3B2SA

Crystal structure of f. graminearum tri101 complexed with coenzyme a and deoxynivalenol
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
450
structure length
448
Chain Sequence
AFKIQLDTLGQLPGLLSIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGGDAVLTPVSASWAFFTFSPKAMSELKDAATKTLDASTKFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSELDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
molecule tags Transferase
total genus 161
structure length 448
sequence length 450
ec nomenclature
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b2sA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b2sA02
1NOCB 1XL8A 2CLAA 3MAEA 1EAEA 5KJUA 1L5AA 2XR7A 5KJTA 3FP0A 1CLAA 1DPCA 3CLAA 4G22A 4N72A 2ZBAA 2IHWA 5DU9A 2BGHA 4JN5A 1XL7A 1EACA 3B2SA 2RKTA 5T3EA 2RKVA 5KJSA 2II4A 3L60A 1EABA 5FANA 1DPBA 1E2OA 2II5A 5DUAA 4KECA 2E1TA 1Q9JA 1Q23A 2I9DA 3U9FA 4HVMA 4G2MA 4KE4A 1XMDA 1EAAA 1PD5A 2XHGA 5KJWA 1QCAA 4G0BA 1EADA 1CIAA 1SCZA 2VSQA 1EAFA 5FALA 1DPDA 4CLAA 2JGPA 1XMCA 5KJVA 3U9BA 2E1UA 4JN3A 3B30A 2E1VA 2II3A 3FOTA 1C4TA
chains in the Genus database with same CATH superfamily
1T7OA 1T7QA 4G22A 2IHWA 1EACA 2RKTA 2RKVA 1EABA 2DEBA 1E2OA 2E1TA 1NDIA 2FW3A 2I9DA 3U9FA 4EPHA 2H4TA 1NDFA 5KJWA 2FYOA 4G0BA 2VSQA 1CIAA 2H3WA 1XMCA 5DU9A 1C4TA 1NOCB 3MAEA 1EAEA 1L5AA 2FY3A 1NM8A 2ZBAA 2FY5A 5KJSA 2II4A 5FANA 1DPBA 4KECA 1Q9JA 1Q23A 4HVMA 4G2MA 1EAAA 2H3PA 2RCUA 1DPDA 2E1UA 4JN3A 3B30A 1Q6XA 1XL8A 2CLAA 2FY2A 1T7NA 4N72A 1T1UA 4EP9A 5T3EA 3B2SA 3L60A 2II5A 5DUAA 4EYWA 4KE4A 1PD5A 1QCAA 1S5OA 2II3A 5KJUA 2XR7A 5KJTA 3FP0A 1CLAA 1DPCA 3CLAA 2BGHA 4JN5A 1XL7A 1NDBA 1XMDA 2XHGA 1EADA 1SCZA 5FALA 1EAFA 2FY4A 4CLAA 2H3UA 2JGPA 5KJVA 3U9BA 2E1VA 3FOTA
chains in the Genus database with same CATH topology
1NOCB 1XL8A 2CLAA 3MAEA 1EAEA 5KJUA 1L5AA 2XR7A 5KJTA 3FP0A 1CLAA 1DPCA 3CLAA 4G22A 4N72A 2ZBAA 2IHWA 5DU9A 2BGHA 4JN5A 1XL7A 1EACA 3B2SA 2RKTA 5T3EA 2RKVA 5KJSA 2II4A 3L60A 1EABA 5FANA 1DPBA 1E2OA 2II5A 5DUAA 4KECA 2E1TA 1Q9JA 1Q23A 2I9DA 3U9FA 4HVMA 4G2MA 4KE4A 1XMDA 1EAAA 1PD5A 2XHGA 5KJWA 1QCAA 4G0BA 1EADA 1CIAA 1SCZA 2VSQA 1EAFA 5FALA 1DPDA 4CLAA 2JGPA 1XMCA 5KJVA 3U9BA 2E1UA 4JN3A 3B30A 2E1VA 2II3A 3FOTA 1C4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NOC B;  1XL8 A;  2CLA A;  3MAE A;  1EAE A;  5KJU A;  1L5A A;  2XR7 A;  5KJT A;  3FP0 A;  1CLA A;  1DPC A;  3CLA A;  4G22 A;  4N72 A;  2ZBA A;  2IHW A;  5DU9 A;  2BGH A;  4JN5 A;  1XL7 A;  1EAC A;  3B2S A;  2RKT A;  5T3E A;  2RKV A;  5KJS A;  2II4 A;  3L60 A;  1EAB A;  5FAN A;  1DPB A;  1E2O A;  2II5 A;  5DUA A;  4KEC A;  2E1T A;  1Q9J A;  1Q23 A;  2I9D A;  3U9F A;  4HVM A;  4G2M A;  4KE4 A;  1XMD A;  1EAA A;  1PD5 A;  2XHG A;  5KJW A;  1QCA A;  4G0B A;  1EAD A;  1CIA A;  1SCZ A;  2VSQ A;  1EAF A;  5FAL A;  1DPD A;  4CLA A;  2JGP A;  1XMC A;  5KJV A;  3U9B A;  2E1U A;  4JN3 A;  3B30 A;  2E1V A;  2II3 A;  3FOT A;  1C4T A; 
#chains in the Genus database with same CATH topology
 1T7O A;  1T7Q A;  4G22 A;  2IHW A;  1EAC A;  2RKT A;  2RKV A;  1EAB A;  2DEB A;  1E2O A;  2E1T A;  1NDI A;  2FW3 A;  2I9D A;  3U9F A;  4EPH A;  2H4T A;  1NDF A;  5KJW A;  2FYO A;  4G0B A;  2VSQ A;  1CIA A;  2H3W A;  1XMC A;  5DU9 A;  1C4T A;  1NOC B;  3MAE A;  1EAE A;  1L5A A;  2FY3 A;  1NM8 A;  2ZBA A;  2FY5 A;  5KJS A;  2II4 A;  5FAN A;  1DPB A;  4KEC A;  1Q9J A;  1Q23 A;  4HVM A;  4G2M A;  1EAA A;  2H3P A;  2RCU A;  1DPD A;  2E1U A;  4JN3 A;  3B30 A;  1Q6X A;  1XL8 A;  2CLA A;  2FY2 A;  1T7N A;  4N72 A;  1T1U A;  4EP9 A;  5T3E A;  3B2S A;  3L60 A;  2II5 A;  5DUA A;  4EYW A;  4KE4 A;  1PD5 A;  1QCA A;  1S5O A;  2II3 A;  5KJU A;  2XR7 A;  5KJT A;  3FP0 A;  1CLA A;  1DPC A;  3CLA A;  2BGH A;  4JN5 A;  1XL7 A;  1NDB A;  1XMD A;  2XHG A;  1EAD A;  1SCZ A;  5FAL A;  1EAF A;  2FY4 A;  4CLA A;  2H3U A;  2JGP A;  5KJV A;  3U9B A;  2E1V A;  3FOT A; 
#chains in the Genus database with same CATH homology
 1NOC B;  1XL8 A;  2CLA A;  3MAE A;  1EAE A;  5KJU A;  1L5A A;  2XR7 A;  5KJT A;  3FP0 A;  1CLA A;  1DPC A;  3CLA A;  4G22 A;  4N72 A;  2ZBA A;  2IHW A;  5DU9 A;  2BGH A;  4JN5 A;  1XL7 A;  1EAC A;  3B2S A;  2RKT A;  5T3E A;  2RKV A;  5KJS A;  2II4 A;  3L60 A;  1EAB A;  5FAN A;  1DPB A;  1E2O A;  2II5 A;  5DUA A;  4KEC A;  2E1T A;  1Q9J A;  1Q23 A;  2I9D A;  3U9F A;  4HVM A;  4G2M A;  4KE4 A;  1XMD A;  1EAA A;  1PD5 A;  2XHG A;  5KJW A;  1QCA A;  4G0B A;  1EAD A;  1CIA A;  1SCZ A;  2VSQ A;  1EAF A;  5FAL A;  1DPD A;  4CLA A;  2JGP A;  1XMC A;  5KJV A;  3U9B A;  2E1U A;  4JN3 A;  3B30 A;  2E1V A;  2II3 A;  3FOT A;  1C4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...