5FALA

Crystal structure of pvhct in complex with coa and p-coumaroyl-shikimate
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
447
structure length
435
Chain Sequence
HMKITVRGSEMVYPAAETPRRRLWNSGPDLVVPRFHTPSVYFFRRRDGEGNDLAAADGSFFDGARMRRALAEALVPFYPMAGRLARDEDGRVEIDCNAGGVLFQEADAPDATVDDFGDFAPTMELKRLIPTVEYTDDISAFPLLVVQVTHFKCGGVAIGVGMQHHVADGFSGLHFINSWADLCRGVPFAVMPYIDRSLLRARDPPTPVYPHVEYQPAPAMLSTPPAAVAIFRLSRADLGRLRSQIPAREGVPRLSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLADAGTVTAGVAEGAAVIQAALDRMDEGYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKFIYDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
publication title Exploiting the Substrate Promiscuity of Hydroxycinnamoyl-CoA:Shikimate Hydroxycinnamoyl Transferase to Reduce Lignin.
pubmed doi rcsb
source organism Panicum virgatum
molecule tags Transferase
total genus 124
structure length 435
sequence length 447
ec nomenclature
pdb deposition date 2015-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5falA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5falA01
1QCAA 4KECA 2RKVA 1EAEA 1C4TA 1XL7A 2II5A 3U9BA 1Q23A 1CLAA 3FP0A 4G0BA 1DPDA 1SCZA 2RKTA 1EAFA 2E1UA 2ZBAA 4G22A 5DU9A 1EADA 5FALA 2II4A 5FANA 3U9FA 2XHGA 1EABA 1EAAA 1E2OA 2BGHA 2II3A 3CLAA 5KJTA 4JN3A 4CLAA 4G2MA 2VSQA 4HVMA 3L60A 3B2SA 1DPCA 1XL8A 2I9DA 5T3EA 1XMDA 1XMCA 5KJSA 5DUAA 2CLAA 1L5AA 1NOCB 2E1TA 4JN5A 5KJUA 1Q9JA 3B30A 1CIAA 5KJWA 3FOTA 2IHWA 5KJVA 2XR7A 4KE4A 1EACA 3MAEA 2JGPA 4N72A 1DPBA 2E1VA 1PD5A
chains in the Genus database with same CATH superfamily
1QCAA 2RKVA 1C4TA 1Q23A 4G0BA 1SCZA 1EAFA 1T7NA 2ZBAA 1EAAA 2BGHA 3CLAA 4JN3A 4HVMA 3B2SA 1DPCA 1XL8A 1NOCB 5KJUA 3B30A 2FY3A 3FOTA 1T7QA 1EACA 1XL7A 1CLAA 4EPHA 1EADA 2H3PA 2XHGA 1EABA 1E2OA 5KJTA 4G2MA 2VSQA 1S5OA 3L60A 2DEBA 2I9DA 5KJSA 5DUAA 2CLAA 1L5AA 4JN5A 2H3UA 2FYOA 2JGPA 1NDFA 4N72A 1PD5A 4EP9A 4KECA 1EAEA 2H4TA 1T1UA 2RKTA 4G22A 5FANA 4CLAA 2FY5A 5T3EA 1XMDA 1XMCA 5KJVA 2H3WA 3MAEA 1DPBA 2E1VA 4EYWA 3U9BA 2II5A 2RCUA 3FP0A 1NDBA 1NM8A 1DPDA 2E1UA 2FY4A 5FALA 2II4A 2II3A 1NDIA 2FW3A 2E1TA 1Q9JA 5KJWA 1CIAA 1T7OA 1Q6XA 2FY2A 2IHWA 2XR7A 4KE4A 5DU9A 3U9FA
chains in the Genus database with same CATH topology
1QCAA 4KECA 2RKVA 1EAEA 1C4TA 1XL7A 2II5A 3U9BA 1Q23A 1CLAA 3FP0A 4G0BA 1DPDA 1SCZA 2RKTA 1EAFA 2E1UA 2ZBAA 4G22A 5DU9A 1EADA 5FALA 2II4A 5FANA 3U9FA 2XHGA 1EABA 1EAAA 1E2OA 2BGHA 2II3A 3CLAA 5KJTA 4JN3A 4CLAA 4G2MA 2VSQA 4HVMA 3L60A 3B2SA 1DPCA 1XL8A 2I9DA 5T3EA 1XMDA 1XMCA 5KJSA 5DUAA 2CLAA 1L5AA 1NOCB 2E1TA 4JN5A 5KJUA 1Q9JA 3B30A 1CIAA 5KJWA 3FOTA 2IHWA 5KJVA 2XR7A 4KE4A 1EACA 3MAEA 2JGPA 4N72A 1DPBA 2E1VA 1PD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCA A;  4KEC A;  2RKV A;  1EAE A;  1C4T A;  1XL7 A;  2II5 A;  3U9B A;  1Q23 A;  1CLA A;  3FP0 A;  4G0B A;  1DPD A;  1SCZ A;  2RKT A;  1EAF A;  2E1U A;  2ZBA A;  4G22 A;  5DU9 A;  1EAD A;  5FAL A;  2II4 A;  5FAN A;  3U9F A;  2XHG A;  1EAB A;  1EAA A;  1E2O A;  2BGH A;  2II3 A;  3CLA A;  5KJT A;  4JN3 A;  4CLA A;  4G2M A;  2VSQ A;  4HVM A;  3L60 A;  3B2S A;  1DPC A;  1XL8 A;  2I9D A;  5T3E A;  1XMD A;  1XMC A;  5KJS A;  5DUA A;  2CLA A;  1L5A A;  1NOC B;  2E1T A;  4JN5 A;  5KJU A;  1Q9J A;  3B30 A;  1CIA A;  5KJW A;  3FOT A;  2IHW A;  5KJV A;  2XR7 A;  4KE4 A;  1EAC A;  3MAE A;  2JGP A;  4N72 A;  1DPB A;  2E1V A;  1PD5 A; 
#chains in the Genus database with same CATH topology
 1QCA A;  2RKV A;  1C4T A;  1Q23 A;  4G0B A;  1SCZ A;  1EAF A;  1T7N A;  2ZBA A;  1EAA A;  2BGH A;  3CLA A;  4JN3 A;  4HVM A;  3B2S A;  1DPC A;  1XL8 A;  1NOC B;  5KJU A;  3B30 A;  2FY3 A;  3FOT A;  1T7Q A;  1EAC A;  1XL7 A;  1CLA A;  4EPH A;  1EAD A;  2H3P A;  2XHG A;  1EAB A;  1E2O A;  5KJT A;  4G2M A;  2VSQ A;  1S5O A;  3L60 A;  2DEB A;  2I9D A;  5KJS A;  5DUA A;  2CLA A;  1L5A A;  4JN5 A;  2H3U A;  2FYO A;  2JGP A;  1NDF A;  4N72 A;  1PD5 A;  4EP9 A;  4KEC A;  1EAE A;  2H4T A;  1T1U A;  2RKT A;  4G22 A;  5FAN A;  4CLA A;  2FY5 A;  5T3E A;  1XMD A;  1XMC A;  5KJV A;  2H3W A;  3MAE A;  1DPB A;  2E1V A;  4EYW A;  3U9B A;  2II5 A;  2RCU A;  3FP0 A;  1NDB A;  1NM8 A;  1DPD A;  2E1U A;  2FY4 A;  5FAL A;  2II4 A;  2II3 A;  1NDI A;  2FW3 A;  2E1T A;  1Q9J A;  5KJW A;  1CIA A;  1T7O A;  1Q6X A;  2FY2 A;  2IHW A;  2XR7 A;  4KE4 A;  5DU9 A;  3U9F A; 
#chains in the Genus database with same CATH homology
 1QCA A;  4KEC A;  2RKV A;  1EAE A;  1C4T A;  1XL7 A;  2II5 A;  3U9B A;  1Q23 A;  1CLA A;  3FP0 A;  4G0B A;  1DPD A;  1SCZ A;  2RKT A;  1EAF A;  2E1U A;  2ZBA A;  4G22 A;  5DU9 A;  1EAD A;  5FAL A;  2II4 A;  5FAN A;  3U9F A;  2XHG A;  1EAB A;  1EAA A;  1E2O A;  2BGH A;  2II3 A;  3CLA A;  5KJT A;  4JN3 A;  4CLA A;  4G2M A;  2VSQ A;  4HVM A;  3L60 A;  3B2S A;  1DPC A;  1XL8 A;  2I9D A;  5T3E A;  1XMD A;  1XMC A;  5KJS A;  5DUA A;  2CLA A;  1L5A A;  1NOC B;  2E1T A;  4JN5 A;  5KJU A;  1Q9J A;  3B30 A;  1CIA A;  5KJW A;  3FOT A;  2IHW A;  5KJV A;  2XR7 A;  4KE4 A;  1EAC A;  3MAE A;  2JGP A;  4N72 A;  1DPB A;  2E1V A;  1PD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...