1NM8A

Structure of human carnitine acetyltransferase: molecular basis for fatty acyl transfer
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
591
structure length
591
Chain Sequence
HHTDPLPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carnitine O-acetyltransferase
publication title Structure of Human Carnitine Acetyltransferase. Molecular Basis for Fatty Acyl Transfer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 214
structure length 591
sequence length 591
ec nomenclature ec 2.3.1.7: Carnitine O-acetyltransferase.
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1nm8A01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1nm8A02
1NDFA 2H3WA 4EYWA 1S5OA 1Q6XA 2FY3A 1NDIA 2FYOA 2FY5A 2FW3A 2H3PA 2H3UA 4EPHA 1NDBA 1T1UA 2H4TA 2DEBA 1T7NA 1T7OA 4EP9A 2RCUA 2FY4A 1NM8A 1T7QA 2FY2A
chains in the Genus database with same CATH superfamily
1NDFA 2H3WA 2CLAA 5DUAA 1SCZA 5KJVA 2E1VA 2E1UA 3MAEA 5FANA 1EAAA 1XMDA 4KECA 2II4A 2H3PA 5KJTA 4EPHA 2II3A 1EACA 1EADA 4N72A 4EP9A 2II5A 3FOTA 4G0BA 5T3EA 2FY2A 4EYWA 1QCAA 1XMCA 5DU9A 1NDIA 3B30A 2ZBAA 4G2MA 4JN5A 4G22A 3U9FA 1Q9JA 1XL7A 4HVMA 2IHWA 4CLAA 2JGPA 2XR7A 1CLAA 2BGHA 2RCUA 1NOCB 1XL8A 1Q23A 1EAEA 1DPCA 1NM8A 2XHGA 2RKVA 1S5OA 3B2SA 1DPDA 2E1TA 2I9DA 1DPBA 5KJUA 2FYOA 2RKTA 2H3UA 1NDBA 1PD5A 2DEBA 1T7NA 5FALA 3U9BA 1T7QA 1CIAA 2FY3A 1Q6XA 2VSQA 3L60A 1C4TA 4JN3A 5KJSA 2FY5A 2FW3A 5KJWA 1EAFA 1T1UA 2H4TA 3CLAA 1T7OA 1L5AA 1EABA 2FY4A 4KE4A 3FP0A 1E2OA
chains in the Genus database with same CATH topology
2XHGA 1NDFA 2H3WA 4EYWA 1S5OA 1Q6XA 2FY3A 5DU9A 1NDIA 2VSQA 5DUAA 4JN3A 4JN5A 2FYOA 2FY5A 1Q9JA 4HVMA 2FW3A 2H3PA 2H3UA 4EPHA 2JGPA 1NDBA 1T1UA 2H4TA 2DEBA 1T7NA 1T7OA 4EP9A 2RCUA 1L5AA 3FOTA 2FY4A 3FP0A 1NM8A 5T3EA 1T7QA 2FY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDF A;  2H3W A;  4EYW A;  1S5O A;  1Q6X A;  2FY3 A;  1NDI A;  2FYO A;  2FY5 A;  2FW3 A;  2H3P A;  2H3U A;  4EPH A;  1NDB A;  1T1U A;  2H4T A;  2DEB A;  1T7N A;  1T7O A;  4EP9 A;  2RCU A;  2FY4 A;  1NM8 A;  1T7Q A;  2FY2 A; 
#chains in the Genus database with same CATH topology
 1NDF A;  2H3W A;  2CLA A;  5DUA A;  1SCZ A;  5KJV A;  2E1V A;  2E1U A;  3MAE A;  5FAN A;  1EAA A;  1XMD A;  4KEC A;  2II4 A;  2H3P A;  5KJT A;  4EPH A;  2II3 A;  1EAC A;  1EAD A;  4N72 A;  4EP9 A;  2II5 A;  3FOT A;  4G0B A;  5T3E A;  2FY2 A;  4EYW A;  1QCA A;  1XMC A;  5DU9 A;  1NDI A;  3B30 A;  2ZBA A;  4G2M A;  4JN5 A;  4G22 A;  3U9F A;  1Q9J A;  1XL7 A;  4HVM A;  2IHW A;  4CLA A;  2JGP A;  2XR7 A;  1CLA A;  2BGH A;  2RCU A;  1NOC B;  1XL8 A;  1Q23 A;  1EAE A;  1DPC A;  1NM8 A;  2XHG A;  2RKV A;  1S5O A;  3B2S A;  1DPD A;  2E1T A;  2I9D A;  1DPB A;  5KJU A;  2FYO A;  2RKT A;  2H3U A;  1NDB A;  1PD5 A;  2DEB A;  1T7N A;  5FAL A;  3U9B A;  1T7Q A;  1CIA A;  2FY3 A;  1Q6X A;  2VSQ A;  3L60 A;  1C4T A;  4JN3 A;  5KJS A;  2FY5 A;  2FW3 A;  5KJW A;  1EAF A;  1T1U A;  2H4T A;  3CLA A;  1T7O A;  1L5A A;  1EAB A;  2FY4 A;  4KE4 A;  3FP0 A;  1E2O A; 
#chains in the Genus database with same CATH homology
 2XHG A;  1NDF A;  2H3W A;  4EYW A;  1S5O A;  1Q6X A;  2FY3 A;  5DU9 A;  1NDI A;  2VSQ A;  5DUA A;  4JN3 A;  4JN5 A;  2FYO A;  2FY5 A;  1Q9J A;  4HVM A;  2FW3 A;  2H3P A;  2H3U A;  4EPH A;  2JGP A;  1NDB A;  1T1U A;  2H4T A;  2DEB A;  1T7N A;  1T7O A;  4EP9 A;  2RCU A;  1L5A A;  3FOT A;  2FY4 A;  3FP0 A;  1NM8 A;  5T3E A;  1T7Q A;  2FY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...