1DPDA

Crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
b'IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTIASLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic and enzymatic investigations on the role of Ser558, His610, and Asn614 in the catalytic mechanism of Azotobacter vinelandii dihydrolipoamide acetyltransferase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Dihydrolipoamide acetyltransferase
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1995-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1dpdA00
3FP0A 2E1TA 4HVMA 5FANA 2II5A 2BGHA 1Q9JA 2XHGA 2IHWA 4G0BA 5DUAA 3U9BA 4JN5A 5T3EA 3L60A 2E1VA 1XL8A 5KJWA 4KECA 4JN3A 1CIAA 5KJSA 1NOCB 4G22A 5KJUA 2RKVA 3B2SA 1XMCA 2ZBAA 2CLAA 1DPCA 4KE4A 1L5AA 5DU9A 1PD5A 1EACA 3U9FA 4CLAA 1XMDA 5FALA 1CLAA 5KJTA 5KJVA 1Q23A 1EAEA 2JGPA 2RKTA 1QCAA 3FOTA 1C4TA 1XL7A 3B30A 2E1UA 1E2OA 3CLAA 1EAAA 2VSQA 1DPBA 1EAFA 4N72A 1EABA 1SCZA 1EADA 2II4A 4G2MA 2II3A 2I9DA 1DPDA 3MAEA 2XR7A
chains in the Genus database with same CATH superfamily
3FP0A 4HVMA 2XHGA 2FW3A 2IHWA 1XL8A 5KJWA 4JN3A 2RKVA 2CLAA 1DPCA 2FY4A 1Q23A 1QCAA 1C4TA 2DEBA 1EAAA 1EABA 2II3A 2FY5A 1T7OA 3MAEA 2XR7A 2E1TA 5FANA 1Q9JA 2E1VA 4KECA 5KJUA 3B2SA 1NDIA 2H4TA 1T7NA 1EAEA 3FOTA 1XL7A 3CLAA 2VSQA 1DPBA 4N72A 1T1UA 1EADA 2II4A 5FALA 2II5A 2BGHA 4G0BA 3U9BA 4JN5A 5T3EA 5KJSA 1NOCB 2FYOA 4G22A 2ZBAA 1T7QA 4KE4A 2H3WA 2H3UA 5DU9A 1EACA 4CLAA 1XMDA 4EP9A 1Q6XA 5KJTA 3B30A 2E1UA 1S5OA 1EAFA 1SCZA 2FY3A 1DPDA 1NDFA 2RCUA 2H3PA 5DUAA 3L60A 4EYWA 1CIAA 1XMCA 1L5AA 1PD5A 3U9FA 2FY2A 1CLAA 1NM8A 5KJVA 2JGPA 2RKTA 1NDBA 1E2OA 4EPHA 4G2MA 2I9DA
chains in the Genus database with same CATH topology
3FP0A 2E1TA 4HVMA 5FANA 2II5A 2BGHA 1Q9JA 2XHGA 2IHWA 4G0BA 5DUAA 3U9BA 4JN5A 5T3EA 3L60A 2E1VA 1XL8A 5KJWA 4KECA 4JN3A 1CIAA 5KJSA 1NOCB 4G22A 5KJUA 2RKVA 3B2SA 1XMCA 2ZBAA 2CLAA 1DPCA 4KE4A 1L5AA 5DU9A 1PD5A 1EACA 3U9FA 4CLAA 1XMDA 5FALA 1CLAA 5KJTA 5KJVA 1Q23A 1EAEA 2JGPA 2RKTA 1QCAA 3FOTA 1C4TA 1XL7A 3B30A 2E1UA 1E2OA 3CLAA 1EAAA 2VSQA 1DPBA 1EAFA 4N72A 1EABA 1SCZA 1EADA 2II4A 4G2MA 2II3A 2I9DA 1DPDA 3MAEA 2XR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FP0 A;  2E1T A;  4HVM A;  5FAN A;  2II5 A;  2BGH A;  1Q9J A;  2XHG A;  2IHW A;  4G0B A;  5DUA A;  3U9B A;  4JN5 A;  5T3E A;  3L60 A;  2E1V A;  1XL8 A;  5KJW A;  4KEC A;  4JN3 A;  1CIA A;  5KJS A;  1NOC B;  4G22 A;  5KJU A;  2RKV A;  3B2S A;  1XMC A;  2ZBA A;  2CLA A;  1DPC A;  4KE4 A;  1L5A A;  5DU9 A;  1PD5 A;  1EAC A;  3U9F A;  4CLA A;  1XMD A;  5FAL A;  1CLA A;  5KJT A;  5KJV A;  1Q23 A;  1EAE A;  2JGP A;  2RKT A;  1QCA A;  3FOT A;  1C4T A;  1XL7 A;  3B30 A;  2E1U A;  1E2O A;  3CLA A;  1EAA A;  2VSQ A;  1DPB A;  1EAF A;  4N72 A;  1EAB A;  1SCZ A;  1EAD A;  2II4 A;  4G2M A;  2II3 A;  2I9D A;  1DPD A;  3MAE A;  2XR7 A; 
#chains in the Genus database with same CATH topology
 3FP0 A;  4HVM A;  2XHG A;  2FW3 A;  2IHW A;  1XL8 A;  5KJW A;  4JN3 A;  2RKV A;  2CLA A;  1DPC A;  2FY4 A;  1Q23 A;  1QCA A;  1C4T A;  2DEB A;  1EAA A;  1EAB A;  2II3 A;  2FY5 A;  1T7O A;  3MAE A;  2XR7 A;  2E1T A;  5FAN A;  1Q9J A;  2E1V A;  4KEC A;  5KJU A;  3B2S A;  1NDI A;  2H4T A;  1T7N A;  1EAE A;  3FOT A;  1XL7 A;  3CLA A;  2VSQ A;  1DPB A;  4N72 A;  1T1U A;  1EAD A;  2II4 A;  5FAL A;  2II5 A;  2BGH A;  4G0B A;  3U9B A;  4JN5 A;  5T3E A;  5KJS A;  1NOC B;  2FYO A;  4G22 A;  2ZBA A;  1T7Q A;  4KE4 A;  2H3W A;  2H3U A;  5DU9 A;  1EAC A;  4CLA A;  1XMD A;  4EP9 A;  1Q6X A;  5KJT A;  3B30 A;  2E1U A;  1S5O A;  1EAF A;  1SCZ A;  2FY3 A;  1DPD A;  1NDF A;  2RCU A;  2H3P A;  5DUA A;  3L60 A;  4EYW A;  1CIA A;  1XMC A;  1L5A A;  1PD5 A;  3U9F A;  2FY2 A;  1CLA A;  1NM8 A;  5KJV A;  2JGP A;  2RKT A;  1NDB A;  1E2O A;  4EPH A;  4G2M A;  2I9D A; 
#chains in the Genus database with same CATH homology
 3FP0 A;  2E1T A;  4HVM A;  5FAN A;  2II5 A;  2BGH A;  1Q9J A;  2XHG A;  2IHW A;  4G0B A;  5DUA A;  3U9B A;  4JN5 A;  5T3E A;  3L60 A;  2E1V A;  1XL8 A;  5KJW A;  4KEC A;  4JN3 A;  1CIA A;  5KJS A;  1NOC B;  4G22 A;  5KJU A;  2RKV A;  3B2S A;  1XMC A;  2ZBA A;  2CLA A;  1DPC A;  4KE4 A;  1L5A A;  5DU9 A;  1PD5 A;  1EAC A;  3U9F A;  4CLA A;  1XMD A;  5FAL A;  1CLA A;  5KJT A;  5KJV A;  1Q23 A;  1EAE A;  2JGP A;  2RKT A;  1QCA A;  3FOT A;  1C4T A;  1XL7 A;  3B30 A;  2E1U A;  1E2O A;  3CLA A;  1EAA A;  2VSQ A;  1DPB A;  1EAF A;  4N72 A;  1EAB A;  1SCZ A;  1EAD A;  2II4 A;  4G2M A;  2II3 A;  2I9D A;  1DPD A;  3MAE A;  2XR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...