2IHWA

Crystal structure of a cubic core of the dihydrolipoamide acyltransferase (e2b) component in the branched-chain alpha-ketoacid dehydrogenase complex (bckdc), apo form
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
234
structure length
234
Chain Sequence
GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Lipoamide acyltransferase component of branched-chain alpha-
publication title A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb
source organism Bos taurus
total genus 68
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2ihwA01
1DPDA 1EAAA 2IHWA 4G22A 3U9FA 1Q9JA 3FP0A 3CLAA 2CLAA 1E2OA 2XHGA 1C4TA 1XMDA 4JN3A 2RKVA 2ZBAA 5FANA 5KJVA 5KJTA 4G0BA 1EAEA 4N72A 1L5AA 3L60A 1Q23A 2II4A 2JGPA 5T3EA 2E1TA 1DPBA 3B30A 1PD5A 2XR7A 2E1VA 4JN5A 4KECA 5DUAA 3B2SA 1CIAA 1NOCB 1DPCA 1EABA 2II3A 1EAFA 2RKTA 4CLAA 3FOTA 3MAEA 5KJUA 5KJSA 4HVMA 1CLAA 2VSQA 2II5A 5DU9A 5KJWA 1EADA 1XL7A 3U9BA 2BGHA 5FALA 1EACA 4G2MA 2I9DA 1XMCA 1SCZA 2E1UA 1XL8A 4KE4A 1QCAA
chains in the Genus database with same CATH superfamily
4G22A 3U9FA 3CLAA 1E2OA 2XHGA 4G0BA 4N72A 2FYOA 1L5AA 1DPBA 1T7NA 5DUAA 1PD5A 2E1VA 4KECA 4EYWA 3MAEA 4HVMA 5KJWA 1EADA 2FY2A 3U9BA 2BGHA 4EP9A 1SCZA 2E1UA 5DU9A 1DPDA 1NM8A 2CLAA 1T7OA 1Q23A 2II4A 2JGPA 5T3EA 3B30A 4JN5A 2DEBA 3B2SA 1EAFA 3FOTA 2FW3A 1Q6XA 1NDBA 4G2MA 1QCAA 2IHWA 3FP0A 4JN3A 5KJTA 2RKVA 2H3WA 5KJVA 3L60A 2E1TA 2XR7A 1CIAA 1NOCB 1EABA 2FY3A 5KJUA 1T7QA 1CLAA 2VSQA 1XL7A 1EACA 2I9DA 1XL8A 4KE4A 1NDFA 1EAAA 1Q9JA 1T1UA 5FANA 1C4TA 1XMDA 1S5OA 2ZBAA 4EPHA 1EAEA 2FY4A 2FY5A 1DPCA 2II3A 1NDIA 2RKTA 4CLAA 5KJSA 2RCUA 2II5A 5FALA 2H3PA 1XMCA 2H3UA 2H4TA
chains in the Genus database with same CATH topology
1DPDA 1EAAA 2IHWA 4G22A 3U9FA 1Q9JA 3FP0A 3CLAA 2CLAA 1E2OA 2XHGA 1C4TA 1XMDA 4JN3A 2RKVA 2ZBAA 5FANA 5KJVA 5KJTA 4G0BA 1EAEA 4N72A 1L5AA 3L60A 1Q23A 2II4A 2JGPA 5T3EA 2E1TA 1DPBA 3B30A 1PD5A 2XR7A 2E1VA 4JN5A 4KECA 5DUAA 3B2SA 1CIAA 1NOCB 1DPCA 1EABA 2II3A 1EAFA 2RKTA 4CLAA 3FOTA 3MAEA 5KJUA 5KJSA 4HVMA 1CLAA 2VSQA 2II5A 5DU9A 5KJWA 1EADA 1XL7A 3U9BA 2BGHA 5FALA 1EACA 4G2MA 2I9DA 1XMCA 1SCZA 2E1UA 1XL8A 4KE4A 1QCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DPD A;  1EAA A;  2IHW A;  4G22 A;  3U9F A;  1Q9J A;  3FP0 A;  3CLA A;  2CLA A;  1E2O A;  2XHG A;  1C4T A;  1XMD A;  4JN3 A;  2RKV A;  2ZBA A;  5FAN A;  5KJV A;  5KJT A;  4G0B A;  1EAE A;  4N72 A;  1L5A A;  3L60 A;  1Q23 A;  2II4 A;  2JGP A;  5T3E A;  2E1T A;  1DPB A;  3B30 A;  1PD5 A;  2XR7 A;  2E1V A;  4JN5 A;  4KEC A;  5DUA A;  3B2S A;  1CIA A;  1NOC B;  1DPC A;  1EAB A;  2II3 A;  1EAF A;  2RKT A;  4CLA A;  3FOT A;  3MAE A;  5KJU A;  5KJS A;  4HVM A;  1CLA A;  2VSQ A;  2II5 A;  5DU9 A;  5KJW A;  1EAD A;  1XL7 A;  3U9B A;  2BGH A;  5FAL A;  1EAC A;  4G2M A;  2I9D A;  1XMC A;  1SCZ A;  2E1U A;  1XL8 A;  4KE4 A;  1QCA A; 
#chains in the Genus database with same CATH topology
 4G22 A;  3U9F A;  3CLA A;  1E2O A;  2XHG A;  4G0B A;  4N72 A;  2FYO A;  1L5A A;  1DPB A;  1T7N A;  5DUA A;  1PD5 A;  2E1V A;  4KEC A;  4EYW A;  3MAE A;  4HVM A;  5KJW A;  1EAD A;  2FY2 A;  3U9B A;  2BGH A;  4EP9 A;  1SCZ A;  2E1U A;  5DU9 A;  1DPD A;  1NM8 A;  2CLA A;  1T7O A;  1Q23 A;  2II4 A;  2JGP A;  5T3E A;  3B30 A;  4JN5 A;  2DEB A;  3B2S A;  1EAF A;  3FOT A;  2FW3 A;  1Q6X A;  1NDB A;  4G2M A;  1QCA A;  2IHW A;  3FP0 A;  4JN3 A;  5KJT A;  2RKV A;  2H3W A;  5KJV A;  3L60 A;  2E1T A;  2XR7 A;  1CIA A;  1NOC B;  1EAB A;  2FY3 A;  5KJU A;  1T7Q A;  1CLA A;  2VSQ A;  1XL7 A;  1EAC A;  2I9D A;  1XL8 A;  4KE4 A;  1NDF A;  1EAA A;  1Q9J A;  1T1U A;  5FAN A;  1C4T A;  1XMD A;  1S5O A;  2ZBA A;  4EPH A;  1EAE A;  2FY4 A;  2FY5 A;  1DPC A;  2II3 A;  1NDI A;  2RKT A;  4CLA A;  5KJS A;  2RCU A;  2II5 A;  5FAL A;  2H3P A;  1XMC A;  2H3U A;  2H4T A; 
#chains in the Genus database with same CATH homology
 1DPD A;  1EAA A;  2IHW A;  4G22 A;  3U9F A;  1Q9J A;  3FP0 A;  3CLA A;  2CLA A;  1E2O A;  2XHG A;  1C4T A;  1XMD A;  4JN3 A;  2RKV A;  2ZBA A;  5FAN A;  5KJV A;  5KJT A;  4G0B A;  1EAE A;  4N72 A;  1L5A A;  3L60 A;  1Q23 A;  2II4 A;  2JGP A;  5T3E A;  2E1T A;  1DPB A;  3B30 A;  1PD5 A;  2XR7 A;  2E1V A;  4JN5 A;  4KEC A;  5DUA A;  3B2S A;  1CIA A;  1NOC B;  1DPC A;  1EAB A;  2II3 A;  1EAF A;  2RKT A;  4CLA A;  3FOT A;  3MAE A;  5KJU A;  5KJS A;  4HVM A;  1CLA A;  2VSQ A;  2II5 A;  5DU9 A;  5KJW A;  1EAD A;  1XL7 A;  3U9B A;  2BGH A;  5FAL A;  1EAC A;  4G2M A;  2I9D A;  1XMC A;  1SCZ A;  2E1U A;  1XL8 A;  4KE4 A;  1QCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...