1DPDA

Crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTIASLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic and enzymatic investigations on the role of Ser558, His610, and Asn614 in the catalytic mechanism of Azotobacter vinelandii dihydrolipoamide acetyltransferase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1995-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1dpdA00
1EAFA 5DUAA 1QCAA 4JN3A 2JGPA 1E2OA 5KJTA 2VSQA 1DPDA 4KECA 3CLAA 4G0BA 5FANA 1XMDA 1CIAA 1C4TA 2I9DA 2BGHA 1EADA 4N72A 5DU9A 2II3A 1Q23A 1Q9JA 1DPBA 2XHGA 1EABA 1XL7A 4KE4A 2II5A 1DPCA 1XL8A 3FP0A 5FALA 3B2SA 1NOCB 1XMCA 2E1VA 4CLAA 2E1TA 2IHWA 4G22A 1EAEA 5KJVA 5KJUA 3MAEA 5KJSA 5KJWA 2XR7A 2E1UA 2II4A 2RKVA 2ZBAA 3L60A 1PD5A 2RKTA 5T3EA 1EAAA 1EACA 3B30A 4G2MA 4JN5A 1L5AA 3U9BA 4HVMA 3U9FA 1CLAA 3FOTA 1SCZA 2CLAA
chains in the Genus database with same CATH superfamily
2FY5A 5DUAA 2JGPA 2FYOA 2VSQA 1XMDA 2XHGA 1DPBA 1DPCA 1XL8A 3B2SA 4CLAA 2DEBA 5KJWA 1NM8A 2E1UA 2H3WA 2RKVA 1PD5A 3U9BA 4G2MA 4JN5A 1T7QA 1SCZA 1Q6XA 2H3PA 1NDFA 1QCAA 4KECA 5FANA 1T7NA 4EP9A 1EADA 2RCUA 4N72A 1NDBA 1XL7A 2II5A 2FY3A 1XMCA 2E1VA 2IHWA 5KJSA 1EAEA 2RKTA 1L5AA 2H4TA 1CLAA 4JN3A 1E2OA 1DPDA 1NDIA 1T1UA 1T7OA 1CIAA 1C4TA 2I9DA 4EYWA 1Q23A 1Q9JA 1EABA 3FP0A 5FALA 2E1TA 4EPHA 3MAEA 2H3UA 2FY2A 2II4A 2ZBAA 1EACA 3B30A 3U9FA 2FW3A 5KJVA 1S5OA 1EAFA 3CLAA 4G0BA 2BGHA 5DU9A 2FY4A 2II3A 4KE4A 5KJTA 1NOCB 5KJUA 2XR7A 3L60A 5T3EA 1EAAA 4G22A 3FOTA 4HVMA 2CLAA
chains in the Genus database with same CATH topology
1EAFA 5DUAA 1QCAA 4JN3A 2JGPA 1E2OA 5KJTA 2VSQA 1DPDA 4KECA 3CLAA 4G0BA 5FANA 1XMDA 1CIAA 1C4TA 2I9DA 2BGHA 1EADA 4N72A 5DU9A 2II3A 1Q23A 1Q9JA 1DPBA 2XHGA 1EABA 1XL7A 4KE4A 2II5A 1DPCA 1XL8A 3FP0A 5FALA 3B2SA 1NOCB 1XMCA 2E1VA 4CLAA 2E1TA 2IHWA 4G22A 1EAEA 5KJVA 5KJUA 3MAEA 5KJSA 5KJWA 2XR7A 2E1UA 2II4A 2RKVA 2ZBAA 3L60A 1PD5A 2RKTA 5T3EA 1EAAA 1EACA 3B30A 4G2MA 4JN5A 1L5AA 3U9BA 4HVMA 3U9FA 1CLAA 3FOTA 1SCZA 2CLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAF A;  5DUA A;  1QCA A;  4JN3 A;  2JGP A;  1E2O A;  5KJT A;  2VSQ A;  1DPD A;  4KEC A;  3CLA A;  4G0B A;  5FAN A;  1XMD A;  1CIA A;  1C4T A;  2I9D A;  2BGH A;  1EAD A;  4N72 A;  5DU9 A;  2II3 A;  1Q23 A;  1Q9J A;  1DPB A;  2XHG A;  1EAB A;  1XL7 A;  4KE4 A;  2II5 A;  1DPC A;  1XL8 A;  3FP0 A;  5FAL A;  3B2S A;  1NOC B;  1XMC A;  2E1V A;  4CLA A;  2E1T A;  2IHW A;  4G22 A;  1EAE A;  5KJV A;  5KJU A;  3MAE A;  5KJS A;  5KJW A;  2XR7 A;  2E1U A;  2II4 A;  2RKV A;  2ZBA A;  3L60 A;  1PD5 A;  2RKT A;  5T3E A;  1EAA A;  1EAC A;  3B30 A;  4G2M A;  4JN5 A;  1L5A A;  3U9B A;  4HVM A;  3U9F A;  1CLA A;  3FOT A;  1SCZ A;  2CLA A; 
#chains in the Genus database with same CATH topology
 2FY5 A;  5DUA A;  2JGP A;  2FYO A;  2VSQ A;  1XMD A;  2XHG A;  1DPB A;  1DPC A;  1XL8 A;  3B2S A;  4CLA A;  2DEB A;  5KJW A;  1NM8 A;  2E1U A;  2H3W A;  2RKV A;  1PD5 A;  3U9B A;  4G2M A;  4JN5 A;  1T7Q A;  1SCZ A;  1Q6X A;  2H3P A;  1NDF A;  1QCA A;  4KEC A;  5FAN A;  1T7N A;  4EP9 A;  1EAD A;  2RCU A;  4N72 A;  1NDB A;  1XL7 A;  2II5 A;  2FY3 A;  1XMC A;  2E1V A;  2IHW A;  5KJS A;  1EAE A;  2RKT A;  1L5A A;  2H4T A;  1CLA A;  4JN3 A;  1E2O A;  1DPD A;  1NDI A;  1T1U A;  1T7O A;  1CIA A;  1C4T A;  2I9D A;  4EYW A;  1Q23 A;  1Q9J A;  1EAB A;  3FP0 A;  5FAL A;  2E1T A;  4EPH A;  3MAE A;  2H3U A;  2FY2 A;  2II4 A;  2ZBA A;  1EAC A;  3B30 A;  3U9F A;  2FW3 A;  5KJV A;  1S5O A;  1EAF A;  3CLA A;  4G0B A;  2BGH A;  5DU9 A;  2FY4 A;  2II3 A;  4KE4 A;  5KJT A;  1NOC B;  5KJU A;  2XR7 A;  3L60 A;  5T3E A;  1EAA A;  4G22 A;  3FOT A;  4HVM A;  2CLA A; 
#chains in the Genus database with same CATH homology
 1EAF A;  5DUA A;  1QCA A;  4JN3 A;  2JGP A;  1E2O A;  5KJT A;  2VSQ A;  1DPD A;  4KEC A;  3CLA A;  4G0B A;  5FAN A;  1XMD A;  1CIA A;  1C4T A;  2I9D A;  2BGH A;  1EAD A;  4N72 A;  5DU9 A;  2II3 A;  1Q23 A;  1Q9J A;  1DPB A;  2XHG A;  1EAB A;  1XL7 A;  4KE4 A;  2II5 A;  1DPC A;  1XL8 A;  3FP0 A;  5FAL A;  3B2S A;  1NOC B;  1XMC A;  2E1V A;  4CLA A;  2E1T A;  2IHW A;  4G22 A;  1EAE A;  5KJV A;  5KJU A;  3MAE A;  5KJS A;  5KJW A;  2XR7 A;  2E1U A;  2II4 A;  2RKV A;  2ZBA A;  3L60 A;  1PD5 A;  2RKT A;  5T3E A;  1EAA A;  1EAC A;  3B30 A;  4G2M A;  4JN5 A;  1L5A A;  3U9B A;  4HVM A;  3U9F A;  1CLA A;  3FOT A;  1SCZ A;  2CLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...