2II4A

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), coenzyme a-bound form
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
234
structure length
234
Chain Sequence
GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
total genus 66
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ii4A01
5T3EA 4G2MA 1NOCB 3MAEA 1DPDA 3FP0A 5FANA 2XHGA 1EAFA 1QCAA 3B30A 2JGPA 4HVMA 1Q23A 3FOTA 1EAAA 2II5A 5KJTA 5KJWA 1CIAA 2VSQA 2E1VA 3B2SA 1XL7A 1EACA 4KECA 1PD5A 2I9DA 2XR7A 2ZBAA 1XMCA 2E1TA 1C4TA 1EABA 3U9BA 1DPBA 3CLAA 5DU9A 2II3A 2E1UA 1XMDA 2BGHA 2II4A 4CLAA 5KJSA 1EADA 2IHWA 1DPCA 2RKTA 1CLAA 4G22A 1Q9JA 4JN3A 5KJVA 1EAEA 4N72A 4G0BA 4JN5A 2CLAA 3U9FA 3L60A 4KE4A 5DUAA 1L5AA 1E2OA 1XL8A 5FALA 2RKVA 5KJUA 1SCZA
chains in the Genus database with same CATH superfamily
5T3EA 5FANA 3FP0A 1EAFA 3B30A 4HVMA 2E1VA 1EACA 2XR7A 1T7OA 1EABA 2FY3A 2E1UA 1XMDA 2BGHA 4CLAA 4EYWA 1DPCA 1T1UA 4JN5A 4EPHA 1E2OA 4G22A 2RKVA 4G2MA 1DPDA 2XHGA 1QCAA 2JGPA 2II5A 2VSQA 2FY4A 2FYOA 4KECA 1XMCA 1NDBA 1DPBA 3CLAA 2II3A 2H3WA 5KJVA 1EAEA 1T7NA 2CLAA 4KE4A 5DUAA 1L5AA 5FALA 2FW3A 5KJTA 1Q6XA 3B2SA 1XL7A 2H3UA 2FY2A 2E1TA 1NM8A 1C4TA 5DU9A 5KJSA 1EADA 2IHWA 2H4TA 2RKTA 2RCUA 2H3PA 1Q9JA 3U9FA 3L60A 1SCZA 4EP9A 1T7QA 1NOCB 2DEBA 3MAEA 1NDIA 1Q23A 3FOTA 1EAAA 2FY5A 5KJWA 1CIAA 1PD5A 2I9DA 2ZBAA 3U9BA 2II4A 1NDFA 4JN3A 4N72A 4G0BA 1S5OA 1XL8A 5KJUA 1CLAA
chains in the Genus database with same CATH topology
5T3EA 4G2MA 1NOCB 3MAEA 1DPDA 3FP0A 5FANA 2XHGA 1EAFA 1QCAA 3B30A 2JGPA 4HVMA 1Q23A 3FOTA 1EAAA 2II5A 5KJTA 5KJWA 1CIAA 2VSQA 2E1VA 3B2SA 1XL7A 1EACA 4KECA 1PD5A 2I9DA 2XR7A 2ZBAA 1XMCA 2E1TA 1C4TA 1EABA 3U9BA 1DPBA 3CLAA 5DU9A 2II3A 2E1UA 1XMDA 2BGHA 2II4A 4CLAA 5KJSA 1EADA 2IHWA 1DPCA 2RKTA 1CLAA 4G22A 1Q9JA 4JN3A 5KJVA 1EAEA 4N72A 4G0BA 4JN5A 2CLAA 3U9FA 3L60A 4KE4A 5DUAA 1L5AA 1E2OA 1XL8A 5FALA 2RKVA 5KJUA 1SCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T3E A;  4G2M A;  1NOC B;  3MAE A;  1DPD A;  3FP0 A;  5FAN A;  2XHG A;  1EAF A;  1QCA A;  3B30 A;  2JGP A;  4HVM A;  1Q23 A;  3FOT A;  1EAA A;  2II5 A;  5KJT A;  5KJW A;  1CIA A;  2VSQ A;  2E1V A;  3B2S A;  1XL7 A;  1EAC A;  4KEC A;  1PD5 A;  2I9D A;  2XR7 A;  2ZBA A;  1XMC A;  2E1T A;  1C4T A;  1EAB A;  3U9B A;  1DPB A;  3CLA A;  5DU9 A;  2II3 A;  2E1U A;  1XMD A;  2BGH A;  2II4 A;  4CLA A;  5KJS A;  1EAD A;  2IHW A;  1DPC A;  2RKT A;  1CLA A;  4G22 A;  1Q9J A;  4JN3 A;  5KJV A;  1EAE A;  4N72 A;  4G0B A;  4JN5 A;  2CLA A;  3U9F A;  3L60 A;  4KE4 A;  5DUA A;  1L5A A;  1E2O A;  1XL8 A;  5FAL A;  2RKV A;  5KJU A;  1SCZ A; 
#chains in the Genus database with same CATH topology
 5T3E A;  5FAN A;  3FP0 A;  1EAF A;  3B30 A;  4HVM A;  2E1V A;  1EAC A;  2XR7 A;  1T7O A;  1EAB A;  2FY3 A;  2E1U A;  1XMD A;  2BGH A;  4CLA A;  4EYW A;  1DPC A;  1T1U A;  4JN5 A;  4EPH A;  1E2O A;  4G22 A;  2RKV A;  4G2M A;  1DPD A;  2XHG A;  1QCA A;  2JGP A;  2II5 A;  2VSQ A;  2FY4 A;  2FYO A;  4KEC A;  1XMC A;  1NDB A;  1DPB A;  3CLA A;  2II3 A;  2H3W A;  5KJV A;  1EAE A;  1T7N A;  2CLA A;  4KE4 A;  5DUA A;  1L5A A;  5FAL A;  2FW3 A;  5KJT A;  1Q6X A;  3B2S A;  1XL7 A;  2H3U A;  2FY2 A;  2E1T A;  1NM8 A;  1C4T A;  5DU9 A;  5KJS A;  1EAD A;  2IHW A;  2H4T A;  2RKT A;  2RCU A;  2H3P A;  1Q9J A;  3U9F A;  3L60 A;  1SCZ A;  4EP9 A;  1T7Q A;  1NOC B;  2DEB A;  3MAE A;  1NDI A;  1Q23 A;  3FOT A;  1EAA A;  2FY5 A;  5KJW A;  1CIA A;  1PD5 A;  2I9D A;  2ZBA A;  3U9B A;  2II4 A;  1NDF A;  4JN3 A;  4N72 A;  4G0B A;  1S5O A;  1XL8 A;  5KJU A;  1CLA A; 
#chains in the Genus database with same CATH homology
 5T3E A;  4G2M A;  1NOC B;  3MAE A;  1DPD A;  3FP0 A;  5FAN A;  2XHG A;  1EAF A;  1QCA A;  3B30 A;  2JGP A;  4HVM A;  1Q23 A;  3FOT A;  1EAA A;  2II5 A;  5KJT A;  5KJW A;  1CIA A;  2VSQ A;  2E1V A;  3B2S A;  1XL7 A;  1EAC A;  4KEC A;  1PD5 A;  2I9D A;  2XR7 A;  2ZBA A;  1XMC A;  2E1T A;  1C4T A;  1EAB A;  3U9B A;  1DPB A;  3CLA A;  5DU9 A;  2II3 A;  2E1U A;  1XMD A;  2BGH A;  2II4 A;  4CLA A;  5KJS A;  1EAD A;  2IHW A;  1DPC A;  2RKT A;  1CLA A;  4G22 A;  1Q9J A;  4JN3 A;  5KJV A;  1EAE A;  4N72 A;  4G0B A;  4JN5 A;  2CLA A;  3U9F A;  3L60 A;  4KE4 A;  5DUA A;  1L5A A;  1E2O A;  1XL8 A;  5FAL A;  2RKV A;  5KJU A;  1SCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...