3B2SA

Crystal structure of f. graminearum tri101 complexed with coenzyme a and deoxynivalenol
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
450
structure length
448
Chain Sequence
AFKIQLDTLGQLPGLLSIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGGDAVLTPVSASWAFFTFSPKAMSELKDAATKTLDASTKFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSELDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
total genus 161
structure length 448
sequence length 450
ec nomenclature
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b2sA01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b2sA02
1EABA 5KJVA 5KJSA 2E1VA 1EAFA 2RKTA 3B2SA 3B30A 3L60A 3U9FA 4CLAA 1DPCA 2II5A 1E2OA 3MAEA 4JN5A 2XR7A 4JN3A 4KE4A 4KECA 4N72A 5DUAA 2VSQA 3FOTA 4G22A 1PD5A 2XHGA 2BGHA 3U9BA 1EAEA 1XL7A 2RKVA 1DPBA 1NOCB 2I9DA 3FP0A 1C4TA 2CLAA 5KJUA 1CLAA 2II4A 2ZBAA 1CIAA 1DPDA 1SCZA 1Q23A 2IHWA 5KJWA 5DU9A 5T3EA 1QCAA 1XMDA 2II3A 4G0BA 4G2MA 5FANA 1EADA 2E1TA 2JGPA 1L5AA 4HVMA 1XMCA 1EAAA 2E1UA 1EACA 5FALA 5KJTA 1XL8A 1Q9JA 3CLAA
chains in the Genus database with same CATH superfamily
2FW3A 2E1VA 3MAEA 4KE4A 4KECA 5DUAA 2FY4A 2H3PA 2BGHA 1XL7A 4EPHA 1NOCB 3FP0A 1C4TA 1NDFA 2ZBAA 1SCZA 5KJWA 5T3EA 1T1UA 1T7OA 4HVMA 1EAAA 1Q9JA 1NDBA 3B30A 1EAFA 3U9FA 1DPCA 4JN5A 4N72A 2XR7A 2VSQA 3FOTA 2H3UA 3U9BA 1EAEA 2H3WA 1DPBA 2II4A 1CIAA 1NM8A 1Q23A 5DU9A 1QCAA 2II3A 1T7NA 5FANA 1L5AA 2JGPA 2FY5A 2FY3A 2E1UA 5FALA 5KJTA 1E2OA 3CLAA 1EABA 4EYWA 5KJVA 5KJSA 2RKTA 3L60A 4CLAA 2FY2A 2II5A 4JN3A 2DEBA 1S5OA 2RKVA 4EP9A 2CLAA 1CLAA 1T7QA 1XMDA 4G0BA 2E1TA 1XMCA 1EACA 1XL8A 3B2SA 2FYOA 4G22A 1PD5A 2XHGA 1Q6XA 2I9DA 5KJUA 1DPDA 2H4TA 2RCUA 2IHWA 4G2MA 1EADA 1NDIA
chains in the Genus database with same CATH topology
1EABA 5KJVA 5KJSA 2E1VA 1EAFA 2RKTA 3B2SA 3B30A 3L60A 3U9FA 4CLAA 1DPCA 2II5A 1E2OA 3MAEA 4JN5A 2XR7A 4JN3A 4KE4A 4KECA 4N72A 5DUAA 2VSQA 3FOTA 4G22A 1PD5A 2XHGA 2BGHA 3U9BA 1EAEA 1XL7A 2RKVA 1DPBA 1NOCB 2I9DA 3FP0A 1C4TA 2CLAA 5KJUA 1CLAA 2II4A 2ZBAA 1CIAA 1DPDA 1SCZA 1Q23A 2IHWA 5KJWA 5DU9A 5T3EA 1QCAA 1XMDA 2II3A 4G0BA 4G2MA 5FANA 1EADA 2E1TA 2JGPA 1L5AA 4HVMA 1XMCA 1EAAA 2E1UA 1EACA 5FALA 5KJTA 1XL8A 1Q9JA 3CLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAB A;  5KJV A;  5KJS A;  2E1V A;  1EAF A;  2RKT A;  3B2S A;  3B30 A;  3L60 A;  3U9F A;  4CLA A;  1DPC A;  2II5 A;  1E2O A;  3MAE A;  4JN5 A;  2XR7 A;  4JN3 A;  4KE4 A;  4KEC A;  4N72 A;  5DUA A;  2VSQ A;  3FOT A;  4G22 A;  1PD5 A;  2XHG A;  2BGH A;  3U9B A;  1EAE A;  1XL7 A;  2RKV A;  1DPB A;  1NOC B;  2I9D A;  3FP0 A;  1C4T A;  2CLA A;  5KJU A;  1CLA A;  2II4 A;  2ZBA A;  1CIA A;  1DPD A;  1SCZ A;  1Q23 A;  2IHW A;  5KJW A;  5DU9 A;  5T3E A;  1QCA A;  1XMD A;  2II3 A;  4G0B A;  4G2M A;  5FAN A;  1EAD A;  2E1T A;  2JGP A;  1L5A A;  4HVM A;  1XMC A;  1EAA A;  2E1U A;  1EAC A;  5FAL A;  5KJT A;  1XL8 A;  1Q9J A;  3CLA A; 
#chains in the Genus database with same CATH topology
 2FW3 A;  2E1V A;  3MAE A;  4KE4 A;  4KEC A;  5DUA A;  2FY4 A;  2H3P A;  2BGH A;  1XL7 A;  4EPH A;  1NOC B;  3FP0 A;  1C4T A;  1NDF A;  2ZBA A;  1SCZ A;  5KJW A;  5T3E A;  1T1U A;  1T7O A;  4HVM A;  1EAA A;  1Q9J A;  1NDB A;  3B30 A;  1EAF A;  3U9F A;  1DPC A;  4JN5 A;  4N72 A;  2XR7 A;  2VSQ A;  3FOT A;  2H3U A;  3U9B A;  1EAE A;  2H3W A;  1DPB A;  2II4 A;  1CIA A;  1NM8 A;  1Q23 A;  5DU9 A;  1QCA A;  2II3 A;  1T7N A;  5FAN A;  1L5A A;  2JGP A;  2FY5 A;  2FY3 A;  2E1U A;  5FAL A;  5KJT A;  1E2O A;  3CLA A;  1EAB A;  4EYW A;  5KJV A;  5KJS A;  2RKT A;  3L60 A;  4CLA A;  2FY2 A;  2II5 A;  4JN3 A;  2DEB A;  1S5O A;  2RKV A;  4EP9 A;  2CLA A;  1CLA A;  1T7Q A;  1XMD A;  4G0B A;  2E1T A;  1XMC A;  1EAC A;  1XL8 A;  3B2S A;  2FYO A;  4G22 A;  1PD5 A;  2XHG A;  1Q6X A;  2I9D A;  5KJU A;  1DPD A;  2H4T A;  2RCU A;  2IHW A;  4G2M A;  1EAD A;  1NDI A; 
#chains in the Genus database with same CATH homology
 1EAB A;  5KJV A;  5KJS A;  2E1V A;  1EAF A;  2RKT A;  3B2S A;  3B30 A;  3L60 A;  3U9F A;  4CLA A;  1DPC A;  2II5 A;  1E2O A;  3MAE A;  4JN5 A;  2XR7 A;  4JN3 A;  4KE4 A;  4KEC A;  4N72 A;  5DUA A;  2VSQ A;  3FOT A;  4G22 A;  1PD5 A;  2XHG A;  2BGH A;  3U9B A;  1EAE A;  1XL7 A;  2RKV A;  1DPB A;  1NOC B;  2I9D A;  3FP0 A;  1C4T A;  2CLA A;  5KJU A;  1CLA A;  2II4 A;  2ZBA A;  1CIA A;  1DPD A;  1SCZ A;  1Q23 A;  2IHW A;  5KJW A;  5DU9 A;  5T3E A;  1QCA A;  1XMD A;  2II3 A;  4G0B A;  4G2M A;  5FAN A;  1EAD A;  2E1T A;  2JGP A;  1L5A A;  4HVM A;  1XMC A;  1EAA A;  2E1U A;  1EAC A;  5FAL A;  5KJT A;  1XL8 A;  1Q9J A;  3CLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...