1L5AA

Crystal structure of vibh, an nrps condensation enzyme
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
424
structure length
424
Chain Sequence
MLLAQKPFWQRHLAYPHINLDTVAHSLRLTGPLDTTLLLRALHLTVSEIDLFRARFSAQGELYWHPFSPPIDYQDLSIHLEAEPLAWRQIEQDLQRSSTLIDAPITSHQVYRLSHSEHLIYTRAHHIVLDGYGMMLFEQRLSQHYQSLLSGQTPTAAFKPYQSYLEEEAAYLTSHRYWQDKQFWQGYLREAPDLTLTSATYDPQLSHAVSLSYTLNSQLNHLLLKLANANQIGWPDALVALCALYLESAEPDAPWLWLPFMNRWGSVAANVPGLMVNSLPLLRLSAQQTSLGNYLKQSGQAIRSLYLHGRYRIEQIEQDQGLNAEQSYFMSPFINILPFESPHFADCQTELKVLASGSAEGINFTFRGSPQHELCLDITADLASYPQSHWQSHCERFPRFFEQLLARFQQVEQDVARLLAEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords amide synthase
publication title The structure of VibH represents nonribosomal peptide synthetase condensation, cyclization and epimerization domains.
pubmed rcsb
source organism Vibrio cholerae
total genus 136
structure length 424
sequence length 424
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1l5aA01
3.30.559.30 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1l5aA03
2VSQA 4N72A 4HVMA 1XMDA 1EAFA 2RKTA 1CIAA 2ZBAA 5FANA 2RKVA 2I9DA 1SCZA 2II4A 3MAEA 1DPDA 5KJWA 5KJVA 5T3EA 3B30A 5KJSA 5DUAA 5KJTA 1E2OA 5DU9A 2E1VA 3B2SA 5FALA 1Q23A 2XHGA 4JN5A 2CLAA 2IHWA 1EABA 2XR7A 4G22A 2E1TA 3U9FA 4KE4A 1EAEA 1EADA 1EACA 4KECA 2II5A 1Q9JA 4JN3A 2II3A 1C4TA 1XL7A 1DPCA 4G2MA 1L5AA 2BGHA 5KJUA 4CLAA 3FOTA 2JGPA 1CLAA 3FP0A 1XL8A 1EAAA 3L60A 1DPBA 2E1UA 3CLAA 1PD5A 1NOCB 3U9BA 1QCAA 1XMCA 4G0BA
chains in the Genus database with same CATH superfamily
2H4TA 2RKTA 1CIAA 2FY3A 2ZBAA 5KJWA 5KJVA 2H3PA 3B2SA 2FY5A 2XHGA 2XR7A 1EABA 4G22A 1T7OA 2FYOA 1XL7A 1DPCA 4G2MA 1XL8A 1EAAA 3CLAA 3U9BA 2CLAA 1XMCA 2VSQA 4N72A 4HVMA 1XMDA 1SCZA 1NDIA 5KJSA 5DUAA 5KJTA 1E2OA 5DU9A 5FALA 1T7QA 1T1UA 2FY4A 4KECA 1Q9JA 1Q6XA 2FY2A 1L5AA 2H3UA 2BGHA 3FOTA 1PD5A 1NOCB 1QCAA 4G0BA 1S5OA 1EAFA 2RKVA 2I9DA 1T7NA 3MAEA 1DPDA 5T3EA 3B30A 2RCUA 1Q23A 4JN5A 2IHWA 2E1TA 3U9FA 4EYWA 1EADA 1NM8A 4JN3A 2II3A 4CLAA 2DEBA 2JGPA 1CLAA 5FANA 2FW3A 1NDFA 2II4A 1NDBA 2E1VA 4EPHA 2H3WA 4KE4A 1EAEA 1EACA 2II5A 4EP9A 1C4TA 5KJUA 3FP0A 3L60A 1DPBA 2E1UA
chains in the Genus database with same CATH topology
2H4TA 2RKTA 1CIAA 2ZBAA 2FY3A 5KJWA 5KJVA 2H3PA 3B2SA 2FY5A 2XHGA 2XR7A 1EABA 4G22A 1T7OA 2FYOA 1XL7A 1DPCA 4G2MA 1XL8A 1EAAA 3CLAA 3U9BA 2CLAA 1XMCA 2VSQA 4N72A 4HVMA 1XMDA 1SCZA 1NDIA 5KJSA 5DUAA 5KJTA 1E2OA 5DU9A 5FALA 1T7QA 1T1UA 2FY4A 4KECA 1Q9JA 1Q6XA 2FY2A 1L5AA 2H3UA 2BGHA 3FOTA 1PD5A 1NOCB 1QCAA 4G0BA 1S5OA 1EAFA 2RKVA 2I9DA 3MAEA 1T7NA 1DPDA 5T3EA 3B30A 2RCUA 1Q23A 4JN5A 2IHWA 2E1TA 3U9FA 4EYWA 1EADA 1NM8A 4JN3A 2II3A 4CLAA 2DEBA 2JGPA 1CLAA 5FANA 2FW3A 1NDFA 2II4A 1NDBA 2E1VA 4EPHA 2H3WA 4KE4A 1EAEA 1EACA 2II5A 4EP9A 1C4TA 5KJUA 3FP0A 3L60A 1DPBA 2E1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSQ A;  4N72 A;  4HVM A;  1XMD A;  1EAF A;  2RKT A;  1CIA A;  2ZBA A;  5FAN A;  2RKV A;  2I9D A;  1SCZ A;  2II4 A;  3MAE A;  1DPD A;  5KJW A;  5KJV A;  5T3E A;  3B30 A;  5KJS A;  5DUA A;  5KJT A;  1E2O A;  5DU9 A;  2E1V A;  3B2S A;  5FAL A;  1Q23 A;  2XHG A;  4JN5 A;  2CLA A;  2IHW A;  1EAB A;  2XR7 A;  4G22 A;  2E1T A;  3U9F A;  4KE4 A;  1EAE A;  1EAD A;  1EAC A;  4KEC A;  2II5 A;  1Q9J A;  4JN3 A;  2II3 A;  1C4T A;  1XL7 A;  1DPC A;  4G2M A;  1L5A A;  2BGH A;  5KJU A;  4CLA A;  3FOT A;  2JGP A;  1CLA A;  3FP0 A;  1XL8 A;  1EAA A;  3L60 A;  1DPB A;  2E1U A;  3CLA A;  1PD5 A;  1NOC B;  3U9B A;  1QCA A;  1XMC A;  4G0B A; 
#chains in the Genus database with same CATH topology
 2H4T A;  2RKT A;  1CIA A;  2FY3 A;  2ZBA A;  5KJW A;  5KJV A;  2H3P A;  3B2S A;  2FY5 A;  2XHG A;  2XR7 A;  1EAB A;  4G22 A;  1T7O A;  2FYO A;  1XL7 A;  1DPC A;  4G2M A;  1XL8 A;  1EAA A;  3CLA A;  3U9B A;  2CLA A;  1XMC A;  2VSQ A;  4N72 A;  4HVM A;  1XMD A;  1SCZ A;  1NDI A;  5KJS A;  5DUA A;  5KJT A;  1E2O A;  5DU9 A;  5FAL A;  1T7Q A;  1T1U A;  2FY4 A;  4KEC A;  1Q9J A;  1Q6X A;  2FY2 A;  1L5A A;  2H3U A;  2BGH A;  3FOT A;  1PD5 A;  1NOC B;  1QCA A;  4G0B A;  1S5O A;  1EAF A;  2RKV A;  2I9D A;  1T7N A;  3MAE A;  1DPD A;  5T3E A;  3B30 A;  2RCU A;  1Q23 A;  4JN5 A;  2IHW A;  2E1T A;  3U9F A;  4EYW A;  1EAD A;  1NM8 A;  4JN3 A;  2II3 A;  4CLA A;  2DEB A;  2JGP A;  1CLA A;  5FAN A;  2FW3 A;  1NDF A;  2II4 A;  1NDB A;  2E1V A;  4EPH A;  2H3W A;  4KE4 A;  1EAE A;  1EAC A;  2II5 A;  4EP9 A;  1C4T A;  5KJU A;  3FP0 A;  3L60 A;  1DPB A;  2E1U A; 
#chains in the Genus database with same CATH homology
 2H4T A;  2RKT A;  1CIA A;  2ZBA A;  2FY3 A;  5KJW A;  5KJV A;  2H3P A;  3B2S A;  2FY5 A;  2XHG A;  2XR7 A;  1EAB A;  4G22 A;  1T7O A;  2FYO A;  1XL7 A;  1DPC A;  4G2M A;  1XL8 A;  1EAA A;  3CLA A;  3U9B A;  2CLA A;  1XMC A;  2VSQ A;  4N72 A;  4HVM A;  1XMD A;  1SCZ A;  1NDI A;  5KJS A;  5DUA A;  5KJT A;  1E2O A;  5DU9 A;  5FAL A;  1T7Q A;  1T1U A;  2FY4 A;  4KEC A;  1Q9J A;  1Q6X A;  2FY2 A;  1L5A A;  2H3U A;  2BGH A;  3FOT A;  1PD5 A;  1NOC B;  1QCA A;  4G0B A;  1S5O A;  1EAF A;  2RKV A;  2I9D A;  3MAE A;  1T7N A;  1DPD A;  5T3E A;  3B30 A;  2RCU A;  1Q23 A;  4JN5 A;  2IHW A;  2E1T A;  3U9F A;  4EYW A;  1EAD A;  1NM8 A;  4JN3 A;  2II3 A;  4CLA A;  2DEB A;  2JGP A;  1CLA A;  5FAN A;  2FW3 A;  1NDF A;  2II4 A;  1NDB A;  2E1V A;  4EPH A;  2H3W A;  4KE4 A;  1EAE A;  1EAC A;  2II5 A;  4EP9 A;  1C4T A;  5KJU A;  3FP0 A;  3L60 A;  1DPB A;  2E1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...