1NM8A

Structure of human carnitine acetyltransferase: molecular basis for fatty acyl transfer
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
591
structure length
591
Chain Sequence
HHTDPLPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVYRSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSTPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carnitine O-acetyltransferase
publication title Structure of Human Carnitine Acetyltransferase. Molecular Basis for Fatty Acyl Transfer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 214
structure length 591
sequence length 591
ec nomenclature ec 2.3.1.7: Carnitine O-acetyltransferase.
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.40 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1nm8A01
3.30.559.70 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1nm8A02
1NM8A 2FW3A 1T1UA 4EYWA 2RCUA 2FY3A 2FYOA 4EPHA 4EP9A 2H3PA 1T7NA 2H3UA 1T7QA 1NDIA 2FY4A 2DEBA 1NDFA 2FY2A 2FY5A 1Q6XA 2H4TA 1T7OA 2H3WA 1S5OA 1NDBA
chains in the Genus database with same CATH superfamily
1NM8A 3FOTA 2IHWA 3CLAA 2CLAA 4G22A 4EPHA 1XMDA 4JN5A 3MAEA 1CIAA 5KJWA 3B30A 2H3UA 1Q9JA 3FP0A 2RKVA 1PD5A 1C4TA 2FY2A 2II3A 1Q6XA 3U9BA 1L5AA 2H3WA 1NDBA 3B2SA 1NDFA 5KJSA 1DPDA 3U9FA 2RCUA 2FY3A 2FYOA 4CLAA 4N72A 5FANA 2H3PA 1DPCA 4KECA 1XMCA 1T7NA 3L60A 2XR7A 1NDIA 1Q23A 4G2MA 2E1VA 2FY5A 2RKTA 1T7OA 2E1TA 1S5OA 1EACA 1DPBA 4G0BA 1E2OA 1T1UA 4EYWA 5KJTA 1EADA 2XHGA 4EP9A 2E1UA 5FALA 4KE4A 1SCZA 1EAEA 5DU9A 1T7QA 1QCAA 5KJUA 2VSQA 5T3EA 4JN3A 1XL7A 1EAFA 2FW3A 2ZBAA 1XL8A 4HVMA 1EABA 1NOCB 2JGPA 1CLAA 5DUAA 2II5A 2I9DA 2FY4A 2DEBA 2II4A 2H4TA 1EAAA 5KJVA 2BGHA
chains in the Genus database with same CATH topology
1NM8A 2FW3A 1T1UA 3FOTA 4EYWA 4HVMA 2RCUA 2FY3A 2FYOA 4EPHA 2XHGA 4JN5A 4EP9A 2H3PA 2JGPA 1T7NA 2H3UA 5DU9A 5DUAA 1T7QA 1NDIA 1Q9JA 2FY4A 3FP0A 2DEBA 2VSQA 1NDFA 2FY2A 5T3EA 2FY5A 4JN3A 1Q6XA 2H4TA 1T7OA 1L5AA 2H3WA 1S5OA 1NDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NM8 A;  2FW3 A;  1T1U A;  4EYW A;  2RCU A;  2FY3 A;  2FYO A;  4EPH A;  4EP9 A;  2H3P A;  1T7N A;  2H3U A;  1T7Q A;  1NDI A;  2FY4 A;  2DEB A;  1NDF A;  2FY2 A;  2FY5 A;  1Q6X A;  2H4T A;  1T7O A;  2H3W A;  1S5O A;  1NDB A; 
#chains in the Genus database with same CATH topology
 1NM8 A;  3FOT A;  2IHW A;  3CLA A;  2CLA A;  4G22 A;  4EPH A;  1XMD A;  4JN5 A;  3MAE A;  1CIA A;  5KJW A;  3B30 A;  2H3U A;  1Q9J A;  3FP0 A;  2RKV A;  1PD5 A;  1C4T A;  2FY2 A;  2II3 A;  1Q6X A;  3U9B A;  1L5A A;  2H3W A;  1NDB A;  3B2S A;  1NDF A;  5KJS A;  1DPD A;  3U9F A;  2RCU A;  2FY3 A;  2FYO A;  4CLA A;  4N72 A;  5FAN A;  2H3P A;  1DPC A;  4KEC A;  1XMC A;  1T7N A;  3L60 A;  2XR7 A;  1NDI A;  1Q23 A;  4G2M A;  2E1V A;  2FY5 A;  2RKT A;  1T7O A;  2E1T A;  1S5O A;  1EAC A;  1DPB A;  4G0B A;  1E2O A;  1T1U A;  4EYW A;  5KJT A;  1EAD A;  2XHG A;  4EP9 A;  2E1U A;  5FAL A;  4KE4 A;  1SCZ A;  1EAE A;  5DU9 A;  1T7Q A;  1QCA A;  5KJU A;  2VSQ A;  5T3E A;  4JN3 A;  1XL7 A;  1EAF A;  2FW3 A;  2ZBA A;  1XL8 A;  4HVM A;  1EAB A;  1NOC B;  2JGP A;  1CLA A;  5DUA A;  2II5 A;  2I9D A;  2FY4 A;  2DEB A;  2II4 A;  2H4T A;  1EAA A;  5KJV A;  2BGH A; 
#chains in the Genus database with same CATH homology
 1NM8 A;  2FW3 A;  1T1U A;  3FOT A;  4EYW A;  4HVM A;  2RCU A;  2FY3 A;  2FYO A;  4EPH A;  2XHG A;  4JN5 A;  4EP9 A;  2H3P A;  2JGP A;  1T7N A;  2H3U A;  5DU9 A;  5DUA A;  1T7Q A;  1NDI A;  1Q9J A;  2FY4 A;  3FP0 A;  2DEB A;  2VSQ A;  1NDF A;  2FY2 A;  5T3E A;  2FY5 A;  4JN3 A;  1Q6X A;  2H4T A;  1T7O A;  1L5A A;  2H3W A;  1S5O A;  1NDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...