domain of e.coli dihydrolipoamide succinyltransferase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
233
structure length
233
Chain Sequence
ARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dihydrolipoamide Succinyltransferase
publication title Improved structural model for the catalytic domain of E.coli dihydrolipoamide succinyltransferase
rcsb
source organism Escherichia coli
total genus 65
structure length 233
sequence length 233
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1sczA00
5FALA 1DPCA 2VSQA 1L5AA 1E2OA 2E1VA 5T3EA 5KJTA 1EADA 2IHWA 3FOTA 1XL8A 3MAEA 3U9BA 3L60A 4JN3A 2XHGA 4CLAA 5KJVA 1CIAA 2RKTA 1CLAA 2II3A 1EABA 2CLAA 5FANA 2II5A 2I9DA 5KJUA 1XMDA 1XL7A 3U9FA 2JGPA 2ZBAA 1XMCA 1EAFA 3B30A 1SCZA 4N72A 4JN5A 1Q23A 1EAAA 1NOCB 5KJSA 4G0BA 5DUAA 2XR7A 3FP0A 4KECA 4HVMA 1DPDA 2E1UA 1DPBA 1EACA 4G22A 2BGHA 3B2SA 1EAEA 2II4A 1PD5A 4G2MA 2RKVA 5DU9A 1Q9JA 1QCAA 3CLAA 4KE4A 5KJWA 2E1TA 1C4TA
chains in the Genus database with same CATH superfamily
3FOTA 5KJVA 2FY5A 2CLAA 2RCUA 1XL7A 4EPHA 2ZBAA 3B30A 4N72A 2FW3A 1Q6XA 4G0BA 4KECA 1NM8A 2E1UA 1EACA 2II4A 2RKVA 1Q9JA 4KE4A 5KJWA 5FALA 2H3PA 1L5AA 5T3EA 1EADA 1NDIA 3L60A 4JN3A 4CLAA 1CIAA 2II3A 1T7NA 5FANA 2II5A 3U9FA 2JGPA 1NDBA 5DUAA 2XR7A 3FP0A 4EYWA 4G22A 2BGHA 2FY3A 3B2SA 2H3WA 2E1TA 1C4TA 1T7OA 1E2OA 2E1VA 1T1UA 1XL8A 3MAEA 2RKTA 1CLAA 2H3UA 5KJUA 1T7QA 1SCZA 1Q23A 5KJSA 2FY2A 4HVMA 1DPDA 1EAEA 1PD5A 3CLAA 1DPCA 2VSQA 5KJTA 2IHWA 2FYOA 3U9BA 2XHGA 2H4TA 1EABA 2FY4A 2I9DA 1XMDA 1S5OA 1XMCA 1EAFA 1NDFA 4JN5A 4EP9A 1EAAA 1NOCB 1DPBA 4G2MA 5DU9A 2DEBA 1QCAA
chains in the Genus database with same CATH topology
5FALA 1DPCA 2VSQA 1L5AA 1E2OA 2E1VA 5T3EA 5KJTA 1EADA 2IHWA 3FOTA 1XL8A 3MAEA 3U9BA 3L60A 4JN3A 2XHGA 4CLAA 5KJVA 1CIAA 2RKTA 1CLAA 2II3A 1EABA 2CLAA 5FANA 2II5A 2I9DA 5KJUA 1XMDA 1XL7A 3U9FA 2JGPA 2ZBAA 1XMCA 1EAFA 3B30A 1SCZA 4N72A 4JN5A 1Q23A 1EAAA 1NOCB 5KJSA 4G0BA 5DUAA 2XR7A 3FP0A 4KECA 4HVMA 1DPDA 2E1UA 1DPBA 1EACA 4G22A 2BGHA 3B2SA 1EAEA 2II4A 1PD5A 4G2MA 2RKVA 5DU9A 1Q9JA 1QCAA 3CLAA 4KE4A 5KJWA 2E1TA 1C4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FAL A;  1DPC A;  2VSQ A;  1L5A A;  1E2O A;  2E1V A;  5T3E A;  5KJT A;  1EAD A;  2IHW A;  3FOT A;  1XL8 A;  3MAE A;  3U9B A;  3L60 A;  4JN3 A;  2XHG A;  4CLA A;  5KJV A;  1CIA A;  2RKT A;  1CLA A;  2II3 A;  1EAB A;  2CLA A;  5FAN A;  2II5 A;  2I9D A;  5KJU A;  1XMD A;  1XL7 A;  3U9F A;  2JGP A;  2ZBA A;  1XMC A;  1EAF A;  3B30 A;  1SCZ A;  4N72 A;  4JN5 A;  1Q23 A;  1EAA A;  1NOC B;  5KJS A;  4G0B A;  5DUA A;  2XR7 A;  3FP0 A;  4KEC A;  4HVM A;  1DPD A;  2E1U A;  1DPB A;  1EAC A;  4G22 A;  2BGH A;  3B2S A;  1EAE A;  2II4 A;  1PD5 A;  4G2M A;  2RKV A;  5DU9 A;  1Q9J A;  1QCA A;  3CLA A;  4KE4 A;  5KJW A;  2E1T A;  1C4T A; 
#chains in the Genus database with same CATH topology
 3FOT A;  5KJV A;  2FY5 A;  2CLA A;  2RCU A;  1XL7 A;  4EPH A;  2ZBA A;  3B30 A;  4N72 A;  2FW3 A;  1Q6X A;  4G0B A;  4KEC A;  1NM8 A;  2E1U A;  1EAC A;  2II4 A;  2RKV A;  1Q9J A;  4KE4 A;  5KJW A;  5FAL A;  2H3P A;  1L5A A;  5T3E A;  1EAD A;  1NDI A;  3L60 A;  4JN3 A;  4CLA A;  1CIA A;  2II3 A;  1T7N A;  5FAN A;  2II5 A;  3U9F A;  2JGP A;  1NDB A;  5DUA A;  2XR7 A;  3FP0 A;  4EYW A;  4G22 A;  2BGH A;  2FY3 A;  3B2S A;  2H3W A;  2E1T A;  1C4T A;  1T7O A;  1E2O A;  2E1V A;  1T1U A;  1XL8 A;  3MAE A;  2RKT A;  1CLA A;  2H3U A;  5KJU A;  1T7Q A;  1SCZ A;  1Q23 A;  5KJS A;  2FY2 A;  4HVM A;  1DPD A;  1EAE A;  1PD5 A;  3CLA A;  1DPC A;  2VSQ A;  5KJT A;  2IHW A;  2FYO A;  3U9B A;  2XHG A;  2H4T A;  1EAB A;  2FY4 A;  2I9D A;  1XMD A;  1S5O A;  1XMC A;  1EAF A;  1NDF A;  4JN5 A;  4EP9 A;  1EAA A;  1NOC B;  1DPB A;  4G2M A;  5DU9 A;  2DEB A;  1QCA A; 
#chains in the Genus database with same CATH homology
 5FAL A;  1DPC A;  2VSQ A;  1L5A A;  1E2O A;  2E1V A;  5T3E A;  5KJT A;  1EAD A;  2IHW A;  3FOT A;  1XL8 A;  3MAE A;  3U9B A;  3L60 A;  4JN3 A;  2XHG A;  4CLA A;  5KJV A;  1CIA A;  2RKT A;  1CLA A;  2II3 A;  1EAB A;  2CLA A;  5FAN A;  2II5 A;  2I9D A;  5KJU A;  1XMD A;  1XL7 A;  3U9F A;  2JGP A;  2ZBA A;  1XMC A;  1EAF A;  3B30 A;  1SCZ A;  4N72 A;  4JN5 A;  1Q23 A;  1EAA A;  1NOC B;  5KJS A;  4G0B A;  5DUA A;  2XR7 A;  3FP0 A;  4KEC A;  4HVM A;  1DPD A;  2E1U A;  1DPB A;  1EAC A;  4G22 A;  2BGH A;  3B2S A;  1EAE A;  2II4 A;  1PD5 A;  4G2M A;  2RKV A;  5DU9 A;  1Q9J A;  1QCA A;  3CLA A;  4KE4 A;  5KJW A;  2E1T A;  1C4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...