1QCAA

Quadruple mutant q92c, n146f, y168f, i172v type iii cat complexed with fusidic acid. crystals grown at ph 6.3. x-ray data collected at room temperature
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
211
Chain Sequence
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPCFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGPENHLFISALPWVNFDSFNLNVANFTDFFAPVITMAKYQQEGDRLLLPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase (acyltransferase)
molecule keywords TYPE III CHLORAMPHENICOL ACETYLTRANSFERASE
publication title Steroid recognition by chloramphenicol acetyltransferase: engineering and structural analysis of a high affinity fusidic acid binding site.
pubmed doi rcsb
source organism Shigella flexneri
total genus 55
structure length 211
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1995-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1qcaA00
2RKTA 3FP0A 4JN3A 2I9DA 5KJVA 5KJWA 1EACA 4CLAA 3MAEA 3B2SA 1XL8A 3B30A 1SCZA 1Q9JA 2IHWA 2II3A 2RKVA 5T3EA 5KJTA 1CIAA 1E2OA 1EAEA 1L5AA 1XMCA 5DUAA 2E1TA 2BGHA 1C4TA 2E1UA 2JGPA 1PD5A 3FOTA 4G2MA 1EAAA 5KJUA 1DPBA 1DPCA 2E1VA 3L60A 4G0BA 4G22A 4N72A 5FANA 2XR7A 4HVMA 1DPDA 1CLAA 2XHGA 2CLAA 4KECA 2II4A 1EAFA 2II5A 5FALA 1XL7A 3CLAA 5DU9A 2ZBAA 1XMDA 1EADA 3U9FA 2VSQA 4KE4A 1NOCB 3U9BA 4JN5A 5KJSA 1QCAA 1EABA 1Q23A
chains in the Genus database with same CATH superfamily
1EACA 4CLAA 1NDIA 1T7OA 1T7QA 1EAEA 1XMCA 2H3PA 5DUAA 2BGHA 2JGPA 1PD5A 1EAAA 2FYOA 1DPBA 1DPCA 3L60A 4G0BA 4N72A 1DPDA 4KECA 2II4A 3CLAA 2FW3A 3U9BA 1T1UA 2H4TA 3FP0A 2FY2A 2I9DA 5KJWA 1T7NA 3B30A 5T3EA 1E2OA 5KJUA 2FY3A 2FY4A 4G22A 2CLAA 2H3UA 1EAFA 1XL7A 5DU9A 1Q6XA 2VSQA 1QCAA 4KE4A 3FOTA 1EABA 2RKTA 1Q23A 4JN3A 1XL8A 4EYWA 1Q9JA 1SCZA 2IHWA 2II3A 2E1TA 2XR7A 1NDBA 4HVMA 1CLAA 2XHGA 5FALA 1NM8A 2ZBAA 1XMDA 3U9FA 1NOCB 4JN5A 5KJSA 1NDFA 2RCUA 5KJVA 2FY5A 4EP9A 3MAEA 3B2SA 5KJTA 2RKVA 1S5OA 1CIAA 1L5AA 2E1UA 1C4TA 4G2MA 2E1VA 5FANA 2H3WA 4EPHA 2DEBA 2II5A 1EADA
chains in the Genus database with same CATH topology
2RKTA 3FP0A 4JN3A 2I9DA 5KJVA 5KJWA 1EACA 4CLAA 3MAEA 3B2SA 1XL8A 3B30A 1SCZA 1Q9JA 2IHWA 2II3A 2RKVA 5T3EA 5KJTA 1CIAA 1E2OA 1EAEA 1L5AA 1XMCA 5DUAA 2E1TA 2BGHA 1C4TA 2E1UA 2JGPA 1PD5A 3FOTA 4G2MA 1EAAA 5KJUA 1DPBA 1DPCA 2E1VA 3L60A 4G0BA 4G22A 4N72A 5FANA 2XR7A 4HVMA 1DPDA 1CLAA 2XHGA 2CLAA 4KECA 2II4A 1EAFA 2II5A 5FALA 1XL7A 3CLAA 5DU9A 2ZBAA 1XMDA 1EADA 3U9FA 2VSQA 4KE4A 1NOCB 3U9BA 4JN5A 5KJSA 1QCAA 1EABA 1Q23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKT A;  3FP0 A;  4JN3 A;  2I9D A;  5KJV A;  5KJW A;  1EAC A;  4CLA A;  3MAE A;  3B2S A;  1XL8 A;  3B30 A;  1SCZ A;  1Q9J A;  2IHW A;  2II3 A;  2RKV A;  5T3E A;  5KJT A;  1CIA A;  1E2O A;  1EAE A;  1L5A A;  1XMC A;  5DUA A;  2E1T A;  2BGH A;  1C4T A;  2E1U A;  2JGP A;  1PD5 A;  3FOT A;  4G2M A;  1EAA A;  5KJU A;  1DPB A;  1DPC A;  2E1V A;  3L60 A;  4G0B A;  4G22 A;  4N72 A;  5FAN A;  2XR7 A;  4HVM A;  1DPD A;  1CLA A;  2XHG A;  2CLA A;  4KEC A;  2II4 A;  1EAF A;  2II5 A;  5FAL A;  1XL7 A;  3CLA A;  5DU9 A;  2ZBA A;  1XMD A;  1EAD A;  3U9F A;  2VSQ A;  4KE4 A;  1NOC B;  3U9B A;  4JN5 A;  5KJS A;  1QCA A;  1EAB A;  1Q23 A; 
#chains in the Genus database with same CATH topology
 1EAC A;  4CLA A;  1NDI A;  1T7O A;  1T7Q A;  1EAE A;  1XMC A;  2H3P A;  5DUA A;  2BGH A;  2JGP A;  1PD5 A;  1EAA A;  2FYO A;  1DPB A;  1DPC A;  3L60 A;  4G0B A;  4N72 A;  1DPD A;  4KEC A;  2II4 A;  3CLA A;  2FW3 A;  3U9B A;  1T1U A;  2H4T A;  3FP0 A;  2FY2 A;  2I9D A;  5KJW A;  1T7N A;  3B30 A;  5T3E A;  1E2O A;  5KJU A;  2FY3 A;  2FY4 A;  4G22 A;  2CLA A;  2H3U A;  1EAF A;  1XL7 A;  5DU9 A;  1Q6X A;  2VSQ A;  1QCA A;  4KE4 A;  3FOT A;  1EAB A;  2RKT A;  1Q23 A;  4JN3 A;  1XL8 A;  4EYW A;  1Q9J A;  1SCZ A;  2IHW A;  2II3 A;  2E1T A;  2XR7 A;  1NDB A;  4HVM A;  1CLA A;  2XHG A;  5FAL A;  1NM8 A;  2ZBA A;  1XMD A;  3U9F A;  1NOC B;  4JN5 A;  5KJS A;  1NDF A;  2RCU A;  5KJV A;  2FY5 A;  4EP9 A;  3MAE A;  3B2S A;  5KJT A;  2RKV A;  1S5O A;  1CIA A;  1L5A A;  2E1U A;  1C4T A;  4G2M A;  2E1V A;  5FAN A;  2H3W A;  4EPH A;  2DEB A;  2II5 A;  1EAD A; 
#chains in the Genus database with same CATH homology
 2RKT A;  3FP0 A;  4JN3 A;  2I9D A;  5KJV A;  5KJW A;  1EAC A;  4CLA A;  3MAE A;  3B2S A;  1XL8 A;  3B30 A;  1SCZ A;  1Q9J A;  2IHW A;  2II3 A;  2RKV A;  5T3E A;  5KJT A;  1CIA A;  1E2O A;  1EAE A;  1L5A A;  1XMC A;  5DUA A;  2E1T A;  2BGH A;  1C4T A;  2E1U A;  2JGP A;  1PD5 A;  3FOT A;  4G2M A;  1EAA A;  5KJU A;  1DPB A;  1DPC A;  2E1V A;  3L60 A;  4G0B A;  4G22 A;  4N72 A;  5FAN A;  2XR7 A;  4HVM A;  1DPD A;  1CLA A;  2XHG A;  2CLA A;  4KEC A;  2II4 A;  1EAF A;  2II5 A;  5FAL A;  1XL7 A;  3CLA A;  5DU9 A;  2ZBA A;  1XMD A;  1EAD A;  3U9F A;  2VSQ A;  4KE4 A;  1NOC B;  3U9B A;  4JN5 A;  5KJS A;  1QCA A;  1EAB A;  1Q23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...