2II4A

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), coenzyme a-bound form
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
234
structure length
234
Chain Sequence
b'GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 66
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ii4A01
2E1TA 5KJUA 1CLAA 1Q23A 2E1VA 3FP0A 1QCAA 3CLAA 2I9DA 1CIAA 4JN3A 5FANA 1EABA 1EADA 1XL7A 2E1UA 2XR7A 5KJVA 2IHWA 3B2SA 4G2MA 1DPBA 5DUAA 1PD5A 3U9FA 5DU9A 1C4TA 1DPCA 4N72A 1EAFA 2XHGA 3MAEA 4KE4A 4HVMA 1DPDA 1XMDA 1EACA 4JN5A 4KECA 1XMCA 1E2OA 3FOTA 2JGPA 2RKVA 4G22A 2VSQA 5T3EA 1EAEA 1L5AA 2RKTA 1SCZA 1XL8A 2CLAA 2II4A 3U9BA 5KJWA 5KJTA 5KJSA 1NOCB 3L60A 4CLAA 4G0BA 2BGHA 5FALA 2ZBAA 1EAAA 2II5A 2II3A 1Q9JA 3B30A
chains in the Genus database with same CATH superfamily
2E1TA 1XL7A 2E1UA 2DEBA 4G2MA 1PD5A 1NDIA 4N72A 4JN5A 1Q6XA 1E2OA 3FOTA 3U9BA 5FALA 2II5A 2II3A 1Q9JA 2RCUA 5KJUA 1CLAA 2E1VA 5FANA 2I9DA 5KJVA 2H4TA 1EAFA 3MAEA 1T7QA 1T7OA 2JGPA 2RKVA 2FW3A 2FY3A 2RKTA 1SCZA 2II4A 1NDFA 1NOCB 1NDBA 2FY4A 4CLAA 2FYOA 3B2SA 4EP9A 4EPHA 1Q23A 3FP0A 3CLAA 1CIAA 1EABA 1EADA 2XR7A 2IHWA 2FY2A 1NM8A 2H3WA 5DUAA 1C4TA 1DPCA 1DPDA 1XMDA 1EACA 1XMCA 1T7NA 1EAEA 1L5AA 5KJTA 3L60A 4G0BA 2BGHA 1EAAA 3B30A 1T1UA 2H3UA 1QCAA 4JN3A 4EYWA 1DPBA 3U9FA 5DU9A 2XHGA 4KE4A 4HVMA 2H3PA 4KECA 4G22A 2VSQA 5T3EA 1XL8A 2CLAA 5KJWA 5KJSA 2ZBAA 2FY5A 1S5OA
chains in the Genus database with same CATH topology
2E1TA 5KJUA 1CLAA 1Q23A 2E1VA 3FP0A 1QCAA 3CLAA 2I9DA 1CIAA 4JN3A 5FANA 1EABA 1EADA 1XL7A 2E1UA 2XR7A 5KJVA 2IHWA 3B2SA 4G2MA 1DPBA 5DUAA 1PD5A 3U9FA 5DU9A 1C4TA 1DPCA 4N72A 1EAFA 2XHGA 3MAEA 4KE4A 4HVMA 1DPDA 1XMDA 1EACA 4JN5A 4KECA 1XMCA 1E2OA 3FOTA 2JGPA 2RKVA 4G22A 2VSQA 5T3EA 1EAEA 1L5AA 2RKTA 1SCZA 1XL8A 2CLAA 2II4A 3U9BA 5KJWA 5KJTA 5KJSA 1NOCB 3L60A 4CLAA 4G0BA 2BGHA 5FALA 2ZBAA 1EAAA 2II5A 2II3A 1Q9JA 3B30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1T A;  5KJU A;  1CLA A;  1Q23 A;  2E1V A;  3FP0 A;  1QCA A;  3CLA A;  2I9D A;  1CIA A;  4JN3 A;  5FAN A;  1EAB A;  1EAD A;  1XL7 A;  2E1U A;  2XR7 A;  5KJV A;  2IHW A;  3B2S A;  4G2M A;  1DPB A;  5DUA A;  1PD5 A;  3U9F A;  5DU9 A;  1C4T A;  1DPC A;  4N72 A;  1EAF A;  2XHG A;  3MAE A;  4KE4 A;  4HVM A;  1DPD A;  1XMD A;  1EAC A;  4JN5 A;  4KEC A;  1XMC A;  1E2O A;  3FOT A;  2JGP A;  2RKV A;  4G22 A;  2VSQ A;  5T3E A;  1EAE A;  1L5A A;  2RKT A;  1SCZ A;  1XL8 A;  2CLA A;  2II4 A;  3U9B A;  5KJW A;  5KJT A;  5KJS A;  1NOC B;  3L60 A;  4CLA A;  4G0B A;  2BGH A;  5FAL A;  2ZBA A;  1EAA A;  2II5 A;  2II3 A;  1Q9J A;  3B30 A; 
#chains in the Genus database with same CATH topology
 2E1T A;  1XL7 A;  2E1U A;  2DEB A;  4G2M A;  1PD5 A;  1NDI A;  4N72 A;  4JN5 A;  1Q6X A;  1E2O A;  3FOT A;  3U9B A;  5FAL A;  2II5 A;  2II3 A;  1Q9J A;  2RCU A;  5KJU A;  1CLA A;  2E1V A;  5FAN A;  2I9D A;  5KJV A;  2H4T A;  1EAF A;  3MAE A;  1T7Q A;  1T7O A;  2JGP A;  2RKV A;  2FW3 A;  2FY3 A;  2RKT A;  1SCZ A;  2II4 A;  1NDF A;  1NOC B;  1NDB A;  2FY4 A;  4CLA A;  2FYO A;  3B2S A;  4EP9 A;  4EPH A;  1Q23 A;  3FP0 A;  3CLA A;  1CIA A;  1EAB A;  1EAD A;  2XR7 A;  2IHW A;  2FY2 A;  1NM8 A;  2H3W A;  5DUA A;  1C4T A;  1DPC A;  1DPD A;  1XMD A;  1EAC A;  1XMC A;  1T7N A;  1EAE A;  1L5A A;  5KJT A;  3L60 A;  4G0B A;  2BGH A;  1EAA A;  3B30 A;  1T1U A;  2H3U A;  1QCA A;  4JN3 A;  4EYW A;  1DPB A;  3U9F A;  5DU9 A;  2XHG A;  4KE4 A;  4HVM A;  2H3P A;  4KEC A;  4G22 A;  2VSQ A;  5T3E A;  1XL8 A;  2CLA A;  5KJW A;  5KJS A;  2ZBA A;  2FY5 A;  1S5O A; 
#chains in the Genus database with same CATH homology
 2E1T A;  5KJU A;  1CLA A;  1Q23 A;  2E1V A;  3FP0 A;  1QCA A;  3CLA A;  2I9D A;  1CIA A;  4JN3 A;  5FAN A;  1EAB A;  1EAD A;  1XL7 A;  2E1U A;  2XR7 A;  5KJV A;  2IHW A;  3B2S A;  4G2M A;  1DPB A;  5DUA A;  1PD5 A;  3U9F A;  5DU9 A;  1C4T A;  1DPC A;  4N72 A;  1EAF A;  2XHG A;  3MAE A;  4KE4 A;  4HVM A;  1DPD A;  1XMD A;  1EAC A;  4JN5 A;  4KEC A;  1XMC A;  1E2O A;  3FOT A;  2JGP A;  2RKV A;  4G22 A;  2VSQ A;  5T3E A;  1EAE A;  1L5A A;  2RKT A;  1SCZ A;  1XL8 A;  2CLA A;  2II4 A;  3U9B A;  5KJW A;  5KJT A;  5KJS A;  1NOC B;  3L60 A;  4CLA A;  4G0B A;  2BGH A;  5FAL A;  2ZBA A;  1EAA A;  2II5 A;  2II3 A;  1Q9J A;  3B30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...