2IHWA

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), apo form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
234
structure length
234
Chain Sequence
GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 68
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ihwA01
1EADA 3B2SA 1EAFA 3B30A 2II4A 5DUAA 5T3EA 2VSQA 1DPCA 1Q9JA 1XMDA 1XMCA 2CLAA 1SCZA 5KJSA 2E1UA 2E1TA 4JN5A 3U9FA 1L5AA 1EAEA 2RKTA 1EABA 4JN3A 2JGPA 2I9DA 5KJWA 1DPBA 2ZBAA 2IHWA 2RKVA 3CLAA 4HVMA 2II5A 5FALA 4CLAA 2XHGA 3L60A 1DPDA 1NOCB 3FOTA 4G2MA 4N72A 1Q23A 1CIAA 2E1VA 5KJTA 4G0BA 3MAEA 1QCAA 4KE4A 5DU9A 1C4TA 2BGHA 5FANA 4G22A 1EACA 5KJUA 4KECA 1EAAA 1E2OA 1XL7A 2XR7A 1PD5A 1XL8A 3U9BA 2II3A 1CLAA 3FP0A 5KJVA
chains in the Genus database with same CATH superfamily
1NM8A 2H3WA 1NDIA 4EP9A 2E1TA 1L5AA 1EAEA 2RCUA 2JGPA 1DPBA 1Q6XA 2RKVA 5FALA 3L60A 3FOTA 1CIAA 5KJTA 2H4TA 4EPHA 5FANA 4G22A 1XL7A 1EADA 1EAFA 1Q9JA 2CLAA 1SCZA 5KJSA 2FY4A 2E1UA 4JN3A 2ZBAA 3CLAA 4HVMA 2XHGA 4N72A 1QCAA 2DEBA 1EAAA 2XR7A 2H3UA 3U9BA 2II3A 3FP0A 1T1UA 1T7QA 3B2SA 5DUAA 5T3EA 2FY3A 2II4A 2VSQA 1DPCA 2FYOA 3U9FA 2I9DA 1S5OA 2IHWA 2II5A 1DPDA 1Q23A 4G0BA 5DU9A 4KE4A 1C4TA 2BGHA 5KJUA 4KECA 1E2OA 1PD5A 1CLAA 1T7NA 1XMDA 1XMCA 1T7OA 4JN5A 2RKTA 1NDFA 1EABA 4EYWA 5KJWA 4CLAA 1NOCB 4G2MA 2E1VA 2H3PA 3MAEA 2FY2A 2FY5A 1EACA 1XL8A 2FW3A 1NDBA 3B30A 5KJVA
chains in the Genus database with same CATH topology
1EADA 3B2SA 1EAFA 3B30A 2II4A 5DUAA 5T3EA 2VSQA 1DPCA 1Q9JA 1XMDA 1XMCA 2CLAA 1SCZA 5KJSA 2E1UA 2E1TA 4JN5A 3U9FA 1L5AA 1EAEA 2RKTA 1EABA 4JN3A 2JGPA 2I9DA 5KJWA 1DPBA 2ZBAA 2IHWA 2RKVA 3CLAA 4HVMA 2II5A 5FALA 4CLAA 2XHGA 3L60A 1DPDA 1NOCB 3FOTA 4G2MA 4N72A 1Q23A 1CIAA 2E1VA 5KJTA 4G0BA 3MAEA 1QCAA 4KE4A 5DU9A 1C4TA 2BGHA 5FANA 4G22A 1EACA 5KJUA 4KECA 1EAAA 1E2OA 1XL7A 2XR7A 1PD5A 1XL8A 3U9BA 2II3A 1CLAA 3FP0A 5KJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAD A;  3B2S A;  1EAF A;  3B30 A;  2II4 A;  5DUA A;  5T3E A;  2VSQ A;  1DPC A;  1Q9J A;  1XMD A;  1XMC A;  2CLA A;  1SCZ A;  5KJS A;  2E1U A;  2E1T A;  4JN5 A;  3U9F A;  1L5A A;  1EAE A;  2RKT A;  1EAB A;  4JN3 A;  2JGP A;  2I9D A;  5KJW A;  1DPB A;  2ZBA A;  2IHW A;  2RKV A;  3CLA A;  4HVM A;  2II5 A;  5FAL A;  4CLA A;  2XHG A;  3L60 A;  1DPD A;  1NOC B;  3FOT A;  4G2M A;  4N72 A;  1Q23 A;  1CIA A;  2E1V A;  5KJT A;  4G0B A;  3MAE A;  1QCA A;  4KE4 A;  5DU9 A;  1C4T A;  2BGH A;  5FAN A;  4G22 A;  1EAC A;  5KJU A;  4KEC A;  1EAA A;  1E2O A;  1XL7 A;  2XR7 A;  1PD5 A;  1XL8 A;  3U9B A;  2II3 A;  1CLA A;  3FP0 A;  5KJV A; 
#chains in the Genus database with same CATH topology
 1NM8 A;  2H3W A;  1NDI A;  4EP9 A;  2E1T A;  1L5A A;  1EAE A;  2RCU A;  2JGP A;  1DPB A;  1Q6X A;  2RKV A;  5FAL A;  3L60 A;  3FOT A;  1CIA A;  5KJT A;  2H4T A;  4EPH A;  5FAN A;  4G22 A;  1XL7 A;  1EAD A;  1EAF A;  1Q9J A;  2CLA A;  1SCZ A;  5KJS A;  2FY4 A;  2E1U A;  4JN3 A;  2ZBA A;  3CLA A;  4HVM A;  2XHG A;  4N72 A;  1QCA A;  2DEB A;  1EAA A;  2XR7 A;  2H3U A;  3U9B A;  2II3 A;  3FP0 A;  1T1U A;  1T7Q A;  3B2S A;  5DUA A;  5T3E A;  2FY3 A;  2II4 A;  2VSQ A;  1DPC A;  2FYO A;  3U9F A;  2I9D A;  1S5O A;  2IHW A;  2II5 A;  1DPD A;  1Q23 A;  4G0B A;  5DU9 A;  4KE4 A;  1C4T A;  2BGH A;  5KJU A;  4KEC A;  1E2O A;  1PD5 A;  1CLA A;  1T7N A;  1XMD A;  1XMC A;  1T7O A;  4JN5 A;  2RKT A;  1NDF A;  1EAB A;  4EYW A;  5KJW A;  4CLA A;  1NOC B;  4G2M A;  2E1V A;  2H3P A;  3MAE A;  2FY2 A;  2FY5 A;  1EAC A;  1XL8 A;  2FW3 A;  1NDB A;  3B30 A;  5KJV A; 
#chains in the Genus database with same CATH homology
 1EAD A;  3B2S A;  1EAF A;  3B30 A;  2II4 A;  5DUA A;  5T3E A;  2VSQ A;  1DPC A;  1Q9J A;  1XMD A;  1XMC A;  2CLA A;  1SCZ A;  5KJS A;  2E1U A;  2E1T A;  4JN5 A;  3U9F A;  1L5A A;  1EAE A;  2RKT A;  1EAB A;  4JN3 A;  2JGP A;  2I9D A;  5KJW A;  1DPB A;  2ZBA A;  2IHW A;  2RKV A;  3CLA A;  4HVM A;  2II5 A;  5FAL A;  4CLA A;  2XHG A;  3L60 A;  1DPD A;  1NOC B;  3FOT A;  4G2M A;  4N72 A;  1Q23 A;  1CIA A;  2E1V A;  5KJT A;  4G0B A;  3MAE A;  1QCA A;  4KE4 A;  5DU9 A;  1C4T A;  2BGH A;  5FAN A;  4G22 A;  1EAC A;  5KJU A;  4KEC A;  1EAA A;  1E2O A;  1XL7 A;  2XR7 A;  1PD5 A;  1XL8 A;  3U9B A;  2II3 A;  1CLA A;  3FP0 A;  5KJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...