1L5AA

Crystal structure of vibh, an nrps condensation enzyme
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
424
structure length
424
Chain Sequence
b'MLLAQKPFWQRHLAYPHINLDTVAHSLRLTGPLDTTLLLRALHLTVSEIDLFRARFSAQGELYWHPFSPPIDYQDLSIHLEAEPLAWRQIEQDLQRSSTLIDAPITSHQVYRLSHSEHLIYTRAHHIVLDGYGMMLFEQRLSQHYQSLLSGQTPTAAFKPYQSYLEEEAAYLTSHRYWQDKQFWQGYLREAPDLTLTSATYDPQLSHAVSLSYTLNSQLNHLLLKLANANQIGWPDALVALCALYLESAEPDAPWLWLPFMNRWGSVAANVPGLMVNSLPLLRLSAQQTSLGNYLKQSGQAIRSLYLHGRYRIEQIEQDQGLNAEQSYFMSPFINILPFESPHFADCQTELKVLASGSAEGINFTFRGSPQHELCLDITADLASYPQSHWQSHCERFPRFFEQLLARFQQVEQDVARLLAEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords amide synthase
publication title The structure of VibH represents nonribosomal peptide synthetase condensation, cyclization and epimerization domains.
pubmed rcsb
source organism Vibrio cholerae
molecule tags Biosynthetic protein
total genus 136
structure length 424
sequence length 424
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1l5aA01
3.30.559.30 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1l5aA03
1XMDA 1XL7A 1DPBA 5T3EA 3B2SA 2BGHA 4G22A 5FALA 4CLAA 1CIAA 1Q23A 1C4TA 5DUAA 1EAFA 2IHWA 3B30A 4JN5A 3U9BA 1XMCA 1Q9JA 4G0BA 5KJWA 5KJUA 2ZBAA 2XR7A 2CLAA 4KECA 1EADA 1XL8A 1CLAA 2E1TA 2I9DA 2RKTA 5KJVA 2VSQA 1QCAA 2II4A 3L60A 4JN3A 5KJSA 1E2OA 1PD5A 3MAEA 4G2MA 4N72A 3U9FA 4HVMA 5KJTA 2E1UA 3CLAA 1EABA 2RKVA 3FOTA 1DPDA 1EACA 5DU9A 1SCZA 1L5AA 2II5A 2E1VA 5FANA 1EAAA 1EAEA 2JGPA 2XHGA 1NOCB 1DPCA 3FP0A 4KE4A 2II3A
chains in the Genus database with same CATH superfamily
1XMDA 1XL7A 5T3EA 3B2SA 5FALA 1Q23A 2FY5A 4G0BA 1S5OA 2I9DA 1E2OA 4N72A 3CLAA 1EABA 3FOTA 1NM8A 1SCZA 1EAAA 2JGPA 1DPCA 4KE4A 1T7NA 2FW3A 1DPBA 2FY3A 2BGHA 4G22A 4CLAA 1C4TA 2H3UA 1NDFA 1XMCA 2DEBA 2FY2A 5KJWA 5KJUA 2ZBAA 2FYOA 1CLAA 4EP9A 1QCAA 4HVMA 1NDIA 5KJTA 2II5A 2E1VA 1T7QA 1EAEA 2H3WA 1T1UA 2IHWA 3B30A 4JN5A 3U9BA 1Q9JA 1T7OA 2H4TA 4KECA 4EPHA 5KJVA 5KJSA 2H3PA 3L60A 1PD5A 3MAEA 4G2MA 3U9FA 4EYWA 2E1UA 2FY4A 1EACA 2RCUA 3FP0A 1NDBA 1CIAA 1Q6XA 5DUAA 1EAFA 2XR7A 2CLAA 1EADA 1XL8A 2E1TA 2RKTA 2VSQA 4JN3A 2II4A 2RKVA 1L5AA 1DPDA 5DU9A 5FANA 2XHGA 1NOCB 2II3A
chains in the Genus database with same CATH topology
1XMDA 1XL7A 5T3EA 3B2SA 5FALA 1Q23A 2FY5A 4G0BA 1S5OA 2I9DA 1E2OA 4N72A 3CLAA 1EABA 3FOTA 1NM8A 1SCZA 1EAAA 2JGPA 1DPCA 4KE4A 1T7NA 2FW3A 1DPBA 2FY3A 2BGHA 4G22A 4CLAA 1C4TA 2H3UA 1XMCA 5KJWA 1NDFA 2DEBA 5KJUA 2FY2A 2ZBAA 2FYOA 1CLAA 4EP9A 1QCAA 4HVMA 5KJTA 1NDIA 2II5A 2E1VA 1T7QA 1EAEA 2H3WA 1T1UA 2IHWA 3B30A 4JN5A 3U9BA 1Q9JA 1T7OA 2H4TA 4KECA 5KJVA 5KJSA 4EPHA 3L60A 2H3PA 1PD5A 3MAEA 4G2MA 3U9FA 4EYWA 2E1UA 2FY4A 1EACA 2RCUA 3FP0A 1NDBA 1CIAA 5DUAA 1Q6XA 1EAFA 2XR7A 2CLAA 1EADA 1XL8A 2E1TA 2RKTA 2VSQA 4JN3A 2II4A 2RKVA 1L5AA 1DPDA 5DU9A 5FANA 2XHGA 1NOCB 2II3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMD A;  1XL7 A;  1DPB A;  5T3E A;  3B2S A;  2BGH A;  4G22 A;  5FAL A;  4CLA A;  1CIA A;  1Q23 A;  1C4T A;  5DUA A;  1EAF A;  2IHW A;  3B30 A;  4JN5 A;  3U9B A;  1XMC A;  1Q9J A;  4G0B A;  5KJW A;  5KJU A;  2ZBA A;  2XR7 A;  2CLA A;  4KEC A;  1EAD A;  1XL8 A;  1CLA A;  2E1T A;  2I9D A;  2RKT A;  5KJV A;  2VSQ A;  1QCA A;  2II4 A;  3L60 A;  4JN3 A;  5KJS A;  1E2O A;  1PD5 A;  3MAE A;  4G2M A;  4N72 A;  3U9F A;  4HVM A;  5KJT A;  2E1U A;  3CLA A;  1EAB A;  2RKV A;  3FOT A;  1DPD A;  1EAC A;  5DU9 A;  1SCZ A;  1L5A A;  2II5 A;  2E1V A;  5FAN A;  1EAA A;  1EAE A;  2JGP A;  2XHG A;  1NOC B;  1DPC A;  3FP0 A;  4KE4 A;  2II3 A; 
#chains in the Genus database with same CATH topology
 1XMD A;  1XL7 A;  5T3E A;  3B2S A;  5FAL A;  1Q23 A;  2FY5 A;  4G0B A;  1S5O A;  2I9D A;  1E2O A;  4N72 A;  3CLA A;  1EAB A;  3FOT A;  1NM8 A;  1SCZ A;  1EAA A;  2JGP A;  1DPC A;  4KE4 A;  1T7N A;  2FW3 A;  1DPB A;  2FY3 A;  2BGH A;  4G22 A;  4CLA A;  1C4T A;  2H3U A;  1NDF A;  1XMC A;  2DEB A;  2FY2 A;  5KJW A;  5KJU A;  2ZBA A;  2FYO A;  1CLA A;  4EP9 A;  1QCA A;  4HVM A;  1NDI A;  5KJT A;  2II5 A;  2E1V A;  1T7Q A;  1EAE A;  2H3W A;  1T1U A;  2IHW A;  3B30 A;  4JN5 A;  3U9B A;  1Q9J A;  1T7O A;  2H4T A;  4KEC A;  4EPH A;  5KJV A;  5KJS A;  2H3P A;  3L60 A;  1PD5 A;  3MAE A;  4G2M A;  3U9F A;  4EYW A;  2E1U A;  2FY4 A;  1EAC A;  2RCU A;  3FP0 A;  1NDB A;  1CIA A;  1Q6X A;  5DUA A;  1EAF A;  2XR7 A;  2CLA A;  1EAD A;  1XL8 A;  2E1T A;  2RKT A;  2VSQ A;  4JN3 A;  2II4 A;  2RKV A;  1L5A A;  1DPD A;  5DU9 A;  5FAN A;  2XHG A;  1NOC B;  2II3 A; 
#chains in the Genus database with same CATH homology
 1XMD A;  1XL7 A;  5T3E A;  3B2S A;  5FAL A;  1Q23 A;  2FY5 A;  4G0B A;  1S5O A;  2I9D A;  1E2O A;  4N72 A;  3CLA A;  1EAB A;  3FOT A;  1NM8 A;  1SCZ A;  1EAA A;  2JGP A;  1DPC A;  4KE4 A;  1T7N A;  2FW3 A;  1DPB A;  2FY3 A;  2BGH A;  4G22 A;  4CLA A;  1C4T A;  2H3U A;  1XMC A;  5KJW A;  1NDF A;  2DEB A;  5KJU A;  2FY2 A;  2ZBA A;  2FYO A;  1CLA A;  4EP9 A;  1QCA A;  4HVM A;  5KJT A;  1NDI A;  2II5 A;  2E1V A;  1T7Q A;  1EAE A;  2H3W A;  1T1U A;  2IHW A;  3B30 A;  4JN5 A;  3U9B A;  1Q9J A;  1T7O A;  2H4T A;  4KEC A;  5KJV A;  5KJS A;  4EPH A;  3L60 A;  2H3P A;  1PD5 A;  3MAE A;  4G2M A;  3U9F A;  4EYW A;  2E1U A;  2FY4 A;  1EAC A;  2RCU A;  3FP0 A;  1NDB A;  1CIA A;  5DUA A;  1Q6X A;  1EAF A;  2XR7 A;  2CLA A;  1EAD A;  1XL8 A;  2E1T A;  2RKT A;  2VSQ A;  4JN3 A;  2II4 A;  2RKV A;  1L5A A;  1DPD A;  5DU9 A;  5FAN A;  2XHG A;  1NOC B;  2II3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...