5FALA

Crystal structure of pvhct in complex with coa and p-coumaroyl-shikimate
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
447
structure length
435
Chain Sequence
HMKITVRGSEMVYPAAETPRRRLWNSGPDLVVPRFHTPSVYFFRRRDGEGNDLAAADGSFFDGARMRRALAEALVPFYPMAGRLARDEDGRVEIDCNAGGVLFQEADAPDATVDDFGDFAPTMELKRLIPTVEYTDDISAFPLLVVQVTHFKCGGVAIGVGMQHHVADGFSGLHFINSWADLCRGVPFAVMPYIDRSLLRARDPPTPVYPHVEYQPAPAMLSTPPAAVAIFRLSRADLGRLRSQIPAREGVPRLSTYAVLAAHVWRCASLARGLPADQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLADAGTVTAGVAEGAAVIQAALDRMDEGYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANRDGSLSVAISLQAEHMEKFRKFIYDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltrans
publication title Exploiting the Substrate Promiscuity of Hydroxycinnamoyl-CoA:Shikimate Hydroxycinnamoyl Transferase to Reduce Lignin.
pubmed doi rcsb
source organism Panicum virgatum
molecule tags Transferase
total genus 124
structure length 435
sequence length 447
ec nomenclature
pdb deposition date 2015-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5falA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5falA01
4KECA 1CLAA 2XHGA 3CLAA 1C4TA 1QCAA 2RKTA 2ZBAA 3L60A 4JN3A 4KE4A 2JGPA 2BGHA 2XR7A 1E2OA 4N72A 3FP0A 5FANA 4G22A 5DUAA 5KJWA 2E1TA 3MAEA 1PD5A 5T3EA 1XL8A 1XMCA 4CLAA 1Q9JA 1L5AA 1EACA 4JN5A 1SCZA 2II3A 2CLAA 3FOTA 2RKVA 5KJVA 5KJUA 5DU9A 1DPDA 3B30A 1EAFA 4G2MA 2VSQA 1DPBA 1EABA 1Q23A 2IHWA 3B2SA 2E1VA 1CIAA 2II4A 2E1UA 2II5A 1EADA 4G0BA 5KJSA 3U9BA 3U9FA 1NOCB 2I9DA 4HVMA 5FALA 5KJTA 1XMDA 1EAEA 1DPCA 1XL7A 1EAAA
chains in the Genus database with same CATH superfamily
4EYWA 2FY2A 2XHGA 3FP0A 5FANA 1T7NA 4CLAA 1NDIA 1Q9JA 2FY3A 1EACA 4JN5A 1Q6XA 1Q23A 2FY5A 2E1VA 3U9BA 1NOCB 1EAEA 2H3UA 4JN3A 1QCAA 2ZBAA 1E2OA 4N72A 4G22A 5DUAA 2RCUA 1NDFA 3MAEA 3FOTA 2FW3A 5DU9A 3B30A 3B2SA 2FYOA 1CIAA 2II5A 1T7OA 1XMDA 1DPCA 1EAAA 1CLAA 1S5OA 3CLAA 4KE4A 2RKTA 3L60A 1T7QA 4EPHA 2FY4A 1PD5A 1XL8A 2H3WA 1T1UA 1SCZA 2II3A 2CLAA 5KJVA 1DPDA 4G2MA 1DPBA 2II4A 5KJSA 4G0BA 3U9FA 2I9DA 5FALA 2XR7A 4KECA 1C4TA 2H3PA 2JGPA 2BGHA 4EP9A 5KJWA 5T3EA 1XMCA 2H4TA 1L5AA 5KJUA 1XL7A 2RKVA 2DEBA 1EAFA 2VSQA 1EABA 2IHWA 1NDBA 1NM8A 2E1UA 1EADA 4HVMA 5KJTA 2E1TA
chains in the Genus database with same CATH topology
4KECA 1CLAA 2XHGA 3CLAA 1C4TA 1QCAA 2RKTA 2ZBAA 3L60A 4JN3A 4KE4A 2JGPA 2BGHA 2XR7A 1E2OA 4N72A 3FP0A 5FANA 4G22A 5DUAA 5KJWA 2E1TA 3MAEA 1PD5A 5T3EA 1XL8A 1XMCA 4CLAA 1Q9JA 1L5AA 1EACA 4JN5A 1SCZA 2II3A 2CLAA 3FOTA 2RKVA 5KJVA 5KJUA 5DU9A 1DPDA 3B30A 1EAFA 4G2MA 2VSQA 1DPBA 1EABA 1Q23A 2IHWA 3B2SA 2E1VA 1CIAA 2II4A 2E1UA 2II5A 1EADA 4G0BA 5KJSA 3U9BA 3U9FA 1NOCB 2I9DA 4HVMA 5FALA 5KJTA 1XMDA 1EAEA 1DPCA 1XL7A 1EAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEC A;  1CLA A;  2XHG A;  3CLA A;  1C4T A;  1QCA A;  2RKT A;  2ZBA A;  3L60 A;  4JN3 A;  4KE4 A;  2JGP A;  2BGH A;  2XR7 A;  1E2O A;  4N72 A;  3FP0 A;  5FAN A;  4G22 A;  5DUA A;  5KJW A;  2E1T A;  3MAE A;  1PD5 A;  5T3E A;  1XL8 A;  1XMC A;  4CLA A;  1Q9J A;  1L5A A;  1EAC A;  4JN5 A;  1SCZ A;  2II3 A;  2CLA A;  3FOT A;  2RKV A;  5KJV A;  5KJU A;  5DU9 A;  1DPD A;  3B30 A;  1EAF A;  4G2M A;  2VSQ A;  1DPB A;  1EAB A;  1Q23 A;  2IHW A;  3B2S A;  2E1V A;  1CIA A;  2II4 A;  2E1U A;  2II5 A;  1EAD A;  4G0B A;  5KJS A;  3U9B A;  3U9F A;  1NOC B;  2I9D A;  4HVM A;  5FAL A;  5KJT A;  1XMD A;  1EAE A;  1DPC A;  1XL7 A;  1EAA A; 
#chains in the Genus database with same CATH topology
 4EYW A;  2FY2 A;  2XHG A;  3FP0 A;  5FAN A;  1T7N A;  4CLA A;  1NDI A;  1Q9J A;  2FY3 A;  1EAC A;  4JN5 A;  1Q6X A;  1Q23 A;  2FY5 A;  2E1V A;  3U9B A;  1NOC B;  1EAE A;  2H3U A;  4JN3 A;  1QCA A;  2ZBA A;  1E2O A;  4N72 A;  4G22 A;  5DUA A;  2RCU A;  1NDF A;  3MAE A;  3FOT A;  2FW3 A;  5DU9 A;  3B30 A;  3B2S A;  2FYO A;  1CIA A;  2II5 A;  1T7O A;  1XMD A;  1DPC A;  1EAA A;  1CLA A;  1S5O A;  3CLA A;  4KE4 A;  2RKT A;  3L60 A;  1T7Q A;  4EPH A;  2FY4 A;  1PD5 A;  1XL8 A;  2H3W A;  1T1U A;  1SCZ A;  2II3 A;  2CLA A;  5KJV A;  1DPD A;  4G2M A;  1DPB A;  2II4 A;  5KJS A;  4G0B A;  3U9F A;  2I9D A;  5FAL A;  2XR7 A;  4KEC A;  1C4T A;  2H3P A;  2JGP A;  2BGH A;  4EP9 A;  5KJW A;  5T3E A;  1XMC A;  2H4T A;  1L5A A;  5KJU A;  1XL7 A;  2RKV A;  2DEB A;  1EAF A;  2VSQ A;  1EAB A;  2IHW A;  1NDB A;  1NM8 A;  2E1U A;  1EAD A;  4HVM A;  5KJT A;  2E1T A; 
#chains in the Genus database with same CATH homology
 4KEC A;  1CLA A;  2XHG A;  3CLA A;  1C4T A;  1QCA A;  2RKT A;  2ZBA A;  3L60 A;  4JN3 A;  4KE4 A;  2JGP A;  2BGH A;  2XR7 A;  1E2O A;  4N72 A;  3FP0 A;  5FAN A;  4G22 A;  5DUA A;  5KJW A;  2E1T A;  3MAE A;  1PD5 A;  5T3E A;  1XL8 A;  1XMC A;  4CLA A;  1Q9J A;  1L5A A;  1EAC A;  4JN5 A;  1SCZ A;  2II3 A;  2CLA A;  3FOT A;  2RKV A;  5KJV A;  5KJU A;  5DU9 A;  1DPD A;  3B30 A;  1EAF A;  4G2M A;  2VSQ A;  1DPB A;  1EAB A;  1Q23 A;  2IHW A;  3B2S A;  2E1V A;  1CIA A;  2II4 A;  2E1U A;  2II5 A;  1EAD A;  4G0B A;  5KJS A;  3U9B A;  3U9F A;  1NOC B;  2I9D A;  4HVM A;  5FAL A;  5KJT A;  1XMD A;  1EAE A;  1DPC A;  1XL7 A;  1EAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...