3B2SA

Crystal structure of f. graminearum tri101 complexed with coenzyme a and deoxynivalenol
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
450
structure length
448
Chain Sequence
b'AFKIQLDTLGQLPGLLSIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGGDAVLTPVSASWAFFTFSPKAMSELKDAATKTLDASTKFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSELDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
molecule tags Transferase
total genus 161
structure length 448
sequence length 450
ec nomenclature
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b2sA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b2sA02
4G2MA 2VSQA 3FOTA 2E1VA 4G22A 5DU9A 4HVMA 2JGPA 1E2OA 2E1UA 1DPDA 1EAEA 2CLAA 4G0BA 1EAAA 2BGHA 2ZBAA 2RKTA 4CLAA 2II5A 1NOCB 4KE4A 3FP0A 1PD5A 1EABA 2E1TA 1QCAA 1L5AA 1C4TA 4KECA 4JN5A 1XMCA 4JN3A 4N72A 1EADA 3CLAA 5FANA 5KJSA 3MAEA 1DPBA 1CLAA 1XMDA 2RKVA 1Q23A 3U9FA 5KJVA 1Q9JA 1XL8A 3B2SA 1CIAA 2II4A 5DUAA 3U9BA 5FALA 2XR7A 5T3EA 2XHGA 5KJWA 1DPCA 1EAFA 3B30A 5KJTA 1SCZA 1XL7A 2II3A 3L60A 2I9DA 2IHWA 1EACA 5KJUA
chains in the Genus database with same CATH superfamily
4EPHA 3FOTA 1T7NA 1DPDA 2BGHA 1NOCB 4KE4A 3FP0A 1PD5A 2FW3A 5KJSA 1Q23A 3U9FA 1NDFA 1Q9JA 3U9BA 5FALA 1T7OA 5KJWA 1XL7A 2H4TA 1EACA 4G2MA 2E1VA 5DU9A 2E1UA 2II5A 1EABA 2E1TA 1L5AA 1C4TA 4KECA 4JN5A 1XMCA 4N72A 2FYOA 1DPBA 5KJVA 3B2SA 5T3EA 2XHGA 1NDBA 2FY3A 3B30A 1S5OA 2DEBA 2H3PA 4EYWA 4HVMA 1E2OA 4G0BA 2CLAA 1T7QA 2FY2A 2FY4A 1XL8A 5DUAA 1CIAA 2II4A 2XR7A 1DPCA 1EAFA 5KJTA 1SCZA 2II3A 2I9DA 2IHWA 5KJUA 1T1UA 2VSQA 4G22A 1NDIA 2JGPA 2RCUA 1EAEA 1EAAA 2ZBAA 2RKTA 4CLAA 1NM8A 1QCAA 4JN3A 2H3UA 1EADA 3CLAA 5FANA 1CLAA 1XMDA 2RKVA 2FY5A 1Q6XA 4EP9A 3L60A 2H3WA 3MAEA
chains in the Genus database with same CATH topology
4G2MA 2VSQA 3FOTA 2E1VA 4G22A 5DU9A 4HVMA 2JGPA 1E2OA 2E1UA 1DPDA 1EAEA 2CLAA 4G0BA 1EAAA 2BGHA 2ZBAA 2RKTA 4CLAA 2II5A 1NOCB 4KE4A 3FP0A 1PD5A 1EABA 2E1TA 1QCAA 1L5AA 1C4TA 4KECA 4JN5A 1XMCA 4JN3A 4N72A 1EADA 3CLAA 5FANA 5KJSA 3MAEA 1DPBA 1CLAA 1XMDA 2RKVA 1Q23A 3U9FA 5KJVA 1Q9JA 1XL8A 3B2SA 1CIAA 2II4A 5DUAA 3U9BA 5FALA 2XR7A 5T3EA 2XHGA 5KJWA 1DPCA 1EAFA 3B30A 5KJTA 1SCZA 1XL7A 2II3A 3L60A 2I9DA 2IHWA 1EACA 5KJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G2M A;  2VSQ A;  3FOT A;  2E1V A;  4G22 A;  5DU9 A;  4HVM A;  2JGP A;  1E2O A;  2E1U A;  1DPD A;  1EAE A;  2CLA A;  4G0B A;  1EAA A;  2BGH A;  2ZBA A;  2RKT A;  4CLA A;  2II5 A;  1NOC B;  4KE4 A;  3FP0 A;  1PD5 A;  1EAB A;  2E1T A;  1QCA A;  1L5A A;  1C4T A;  4KEC A;  4JN5 A;  1XMC A;  4JN3 A;  4N72 A;  1EAD A;  3CLA A;  5FAN A;  5KJS A;  3MAE A;  1DPB A;  1CLA A;  1XMD A;  2RKV A;  1Q23 A;  3U9F A;  5KJV A;  1Q9J A;  1XL8 A;  3B2S A;  1CIA A;  2II4 A;  5DUA A;  3U9B A;  5FAL A;  2XR7 A;  5T3E A;  2XHG A;  5KJW A;  1DPC A;  1EAF A;  3B30 A;  5KJT A;  1SCZ A;  1XL7 A;  2II3 A;  3L60 A;  2I9D A;  2IHW A;  1EAC A;  5KJU A; 
#chains in the Genus database with same CATH topology
 4EPH A;  3FOT A;  1T7N A;  1DPD A;  2BGH A;  1NOC B;  4KE4 A;  3FP0 A;  1PD5 A;  2FW3 A;  5KJS A;  1Q23 A;  3U9F A;  1NDF A;  1Q9J A;  3U9B A;  5FAL A;  1T7O A;  5KJW A;  1XL7 A;  2H4T A;  1EAC A;  4G2M A;  2E1V A;  5DU9 A;  2E1U A;  2II5 A;  1EAB A;  2E1T A;  1L5A A;  1C4T A;  4KEC A;  4JN5 A;  1XMC A;  4N72 A;  2FYO A;  1DPB A;  5KJV A;  3B2S A;  5T3E A;  2XHG A;  1NDB A;  2FY3 A;  3B30 A;  1S5O A;  2DEB A;  2H3P A;  4EYW A;  4HVM A;  1E2O A;  4G0B A;  2CLA A;  1T7Q A;  2FY2 A;  2FY4 A;  1XL8 A;  5DUA A;  1CIA A;  2II4 A;  2XR7 A;  1DPC A;  1EAF A;  5KJT A;  1SCZ A;  2II3 A;  2I9D A;  2IHW A;  5KJU A;  1T1U A;  2VSQ A;  4G22 A;  1NDI A;  2JGP A;  2RCU A;  1EAE A;  1EAA A;  2ZBA A;  2RKT A;  4CLA A;  1NM8 A;  1QCA A;  4JN3 A;  2H3U A;  1EAD A;  3CLA A;  5FAN A;  1CLA A;  1XMD A;  2RKV A;  2FY5 A;  1Q6X A;  4EP9 A;  3L60 A;  2H3W A;  3MAE A; 
#chains in the Genus database with same CATH homology
 4G2M A;  2VSQ A;  3FOT A;  2E1V A;  4G22 A;  5DU9 A;  4HVM A;  2JGP A;  1E2O A;  2E1U A;  1DPD A;  1EAE A;  2CLA A;  4G0B A;  1EAA A;  2BGH A;  2ZBA A;  2RKT A;  4CLA A;  2II5 A;  1NOC B;  4KE4 A;  3FP0 A;  1PD5 A;  1EAB A;  2E1T A;  1QCA A;  1L5A A;  1C4T A;  4KEC A;  4JN5 A;  1XMC A;  4JN3 A;  4N72 A;  1EAD A;  3CLA A;  5FAN A;  5KJS A;  3MAE A;  1DPB A;  1CLA A;  1XMD A;  2RKV A;  1Q23 A;  3U9F A;  5KJV A;  1Q9J A;  1XL8 A;  3B2S A;  1CIA A;  2II4 A;  5DUA A;  3U9B A;  5FAL A;  2XR7 A;  5T3E A;  2XHG A;  5KJW A;  1DPC A;  1EAF A;  3B30 A;  5KJT A;  1SCZ A;  1XL7 A;  2II3 A;  3L60 A;  2I9D A;  2IHW A;  1EAC A;  5KJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...