1L5AA

Crystal structure of vibh, an nrps condensation enzyme
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
424
structure length
424
Chain Sequence
MLLAQKPFWQRHLAYPHINLDTVAHSLRLTGPLDTTLLLRALHLTVSEIDLFRARFSAQGELYWHPFSPPIDYQDLSIHLEAEPLAWRQIEQDLQRSSTLIDAPITSHQVYRLSHSEHLIYTRAHHIVLDGYGMMLFEQRLSQHYQSLLSGQTPTAAFKPYQSYLEEEAAYLTSHRYWQDKQFWQGYLREAPDLTLTSATYDPQLSHAVSLSYTLNSQLNHLLLKLANANQIGWPDALVALCALYLESAEPDAPWLWLPFMNRWGSVAANVPGLMVNSLPLLRLSAQQTSLGNYLKQSGQAIRSLYLHGRYRIEQIEQDQGLNAEQSYFMSPFINILPFESPHFADCQTELKVLASGSAEGINFTFRGSPQHELCLDITADLASYPQSHWQSHCERFPRFFEQLLARFQQVEQDVARLLAEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords amide synthase
publication title The structure of VibH represents nonribosomal peptide synthetase condensation, cyclization and epimerization domains.
pubmed rcsb
source organism Vibrio cholerae
molecule tags Biosynthetic protein
total genus 136
structure length 424
sequence length 424
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1l5aA01
3.30.559.30 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol Acetyltransferase 1l5aA03
1DPBA 1Q23A 1XL8A 1EADA 1XL7A 1XMDA 2E1VA 5KJTA 4G0BA 4JN3A 4CLAA 1QCAA 2E1UA 3L60A 3U9FA 2BGHA 4JN5A 3CLAA 4KECA 5DU9A 2XR7A 1C4TA 2E1TA 2JGPA 5DUAA 4HVMA 1CLAA 1XMCA 2I9DA 5KJVA 5KJSA 1EAFA 1E2OA 1L5AA 1CIAA 1Q9JA 3FP0A 4G22A 4G2MA 1EACA 5T3EA 2II4A 5KJWA 2II5A 4KE4A 4N72A 2RKTA 3U9BA 5FANA 1DPDA 3MAEA 5KJUA 1NOCB 1SCZA 2VSQA 3B2SA 5FALA 2IHWA 2II3A 2XHGA 1DPCA 1EAAA 2CLAA 2RKVA 1PD5A 3FOTA 2ZBAA 1EAEA 3B30A 1EABA
chains in the Genus database with same CATH superfamily
2FW3A 1T7QA 2XR7A 1C4TA 2JGPA 5DUAA 2H4TA 1XMCA 1EACA 4KE4A 4N72A 4EYWA 1NM8A 2H3UA 1NOCB 1T1UA 2XHGA 2ZBAA 1DPBA 3U9FA 2BGHA 4JN5A 5DU9A 1CLAA 1Q9JA 4G2MA 5T3EA 1Q6XA 2RCUA 5KJWA 2II5A 2FY3A 3U9BA 5FANA 1NDIA 2FY4A 2H3WA 2IHWA 3FOTA 2E1TA 1EAEA 3B30A 1EABA 5KJUA 1Q23A 1XL8A 1XL7A 4G0BA 4EPHA 1QCAA 3L60A 3CLAA 4KECA 1EAFA 4EP9A 1E2OA 4G22A 1T7OA 2RKTA 3MAEA 1SCZA 2VSQA 5FALA 2II3A 2RKVA 1EAAA 1S5OA 2CLAA 2FY2A 1PD5A 4CLAA 2E1VA 1EADA 1XMDA 5KJTA 4JN3A 1NDBA 2E1UA 1T7NA 5KJSA 5KJVA 1L5AA 1CIAA 3FP0A 2DEBA 2FYOA 2II4A 2H3PA 1DPDA 3B2SA 2FY5A 1NDFA 1DPCA 4HVMA 2I9DA
chains in the Genus database with same CATH topology
2FW3A 1T7QA 2XR7A 1C4TA 2JGPA 5DUAA 2H4TA 1XMCA 1EACA 4KE4A 4N72A 4EYWA 1NM8A 2H3UA 1NOCB 1T1UA 2XHGA 2ZBAA 1DPBA 3U9FA 2BGHA 4JN5A 5DU9A 1CLAA 1Q9JA 4G2MA 5T3EA 5KJWA 1Q6XA 2RCUA 2II5A 2FY3A 3U9BA 5FANA 1NDIA 2FY4A 2H3WA 2IHWA 3FOTA 2E1TA 5KJUA 1EAEA 3B30A 1EABA 1Q23A 1XL8A 1XL7A 4G0BA 4EPHA 1QCAA 3L60A 3CLAA 4KECA 1EAFA 4EP9A 1E2OA 4G22A 1T7OA 2RKTA 3MAEA 1SCZA 2VSQA 5FALA 2II3A 2RKVA 1EAAA 2CLAA 1S5OA 1PD5A 2FY2A 4CLAA 2E1VA 1EADA 1XMDA 5KJTA 4JN3A 1NDBA 2E1UA 1T7NA 5KJSA 5KJVA 1L5AA 1CIAA 3FP0A 2DEBA 2FYOA 2II4A 2H3PA 1DPDA 3B2SA 2FY5A 1NDFA 4HVMA 1DPCA 2I9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DPB A;  1Q23 A;  1XL8 A;  1EAD A;  1XL7 A;  1XMD A;  2E1V A;  5KJT A;  4G0B A;  4JN3 A;  4CLA A;  1QCA A;  2E1U A;  3L60 A;  3U9F A;  2BGH A;  4JN5 A;  3CLA A;  4KEC A;  5DU9 A;  2XR7 A;  1C4T A;  2E1T A;  2JGP A;  5DUA A;  4HVM A;  1CLA A;  1XMC A;  2I9D A;  5KJV A;  5KJS A;  1EAF A;  1E2O A;  1L5A A;  1CIA A;  1Q9J A;  3FP0 A;  4G22 A;  4G2M A;  1EAC A;  5T3E A;  2II4 A;  5KJW A;  2II5 A;  4KE4 A;  4N72 A;  2RKT A;  3U9B A;  5FAN A;  1DPD A;  3MAE A;  5KJU A;  1NOC B;  1SCZ A;  2VSQ A;  3B2S A;  5FAL A;  2IHW A;  2II3 A;  2XHG A;  1DPC A;  1EAA A;  2CLA A;  2RKV A;  1PD5 A;  3FOT A;  2ZBA A;  1EAE A;  3B30 A;  1EAB A; 
#chains in the Genus database with same CATH topology
 2FW3 A;  1T7Q A;  2XR7 A;  1C4T A;  2JGP A;  5DUA A;  2H4T A;  1XMC A;  1EAC A;  4KE4 A;  4N72 A;  4EYW A;  1NM8 A;  2H3U A;  1NOC B;  1T1U A;  2XHG A;  2ZBA A;  1DPB A;  3U9F A;  2BGH A;  4JN5 A;  5DU9 A;  1CLA A;  1Q9J A;  4G2M A;  5T3E A;  1Q6X A;  2RCU A;  5KJW A;  2II5 A;  2FY3 A;  3U9B A;  5FAN A;  1NDI A;  2FY4 A;  2H3W A;  2IHW A;  3FOT A;  2E1T A;  1EAE A;  3B30 A;  1EAB A;  5KJU A;  1Q23 A;  1XL8 A;  1XL7 A;  4G0B A;  4EPH A;  1QCA A;  3L60 A;  3CLA A;  4KEC A;  1EAF A;  4EP9 A;  1E2O A;  4G22 A;  1T7O A;  2RKT A;  3MAE A;  1SCZ A;  2VSQ A;  5FAL A;  2II3 A;  2RKV A;  1EAA A;  1S5O A;  2CLA A;  2FY2 A;  1PD5 A;  4CLA A;  2E1V A;  1EAD A;  1XMD A;  5KJT A;  4JN3 A;  1NDB A;  2E1U A;  1T7N A;  5KJS A;  5KJV A;  1L5A A;  1CIA A;  3FP0 A;  2DEB A;  2FYO A;  2II4 A;  2H3P A;  1DPD A;  3B2S A;  2FY5 A;  1NDF A;  1DPC A;  4HVM A;  2I9D A; 
#chains in the Genus database with same CATH homology
 2FW3 A;  1T7Q A;  2XR7 A;  1C4T A;  2JGP A;  5DUA A;  2H4T A;  1XMC A;  1EAC A;  4KE4 A;  4N72 A;  4EYW A;  1NM8 A;  2H3U A;  1NOC B;  1T1U A;  2XHG A;  2ZBA A;  1DPB A;  3U9F A;  2BGH A;  4JN5 A;  5DU9 A;  1CLA A;  1Q9J A;  4G2M A;  5T3E A;  5KJW A;  1Q6X A;  2RCU A;  2II5 A;  2FY3 A;  3U9B A;  5FAN A;  1NDI A;  2FY4 A;  2H3W A;  2IHW A;  3FOT A;  2E1T A;  5KJU A;  1EAE A;  3B30 A;  1EAB A;  1Q23 A;  1XL8 A;  1XL7 A;  4G0B A;  4EPH A;  1QCA A;  3L60 A;  3CLA A;  4KEC A;  1EAF A;  4EP9 A;  1E2O A;  4G22 A;  1T7O A;  2RKT A;  3MAE A;  1SCZ A;  2VSQ A;  5FAL A;  2II3 A;  2RKV A;  1EAA A;  2CLA A;  1S5O A;  1PD5 A;  2FY2 A;  4CLA A;  2E1V A;  1EAD A;  1XMD A;  5KJT A;  4JN3 A;  1NDB A;  2E1U A;  1T7N A;  5KJS A;  5KJV A;  1L5A A;  1CIA A;  3FP0 A;  2DEB A;  2FYO A;  2II4 A;  2H3P A;  1DPD A;  3B2S A;  2FY5 A;  1NDF A;  4HVM A;  1DPC A;  2I9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...