5FALA

Crystal structure of pvhct in complex with coa and p-coumaroyl-shikimate
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
447
structure length
435
Chain Sequence
HMKITVRGSEMVYPAAETPRRRLWNSGPDLVVPRFHTPSVYFFRRRDGEGNDLAAADGSFFDGARMRRALAEALVPFYPMAGRLARDEDGRVEIDCNAGGVLFQEADAPDATVDDFGDFAPTMELKRLIPTVEYTDDISAFPLLVVQVTHFKCGGVAIGVGMQHHVADGFSGLHFINSWADLCRGVPFAVMPYIDRSLLRARDPPTPVYPHVEYQPAPAMLSTPPAAVAIFRLSRADLGRLRSQIPAREGVPRLSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLADAGTVTAGVAEGAAVIQAALDRMDEGYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKFIYDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
publication title Exploiting the Substrate Promiscuity of Hydroxycinnamoyl-CoA:Shikimate Hydroxycinnamoyl Transferase to Reduce Lignin.
pubmed doi rcsb
source organism Panicum virgatum
total genus 124
structure length 435
sequence length 447
ec nomenclature
pdb deposition date 2015-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5falA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5falA01
3MAEA 4CLAA 4G0BA 4JN5A 2BGHA 3CLAA 4G22A 5KJUA 1Q23A 3B2SA 1SCZA 2E1TA 5DUAA 1XL8A 2CLAA 2XHGA 1DPBA 1XL7A 4G2MA 2II5A 5DU9A 1DPDA 2E1VA 2II3A 3FOTA 2IHWA 5T3EA 4KE4A 4KECA 5KJWA 1EAFA 2RKVA 5KJSA 4N72A 5KJTA 1L5AA 1XMDA 2RKTA 2II4A 1XMCA 2VSQA 2I9DA 2ZBAA 1E2OA 3B30A 1CLAA 1NOCB 1PD5A 5FANA 1Q9JA 1QCAA 4HVMA 5KJVA 1EABA 5FALA 1EAEA 3U9BA 1DPCA 4JN3A 3FP0A 2JGPA 2XR7A 2E1UA 1C4TA 3U9FA 1CIAA 1EAAA 1EACA 1EADA 3L60A
chains in the Genus database with same CATH superfamily
2FY5A 4JN5A 2E1TA 5DUAA 5KJSA 1XL7A 5DU9A 2II5A 1DPDA 2FY2A 5T3EA 5KJWA 1EAFA 4N72A 2RKTA 1XMCA 2H3UA 2ZBAA 1E2OA 1NOCB 5KJVA 3U9BA 4JN3A 2E1UA 2FYOA 4CLAA 2H3WA 2FW3A 2FY4A 4G2MA 1DPBA 2FY3A 4EYWA 1T7QA 3FOTA 1NM8A 1XMDA 1T7OA 4EPHA 2H3PA 1CLAA 1PD5A 4HVMA 1NDIA 1DPCA 1T1UA 2XR7A 1C4TA 3U9FA 2XHGA 1EADA 3MAEA 1Q6XA 2RCUA 4G0BA 4G22A 5KJUA 1Q23A 3B2SA 1NDBA 2CLAA 2II3A 1L5AA 2H4TA 2VSQA 2I9DA 3B30A 5FALA 1NDFA 1EACA 2BGHA 3CLAA 1S5OA 1SCZA 1XL8A 2E1VA 2IHWA 4KE4A 4KECA 2DEBA 2RKVA 5KJTA 1T7NA 2II4A 4EP9A 5FANA 1Q9JA 1QCAA 1EABA 1EAEA 3FP0A 2JGPA 1CIAA 1EAAA 3L60A
chains in the Genus database with same CATH topology
3MAEA 4CLAA 4G0BA 4JN5A 2BGHA 3CLAA 4G22A 5KJUA 1Q23A 3B2SA 1SCZA 2E1TA 5DUAA 1XL8A 2CLAA 2XHGA 1DPBA 1XL7A 4G2MA 2II5A 5DU9A 1DPDA 2E1VA 2II3A 3FOTA 2IHWA 5T3EA 4KE4A 4KECA 5KJWA 1EAFA 2RKVA 5KJSA 4N72A 5KJTA 1L5AA 1XMDA 2RKTA 2II4A 1XMCA 2VSQA 2I9DA 2ZBAA 1E2OA 3B30A 1CLAA 1NOCB 1PD5A 5FANA 1Q9JA 1QCAA 4HVMA 5KJVA 1EABA 5FALA 1EAEA 3U9BA 1DPCA 4JN3A 3FP0A 2JGPA 2XR7A 2E1UA 1C4TA 3U9FA 1CIAA 1EAAA 1EACA 1EADA 3L60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAE A;  4CLA A;  4G0B A;  4JN5 A;  2BGH A;  3CLA A;  4G22 A;  5KJU A;  1Q23 A;  3B2S A;  1SCZ A;  2E1T A;  5DUA A;  1XL8 A;  2CLA A;  2XHG A;  1DPB A;  1XL7 A;  4G2M A;  2II5 A;  5DU9 A;  1DPD A;  2E1V A;  2II3 A;  3FOT A;  2IHW A;  5T3E A;  4KE4 A;  4KEC A;  5KJW A;  1EAF A;  2RKV A;  5KJS A;  4N72 A;  5KJT A;  1L5A A;  1XMD A;  2RKT A;  2II4 A;  1XMC A;  2VSQ A;  2I9D A;  2ZBA A;  1E2O A;  3B30 A;  1CLA A;  1NOC B;  1PD5 A;  5FAN A;  1Q9J A;  1QCA A;  4HVM A;  5KJV A;  1EAB A;  5FAL A;  1EAE A;  3U9B A;  1DPC A;  4JN3 A;  3FP0 A;  2JGP A;  2XR7 A;  2E1U A;  1C4T A;  3U9F A;  1CIA A;  1EAA A;  1EAC A;  1EAD A;  3L60 A; 
#chains in the Genus database with same CATH topology
 2FY5 A;  4JN5 A;  2E1T A;  5DUA A;  5KJS A;  1XL7 A;  5DU9 A;  2II5 A;  1DPD A;  2FY2 A;  5T3E A;  5KJW A;  1EAF A;  4N72 A;  2RKT A;  1XMC A;  2H3U A;  2ZBA A;  1E2O A;  1NOC B;  5KJV A;  3U9B A;  4JN3 A;  2E1U A;  2FYO A;  4CLA A;  2H3W A;  2FW3 A;  2FY4 A;  4G2M A;  1DPB A;  2FY3 A;  4EYW A;  1T7Q A;  3FOT A;  1NM8 A;  1XMD A;  1T7O A;  4EPH A;  2H3P A;  1CLA A;  1PD5 A;  4HVM A;  1NDI A;  1DPC A;  1T1U A;  2XR7 A;  1C4T A;  3U9F A;  2XHG A;  1EAD A;  3MAE A;  1Q6X A;  2RCU A;  4G0B A;  4G22 A;  5KJU A;  1Q23 A;  3B2S A;  1NDB A;  2CLA A;  2II3 A;  1L5A A;  2H4T A;  2VSQ A;  2I9D A;  3B30 A;  5FAL A;  1NDF A;  1EAC A;  2BGH A;  3CLA A;  1S5O A;  1SCZ A;  1XL8 A;  2E1V A;  2IHW A;  4KE4 A;  4KEC A;  2DEB A;  2RKV A;  5KJT A;  1T7N A;  2II4 A;  4EP9 A;  5FAN A;  1Q9J A;  1QCA A;  1EAB A;  1EAE A;  3FP0 A;  2JGP A;  1CIA A;  1EAA A;  3L60 A; 
#chains in the Genus database with same CATH homology
 3MAE A;  4CLA A;  4G0B A;  4JN5 A;  2BGH A;  3CLA A;  4G22 A;  5KJU A;  1Q23 A;  3B2S A;  1SCZ A;  2E1T A;  5DUA A;  1XL8 A;  2CLA A;  2XHG A;  1DPB A;  1XL7 A;  4G2M A;  2II5 A;  5DU9 A;  1DPD A;  2E1V A;  2II3 A;  3FOT A;  2IHW A;  5T3E A;  4KE4 A;  4KEC A;  5KJW A;  1EAF A;  2RKV A;  5KJS A;  4N72 A;  5KJT A;  1L5A A;  1XMD A;  2RKT A;  2II4 A;  1XMC A;  2VSQ A;  2I9D A;  2ZBA A;  1E2O A;  3B30 A;  1CLA A;  1NOC B;  1PD5 A;  5FAN A;  1Q9J A;  1QCA A;  4HVM A;  5KJV A;  1EAB A;  5FAL A;  1EAE A;  3U9B A;  1DPC A;  4JN3 A;  3FP0 A;  2JGP A;  2XR7 A;  2E1U A;  1C4T A;  3U9F A;  1CIA A;  1EAA A;  1EAC A;  1EAD A;  3L60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...