2II4A

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), coenzyme a-bound form
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
234
structure length
234
Chain Sequence
GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 66
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ii4A01
5KJVA 1XMDA 4N72A 3U9FA 5FANA 1DPCA 1CLAA 2RKVA 4G0BA 1Q23A 2E1UA 2II3A 3B30A 5DUAA 1C4TA 1EABA 4JN3A 1L5AA 3L60A 2I9DA 5T3EA 1XL7A 5DU9A 5KJWA 3FOTA 2BGHA 2RKTA 3CLAA 3B2SA 2VSQA 4KE4A 1EAFA 1Q9JA 1EAAA 1CIAA 1XMCA 1PD5A 1EACA 2XHGA 1EADA 2XR7A 2E1VA 2E1TA 1DPDA 2IHWA 5FALA 2II4A 4CLAA 1QCAA 2II5A 1E2OA 1XL8A 4HVMA 5KJTA 5KJSA 2ZBAA 2JGPA 3FP0A 1SCZA 2CLAA 3MAEA 1NOCB 1DPBA 4G22A 5KJUA 1EAEA 3U9BA 4G2MA 4KECA 4JN5A
chains in the Genus database with same CATH superfamily
5KJVA 2FYOA 5DUAA 2II3A 1NDBA 1T7OA 3B30A 1T1UA 3L60A 2BGHA 2VSQA 2RCUA 1CIAA 4HVMA 2ZBAA 2JGPA 3FP0A 3MAEA 2FY2A 5KJUA 1EAEA 2H3PA 4JN5A 4N72A 1CLAA 1Q23A 1C4TA 1EABA 4JN3A 1L5AA 4EP9A 1XL7A 5DU9A 1T7NA 3FOTA 4KE4A 3CLAA 1Q9JA 1EADA 2XR7A 1E2OA 5KJSA 1S5OA 4EYWA 4G2MA 1XMDA 1DPCA 2RKVA 4G0BA 2E1UA 2I9DA 5T3EA 5KJWA 3B2SA 1EAFA 4EPHA 1EACA 5FALA 1DPDA 1NDFA 2II4A 1T7QA 4CLAA 1SCZA 2CLAA 1DPBA 2FW3A 2H3WA 2FY3A 3U9FA 5FANA 1Q6XA 2DEBA 2H4TA 2FY5A 1NM8A 2RKTA 2H3UA 1EAAA 1XMCA 1PD5A 2XHGA 2E1VA 2E1TA 2IHWA 2FY4A 1NDIA 1QCAA 2II5A 1XL8A 5KJTA 1NOCB 4G22A 3U9BA 4KECA
chains in the Genus database with same CATH topology
5KJVA 1XMDA 4N72A 3U9FA 5FANA 1DPCA 1CLAA 2RKVA 4G0BA 1Q23A 2E1UA 2II3A 3B30A 5DUAA 1C4TA 1EABA 4JN3A 1L5AA 3L60A 2I9DA 5T3EA 1XL7A 5DU9A 5KJWA 3FOTA 2BGHA 2RKTA 3CLAA 3B2SA 2VSQA 4KE4A 1EAFA 1Q9JA 1EAAA 1CIAA 1XMCA 1PD5A 1EACA 2XHGA 1EADA 2XR7A 2E1VA 2E1TA 1DPDA 2IHWA 5FALA 2II4A 4CLAA 1QCAA 2II5A 1E2OA 1XL8A 4HVMA 5KJTA 5KJSA 2ZBAA 2JGPA 3FP0A 1SCZA 2CLAA 3MAEA 1NOCB 1DPBA 4G22A 5KJUA 1EAEA 3U9BA 4G2MA 4KECA 4JN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJV A;  1XMD A;  4N72 A;  3U9F A;  5FAN A;  1DPC A;  1CLA A;  2RKV A;  4G0B A;  1Q23 A;  2E1U A;  2II3 A;  3B30 A;  5DUA A;  1C4T A;  1EAB A;  4JN3 A;  1L5A A;  3L60 A;  2I9D A;  5T3E A;  1XL7 A;  5DU9 A;  5KJW A;  3FOT A;  2BGH A;  2RKT A;  3CLA A;  3B2S A;  2VSQ A;  4KE4 A;  1EAF A;  1Q9J A;  1EAA A;  1CIA A;  1XMC A;  1PD5 A;  1EAC A;  2XHG A;  1EAD A;  2XR7 A;  2E1V A;  2E1T A;  1DPD A;  2IHW A;  5FAL A;  2II4 A;  4CLA A;  1QCA A;  2II5 A;  1E2O A;  1XL8 A;  4HVM A;  5KJT A;  5KJS A;  2ZBA A;  2JGP A;  3FP0 A;  1SCZ A;  2CLA A;  3MAE A;  1NOC B;  1DPB A;  4G22 A;  5KJU A;  1EAE A;  3U9B A;  4G2M A;  4KEC A;  4JN5 A; 
#chains in the Genus database with same CATH topology
 5KJV A;  2FYO A;  5DUA A;  2II3 A;  1NDB A;  1T7O A;  3B30 A;  1T1U A;  3L60 A;  2BGH A;  2VSQ A;  2RCU A;  1CIA A;  4HVM A;  2ZBA A;  2JGP A;  3FP0 A;  3MAE A;  2FY2 A;  5KJU A;  1EAE A;  2H3P A;  4JN5 A;  4N72 A;  1CLA A;  1Q23 A;  1C4T A;  1EAB A;  4JN3 A;  1L5A A;  4EP9 A;  1XL7 A;  5DU9 A;  1T7N A;  3FOT A;  4KE4 A;  3CLA A;  1Q9J A;  1EAD A;  2XR7 A;  1E2O A;  5KJS A;  1S5O A;  4EYW A;  4G2M A;  1XMD A;  1DPC A;  2RKV A;  4G0B A;  2E1U A;  2I9D A;  5T3E A;  5KJW A;  3B2S A;  1EAF A;  4EPH A;  1EAC A;  5FAL A;  1DPD A;  1NDF A;  2II4 A;  1T7Q A;  4CLA A;  1SCZ A;  2CLA A;  1DPB A;  2FW3 A;  2H3W A;  2FY3 A;  3U9F A;  5FAN A;  1Q6X A;  2DEB A;  2H4T A;  2FY5 A;  1NM8 A;  2RKT A;  2H3U A;  1EAA A;  1XMC A;  1PD5 A;  2XHG A;  2E1V A;  2E1T A;  2IHW A;  2FY4 A;  1NDI A;  1QCA A;  2II5 A;  1XL8 A;  5KJT A;  1NOC B;  4G22 A;  3U9B A;  4KEC A; 
#chains in the Genus database with same CATH homology
 5KJV A;  1XMD A;  4N72 A;  3U9F A;  5FAN A;  1DPC A;  1CLA A;  2RKV A;  4G0B A;  1Q23 A;  2E1U A;  2II3 A;  3B30 A;  5DUA A;  1C4T A;  1EAB A;  4JN3 A;  1L5A A;  3L60 A;  2I9D A;  5T3E A;  1XL7 A;  5DU9 A;  5KJW A;  3FOT A;  2BGH A;  2RKT A;  3CLA A;  3B2S A;  2VSQ A;  4KE4 A;  1EAF A;  1Q9J A;  1EAA A;  1CIA A;  1XMC A;  1PD5 A;  1EAC A;  2XHG A;  1EAD A;  2XR7 A;  2E1V A;  2E1T A;  1DPD A;  2IHW A;  5FAL A;  2II4 A;  4CLA A;  1QCA A;  2II5 A;  1E2O A;  1XL8 A;  4HVM A;  5KJT A;  5KJS A;  2ZBA A;  2JGP A;  3FP0 A;  1SCZ A;  2CLA A;  3MAE A;  1NOC B;  1DPB A;  4G22 A;  5KJU A;  1EAE A;  3U9B A;  4G2M A;  4KEC A;  4JN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...