1NM8A

Structure of human carnitine acetyltransferase: molecular basis for fatty acyl transfer
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
591
structure length
591
Chain Sequence
HHTDPLPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Carnitine O-acetyltransferase
publication title Structure of Human Carnitine Acetyltransferase. Molecular Basis for Fatty Acyl Transfer
pubmed doi rcsb
source organism Homo sapiens
total genus 214
structure length 591
sequence length 591
ec nomenclature ec 2.3.1.7: Carnitine O-acetyltransferase.
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1nm8A01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1nm8A02
2FY3A 1NDIA 2FY2A 2FY4A 1T1UA 2H3UA 2RCUA 2FY5A 2FW3A 2FYOA 1T7QA 1T7NA 2H3WA 4EP9A 1NDFA 1NDBA 1T7OA 4EYWA 1Q6XA 1S5OA 2H3PA 1NM8A 2DEBA 4EPHA 2H4TA
chains in the Genus database with same CATH superfamily
2FY3A 5KJUA 1NDIA 5KJSA 4KECA 1DPBA 1EADA 1CLAA 3B2SA 4G2MA 1T7NA 2BGHA 2VSQA 5FALA 2IHWA 1XMCA 4EYWA 2H3PA 3L60A 4KE4A 2XHGA 1Q9JA 2DEBA 3U9FA 2E1TA 5KJWA 2FY4A 2II4A 2H3UA 2RCUA 4N72A 5T3EA 1E2OA 4HVMA 2FW3A 4CLAA 2CLAA 2RKTA 1NDFA 1QCAA 1EAFA 1NDBA 5FANA 3U9BA 1XMDA 4EPHA 5DUAA 1DPDA 1EABA 2RKVA 1PD5A 1CIAA 2JGPA 1XL8A 2FY2A 3CLAA 1SCZA 2XR7A 3MAEA 1EAEA 1L5AA 4EP9A 2ZBAA 5DU9A 5KJTA 1Q23A 3B30A 1C4TA 4G0BA 2E1VA 1EACA 1S5OA 1NM8A 4JN3A 2H4TA 5KJVA 2II5A 1T1UA 4JN5A 2I9DA 2FY5A 4G22A 1NOCB 2FYOA 1T7QA 2H3WA 1EAAA 2II3A 1T7OA 1XL7A 1Q6XA 1DPCA 3FP0A 3FOTA 2E1UA
chains in the Genus database with same CATH topology
2FY3A 1NDIA 2JGPA 2FY2A 2FY4A 1T1UA 2H3UA 2RCUA 5T3EA 4JN5A 2FY5A 4HVMA 2FW3A 1L5AA 2FYOA 1T7QA 1T7NA 2H3WA 2VSQA 4EP9A 1NDFA 5DU9A 1NDBA 1T7OA 4EYWA 1Q6XA 1S5OA 2H3PA 2XHGA 1NM8A 1Q9JA 2DEBA 5DUAA 4EPHA 3FP0A 3FOTA 4JN3A 2H4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FY3 A;  1NDI A;  2FY2 A;  2FY4 A;  1T1U A;  2H3U A;  2RCU A;  2FY5 A;  2FW3 A;  2FYO A;  1T7Q A;  1T7N A;  2H3W A;  4EP9 A;  1NDF A;  1NDB A;  1T7O A;  4EYW A;  1Q6X A;  1S5O A;  2H3P A;  1NM8 A;  2DEB A;  4EPH A;  2H4T A; 
#chains in the Genus database with same CATH topology
 2FY3 A;  5KJU A;  1NDI A;  5KJS A;  4KEC A;  1DPB A;  1EAD A;  1CLA A;  3B2S A;  4G2M A;  1T7N A;  2BGH A;  2VSQ A;  5FAL A;  2IHW A;  1XMC A;  4EYW A;  2H3P A;  3L60 A;  4KE4 A;  2XHG A;  1Q9J A;  2DEB A;  3U9F A;  2E1T A;  5KJW A;  2FY4 A;  2II4 A;  2H3U A;  2RCU A;  4N72 A;  5T3E A;  1E2O A;  4HVM A;  2FW3 A;  4CLA A;  2CLA A;  2RKT A;  1NDF A;  1QCA A;  1EAF A;  1NDB A;  5FAN A;  3U9B A;  1XMD A;  4EPH A;  5DUA A;  1DPD A;  1EAB A;  2RKV A;  1PD5 A;  1CIA A;  2JGP A;  1XL8 A;  2FY2 A;  3CLA A;  1SCZ A;  2XR7 A;  3MAE A;  1EAE A;  1L5A A;  4EP9 A;  2ZBA A;  5DU9 A;  5KJT A;  1Q23 A;  3B30 A;  1C4T A;  4G0B A;  2E1V A;  1EAC A;  1S5O A;  1NM8 A;  4JN3 A;  2H4T A;  5KJV A;  2II5 A;  1T1U A;  4JN5 A;  2I9D A;  2FY5 A;  4G22 A;  1NOC B;  2FYO A;  1T7Q A;  2H3W A;  1EAA A;  2II3 A;  1T7O A;  1XL7 A;  1Q6X A;  1DPC A;  3FP0 A;  3FOT A;  2E1U A; 
#chains in the Genus database with same CATH homology
 2FY3 A;  1NDI A;  2JGP A;  2FY2 A;  2FY4 A;  1T1U A;  2H3U A;  2RCU A;  5T3E A;  4JN5 A;  2FY5 A;  4HVM A;  2FW3 A;  1L5A A;  2FYO A;  1T7Q A;  1T7N A;  2H3W A;  2VSQ A;  4EP9 A;  1NDF A;  5DU9 A;  1NDB A;  1T7O A;  4EYW A;  1Q6X A;  1S5O A;  2H3P A;  2XHG A;  1NM8 A;  1Q9J A;  2DEB A;  5DUA A;  4EPH A;  3FP0 A;  3FOT A;  4JN3 A;  2H4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...