2IHWA

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), apo form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
234
structure length
234
Chain Sequence
GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 68
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ihwA01
1DPDA 3CLAA 5KJWA 1Q9JA 2E1VA 3B2SA 3U9BA 4CLAA 5KJVA 5KJTA 2II5A 1EAEA 1PD5A 2CLAA 1CIAA 1DPCA 2E1TA 3B30A 1E2OA 2JGPA 3U9FA 1QCAA 3FOTA 1XL7A 4KECA 1EACA 2I9DA 1Q23A 2II4A 1SCZA 1C4TA 1XMCA 5DUAA 5FALA 5FANA 2XR7A 1EABA 3MAEA 2BGHA 2ZBAA 2RKVA 4JN5A 5KJSA 4N72A 2E1UA 2XHGA 2IHWA 2II3A 2VSQA 5T3EA 4JN3A 5KJUA 4KE4A 3L60A 1NOCB 1L5AA 4G2MA 1EAAA 1XMDA 4G22A 3FP0A 1EAFA 5DU9A 4G0BA 1EADA 1DPBA 1XL8A 2RKTA 1CLAA 4HVMA
chains in the Genus database with same CATH superfamily
1DPDA 1Q9JA 3B30A 1DPCA 1T7NA 1EACA 2I9DA 1SCZA 2FY4A 2XR7A 1EABA 3MAEA 1NDIA 2RKVA 2H4TA 2IHWA 5T3EA 4G22A 1S5OA 1DPBA 1XL8A 4HVMA 3CLAA 2H3PA 2H3WA 2E1VA 3U9BA 2II5A 2CLAA 1NDBA 2II4A 2E1UA 2FY3A 2FW3A 5KJUA 3L60A 1L5AA 2RCUA 1EAAA 2DEBA 1T7OA 5DU9A 2FY2A 4EPHA 5KJTA 1EAEA 1E2OA 3U9FA 1QCAA 3FOTA 1XL7A 4KECA 1Q23A 1XMCA 5DUAA 5FANA 2ZBAA 4N72A 2II3A 2VSQA 4EYWA 4KE4A 1Q6XA 1T1UA 1NDFA 4G2MA 3FP0A 1EAFA 1NM8A 1EADA 2H3UA 5KJWA 4CLAA 3B2SA 5KJVA 1PD5A 1CIAA 2E1TA 2FY5A 2JGPA 1C4TA 2FYOA 2BGHA 4JN5A 5KJSA 2XHGA 4JN3A 1NOCB 1T7QA 1XMDA 4EP9A 4G0BA 5FALA 2RKTA 1CLAA
chains in the Genus database with same CATH topology
1DPDA 3CLAA 5KJWA 1Q9JA 2E1VA 3B2SA 3U9BA 4CLAA 5KJVA 5KJTA 2II5A 1EAEA 1PD5A 2CLAA 1CIAA 1DPCA 2E1TA 3B30A 1E2OA 2JGPA 3U9FA 1QCAA 3FOTA 1XL7A 4KECA 1EACA 2I9DA 1Q23A 2II4A 1SCZA 1C4TA 1XMCA 5DUAA 5FALA 5FANA 2XR7A 1EABA 3MAEA 2BGHA 2ZBAA 2RKVA 4JN5A 5KJSA 4N72A 2E1UA 2XHGA 2IHWA 2II3A 2VSQA 5T3EA 4JN3A 5KJUA 4KE4A 3L60A 1NOCB 1L5AA 4G2MA 1EAAA 1XMDA 4G22A 3FP0A 1EAFA 5DU9A 4G0BA 1EADA 1DPBA 1XL8A 2RKTA 1CLAA 4HVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DPD A;  3CLA A;  5KJW A;  1Q9J A;  2E1V A;  3B2S A;  3U9B A;  4CLA A;  5KJV A;  5KJT A;  2II5 A;  1EAE A;  1PD5 A;  2CLA A;  1CIA A;  1DPC A;  2E1T A;  3B30 A;  1E2O A;  2JGP A;  3U9F A;  1QCA A;  3FOT A;  1XL7 A;  4KEC A;  1EAC A;  2I9D A;  1Q23 A;  2II4 A;  1SCZ A;  1C4T A;  1XMC A;  5DUA A;  5FAL A;  5FAN A;  2XR7 A;  1EAB A;  3MAE A;  2BGH A;  2ZBA A;  2RKV A;  4JN5 A;  5KJS A;  4N72 A;  2E1U A;  2XHG A;  2IHW A;  2II3 A;  2VSQ A;  5T3E A;  4JN3 A;  5KJU A;  4KE4 A;  3L60 A;  1NOC B;  1L5A A;  4G2M A;  1EAA A;  1XMD A;  4G22 A;  3FP0 A;  1EAF A;  5DU9 A;  4G0B A;  1EAD A;  1DPB A;  1XL8 A;  2RKT A;  1CLA A;  4HVM A; 
#chains in the Genus database with same CATH topology
 1DPD A;  1Q9J A;  3B30 A;  1DPC A;  1T7N A;  1EAC A;  2I9D A;  1SCZ A;  2FY4 A;  2XR7 A;  1EAB A;  3MAE A;  1NDI A;  2RKV A;  2H4T A;  2IHW A;  5T3E A;  4G22 A;  1S5O A;  1DPB A;  1XL8 A;  4HVM A;  3CLA A;  2H3P A;  2H3W A;  2E1V A;  3U9B A;  2II5 A;  2CLA A;  1NDB A;  2II4 A;  2E1U A;  2FY3 A;  2FW3 A;  5KJU A;  3L60 A;  1L5A A;  2RCU A;  1EAA A;  2DEB A;  1T7O A;  5DU9 A;  2FY2 A;  4EPH A;  5KJT A;  1EAE A;  1E2O A;  3U9F A;  1QCA A;  3FOT A;  1XL7 A;  4KEC A;  1Q23 A;  1XMC A;  5DUA A;  5FAN A;  2ZBA A;  4N72 A;  2II3 A;  2VSQ A;  4EYW A;  4KE4 A;  1Q6X A;  1T1U A;  1NDF A;  4G2M A;  3FP0 A;  1EAF A;  1NM8 A;  1EAD A;  2H3U A;  5KJW A;  4CLA A;  3B2S A;  5KJV A;  1PD5 A;  1CIA A;  2E1T A;  2FY5 A;  2JGP A;  1C4T A;  2FYO A;  2BGH A;  4JN5 A;  5KJS A;  2XHG A;  4JN3 A;  1NOC B;  1T7Q A;  1XMD A;  4EP9 A;  4G0B A;  5FAL A;  2RKT A;  1CLA A; 
#chains in the Genus database with same CATH homology
 1DPD A;  3CLA A;  5KJW A;  1Q9J A;  2E1V A;  3B2S A;  3U9B A;  4CLA A;  5KJV A;  5KJT A;  2II5 A;  1EAE A;  1PD5 A;  2CLA A;  1CIA A;  1DPC A;  2E1T A;  3B30 A;  1E2O A;  2JGP A;  3U9F A;  1QCA A;  3FOT A;  1XL7 A;  4KEC A;  1EAC A;  2I9D A;  1Q23 A;  2II4 A;  1SCZ A;  1C4T A;  1XMC A;  5DUA A;  5FAL A;  5FAN A;  2XR7 A;  1EAB A;  3MAE A;  2BGH A;  2ZBA A;  2RKV A;  4JN5 A;  5KJS A;  4N72 A;  2E1U A;  2XHG A;  2IHW A;  2II3 A;  2VSQ A;  5T3E A;  4JN3 A;  5KJU A;  4KE4 A;  3L60 A;  1NOC B;  1L5A A;  4G2M A;  1EAA A;  1XMD A;  4G22 A;  3FP0 A;  1EAF A;  5DU9 A;  4G0B A;  1EAD A;  1DPB A;  1XL8 A;  2RKT A;  1CLA A;  4HVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...