1DPDA

Crystallographic and enzymatic investigations on the role of ser558, his610 and asn614 in the catalytic mechanism of azotobacter vinelandii dihydrolipoamide acetyltransferase (e2p)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
243
structure length
243
Chain Sequence
IPPIPPVDFAKYGEIEEVPMTRLMQIGATNLHRSWLNVPHVTQFESADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAYLLKELPDFNSSLAPSGQALIRKKYVHIGFAVDTPDGLLVPVIRNVDQKSLLQLAAEAAELAEKARSKKLGADAMQGACFTIASLGHIGGTAFTPIVNAPEVAILGVSKASMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGDLLADIRAILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dihydrolipoamide acetyltransferase
molecule keywords DIHYDROLIPOYL-TRANSACETYLASE
publication title Crystallographic and enzymatic investigations on the role of Ser558, His610, and Asn614 in the catalytic mechanism of Azotobacter vinelandii dihydrolipoamide acetyltransferase (E2p).
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 67
structure length 243
sequence length 243
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1995-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 1dpdA00
2BGHA 2XR7A 4G0BA 3MAEA 4G22A 1CIAA 3U9FA 5FALA 5DUAA 4JN5A 3B2SA 1EAAA 2I9DA 1Q23A 1L5AA 1Q9JA 2E1VA 2RKVA 2XHGA 1XL8A 4KE4A 1EACA 5KJVA 2IHWA 2II3A 1PD5A 2RKTA 5DU9A 1C4TA 1EADA 4N72A 3CLAA 2II5A 3B30A 4JN3A 5KJSA 5KJWA 2VSQA 1DPCA 1QCAA 1EABA 1SCZA 3U9BA 5KJUA 1DPDA 1E2OA 2CLAA 5FANA 4CLAA 1EAFA 3L60A 1XL7A 4HVMA 1EAEA 2E1UA 2E1TA 4KECA 2JGPA 4G2MA 3FOTA 5KJTA 2II4A 5T3EA 1XMCA 1CLAA 1NOCB 1XMDA 1DPBA 3FP0A 2ZBAA
chains in the Genus database with same CATH superfamily
4KE4A 1XL8A 5KJVA 5DU9A 3B30A 4EYWA 2FY2A 1SCZA 3U9BA 1DPDA 4EPHA 2CLAA 2DEBA 4HVMA 2E1TA 2E1UA 3FOTA 5KJTA 1XMCA 3FP0A 2BGHA 2XR7A 4G0BA 3MAEA 1CIAA 2FY4A 5FALA 1NDBA 2FYOA 3B2SA 1L5AA 1NDIA 2XHGA 2H4TA 1EACA 2II3A 2RKTA 1EADA 1NDFA 5KJSA 4EP9A 5KJWA 2VSQA 1DPCA 5FANA 1EAFA 2JGPA 4G2MA 5T3EA 2RCUA 1CLAA 1T7NA 1DPBA 4G22A 2H3PA 1EAAA 2H3UA 1Q23A 1Q9JA 2E1VA 2RKVA 1PD5A 1C4TA 1T1UA 1NM8A 1XL7A 4KECA 1NOCB 1S5OA 2FY3A 3U9FA 2H3WA 4JN5A 2I9DA 1Q6XA 2IHWA 4N72A 3CLAA 2II5A 4JN3A 1QCAA 1EABA 5KJUA 1E2OA 4CLAA 3L60A 1T7QA 1EAEA 2FY5A 2II4A 2FW3A 1XMDA 1T7OA 5DUAA 2ZBAA
chains in the Genus database with same CATH topology
2BGHA 2XR7A 4G0BA 3MAEA 4G22A 1CIAA 3U9FA 5FALA 5DUAA 4JN5A 3B2SA 1EAAA 2I9DA 1Q23A 1L5AA 1Q9JA 2E1VA 2RKVA 2XHGA 1XL8A 4KE4A 1EACA 5KJVA 2IHWA 2II3A 1PD5A 2RKTA 5DU9A 1C4TA 1EADA 4N72A 3CLAA 2II5A 3B30A 4JN3A 5KJSA 5KJWA 2VSQA 1DPCA 1QCAA 1EABA 1SCZA 3U9BA 5KJUA 1DPDA 1E2OA 2CLAA 5FANA 4CLAA 1EAFA 3L60A 1XL7A 4HVMA 1EAEA 2E1UA 2E1TA 4KECA 2JGPA 4G2MA 3FOTA 5KJTA 2II4A 5T3EA 1XMCA 1CLAA 1NOCB 1XMDA 1DPBA 3FP0A 2ZBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGH A;  2XR7 A;  4G0B A;  3MAE A;  4G22 A;  1CIA A;  3U9F A;  5FAL A;  5DUA A;  4JN5 A;  3B2S A;  1EAA A;  2I9D A;  1Q23 A;  1L5A A;  1Q9J A;  2E1V A;  2RKV A;  2XHG A;  1XL8 A;  4KE4 A;  1EAC A;  5KJV A;  2IHW A;  2II3 A;  1PD5 A;  2RKT A;  5DU9 A;  1C4T A;  1EAD A;  4N72 A;  3CLA A;  2II5 A;  3B30 A;  4JN3 A;  5KJS A;  5KJW A;  2VSQ A;  1DPC A;  1QCA A;  1EAB A;  1SCZ A;  3U9B A;  5KJU A;  1DPD A;  1E2O A;  2CLA A;  5FAN A;  4CLA A;  1EAF A;  3L60 A;  1XL7 A;  4HVM A;  1EAE A;  2E1U A;  2E1T A;  4KEC A;  2JGP A;  4G2M A;  3FOT A;  5KJT A;  2II4 A;  5T3E A;  1XMC A;  1CLA A;  1NOC B;  1XMD A;  1DPB A;  3FP0 A;  2ZBA A; 
#chains in the Genus database with same CATH topology
 4KE4 A;  1XL8 A;  5KJV A;  5DU9 A;  3B30 A;  4EYW A;  2FY2 A;  1SCZ A;  3U9B A;  1DPD A;  4EPH A;  2CLA A;  2DEB A;  4HVM A;  2E1T A;  2E1U A;  3FOT A;  5KJT A;  1XMC A;  3FP0 A;  2BGH A;  2XR7 A;  4G0B A;  3MAE A;  1CIA A;  2FY4 A;  5FAL A;  1NDB A;  2FYO A;  3B2S A;  1L5A A;  1NDI A;  2XHG A;  2H4T A;  1EAC A;  2II3 A;  2RKT A;  1EAD A;  1NDF A;  5KJS A;  4EP9 A;  5KJW A;  2VSQ A;  1DPC A;  5FAN A;  1EAF A;  2JGP A;  4G2M A;  5T3E A;  2RCU A;  1CLA A;  1T7N A;  1DPB A;  4G22 A;  2H3P A;  1EAA A;  2H3U A;  1Q23 A;  1Q9J A;  2E1V A;  2RKV A;  1PD5 A;  1C4T A;  1T1U A;  1NM8 A;  1XL7 A;  4KEC A;  1NOC B;  1S5O A;  2FY3 A;  3U9F A;  2H3W A;  4JN5 A;  2I9D A;  1Q6X A;  2IHW A;  4N72 A;  3CLA A;  2II5 A;  4JN3 A;  1QCA A;  1EAB A;  5KJU A;  1E2O A;  4CLA A;  3L60 A;  1T7Q A;  1EAE A;  2FY5 A;  2II4 A;  2FW3 A;  1XMD A;  1T7O A;  5DUA A;  2ZBA A; 
#chains in the Genus database with same CATH homology
 2BGH A;  2XR7 A;  4G0B A;  3MAE A;  4G22 A;  1CIA A;  3U9F A;  5FAL A;  5DUA A;  4JN5 A;  3B2S A;  1EAA A;  2I9D A;  1Q23 A;  1L5A A;  1Q9J A;  2E1V A;  2RKV A;  2XHG A;  1XL8 A;  4KE4 A;  1EAC A;  5KJV A;  2IHW A;  2II3 A;  1PD5 A;  2RKT A;  5DU9 A;  1C4T A;  1EAD A;  4N72 A;  3CLA A;  2II5 A;  3B30 A;  4JN3 A;  5KJS A;  5KJW A;  2VSQ A;  1DPC A;  1QCA A;  1EAB A;  1SCZ A;  3U9B A;  5KJU A;  1DPD A;  1E2O A;  2CLA A;  5FAN A;  4CLA A;  1EAF A;  3L60 A;  1XL7 A;  4HVM A;  1EAE A;  2E1U A;  2E1T A;  4KEC A;  2JGP A;  4G2M A;  3FOT A;  5KJT A;  2II4 A;  5T3E A;  1XMC A;  1CLA A;  1NOC B;  1XMD A;  1DPB A;  3FP0 A;  2ZBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...