5KJVA

Crystal structure of coleus blumei hct
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
427
structure length
427
Chain Sequence
MKIHVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPSGADNFFDTAVMKAALGRALVSFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGTVDDYGDFAPSLELRRLIPAVDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDITLPPFIDRTLLSARDPPQPQFKHVEYQPPPAMKTYEPAETVVSIFKLTKDQLTTLKAKSKEDGNTTTYSSYEMLSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQPQLPPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRSALDFLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLYQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl transferase
publication title Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.
pubmed doi rcsb
source organism Plectranthus scutellarioides
molecule tags Transferase
total genus 131
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjvA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjvA01
4KECA 1DPDA 5FANA 3U9BA 1EACA 4HVMA 5KJVA 1Q9JA 2BGHA 4G22A 3U9FA 2E1VA 3FOTA 1EAAA 4G2MA 3CLAA 5KJWA 1Q23A 1CLAA 2RKVA 2I9DA 4CLAA 1CIAA 2XR7A 1XMCA 5KJSA 1DPBA 1XL7A 2II3A 3B2SA 4JN5A 1EAEA 5T3EA 1XMDA 2VSQA 4JN3A 4N72A 1EAFA 1C4TA 1EABA 1XL8A 2E1UA 2XHGA 3B30A 5DUAA 2ZBAA 2JGPA 1DPCA 2II5A 5FALA 3MAEA 1NOCB 2RKTA 2IHWA 1EADA 3FP0A 5DU9A 1L5AA 1E2OA 2CLAA 5KJUA 1SCZA 2II4A 2E1TA 4G0BA 4KE4A 3L60A 1QCAA 1PD5A 5KJTA
chains in the Genus database with same CATH superfamily
3U9BA 3U9FA 2E1VA 3CLAA 5KJWA 1Q23A 1NDBA 2I9DA 1CIAA 2H3PA 1XMCA 1XL7A 3B2SA 2FYOA 1Q6XA 3B30A 2XHGA 2ZBAA 1DPCA 2II5A 5FALA 3MAEA 1NOCB 1EADA 5DU9A 2CLAA 2RCUA 4G0BA 4KE4A 2DEBA 5FANA 5KJVA 1EAAA 2H3WA 1CLAA 5KJSA 1DPBA 2H4TA 4JN5A 1EAEA 5T3EA 2E1UA 4EYWA 2JGPA 4EPHA 1T7QA 1NDIA 3FP0A 1L5AA 1SCZA 2II4A 1T7NA 5KJTA 4KECA 1DPDA 1EACA 4EP9A 4HVMA 3FOTA 4G2MA 2RKVA 4CLAA 1T1UA 1NM8A 4N72A 1EAFA 1XL8A 2FY3A 2FY4A 2RKTA 1T7OA 5KJUA 1NDFA 3L60A 2FY5A 1QCAA 1PD5A 1S5OA 1Q9JA 2H3UA 2BGHA 4G22A 2II3A 1XMDA 2VSQA 1C4TA 1EABA 2FW3A 5DUAA 2FY2A 2IHWA 1E2OA 2E1TA 4JN3A 2XR7A
chains in the Genus database with same CATH topology
4KECA 1DPDA 5FANA 3U9BA 1EACA 4HVMA 5KJVA 1Q9JA 2BGHA 4G22A 3U9FA 2E1VA 3FOTA 1EAAA 4G2MA 3CLAA 5KJWA 1Q23A 1CLAA 2RKVA 2I9DA 4CLAA 1CIAA 2XR7A 1XMCA 5KJSA 1DPBA 1XL7A 2II3A 3B2SA 4JN5A 1EAEA 5T3EA 1XMDA 2VSQA 4JN3A 4N72A 1EAFA 1C4TA 1EABA 1XL8A 2E1UA 2XHGA 3B30A 5DUAA 2ZBAA 2JGPA 1DPCA 2II5A 5FALA 3MAEA 1NOCB 2RKTA 2IHWA 1EADA 3FP0A 5DU9A 1L5AA 1E2OA 2CLAA 5KJUA 1SCZA 2II4A 2E1TA 4G0BA 4KE4A 3L60A 1QCAA 1PD5A 5KJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KEC A;  1DPD A;  5FAN A;  3U9B A;  1EAC A;  4HVM A;  5KJV A;  1Q9J A;  2BGH A;  4G22 A;  3U9F A;  2E1V A;  3FOT A;  1EAA A;  4G2M A;  3CLA A;  5KJW A;  1Q23 A;  1CLA A;  2RKV A;  2I9D A;  4CLA A;  1CIA A;  2XR7 A;  1XMC A;  5KJS A;  1DPB A;  1XL7 A;  2II3 A;  3B2S A;  4JN5 A;  1EAE A;  5T3E A;  1XMD A;  2VSQ A;  4JN3 A;  4N72 A;  1EAF A;  1C4T A;  1EAB A;  1XL8 A;  2E1U A;  2XHG A;  3B30 A;  5DUA A;  2ZBA A;  2JGP A;  1DPC A;  2II5 A;  5FAL A;  3MAE A;  1NOC B;  2RKT A;  2IHW A;  1EAD A;  3FP0 A;  5DU9 A;  1L5A A;  1E2O A;  2CLA A;  5KJU A;  1SCZ A;  2II4 A;  2E1T A;  4G0B A;  4KE4 A;  3L60 A;  1QCA A;  1PD5 A;  5KJT A; 
#chains in the Genus database with same CATH topology
 3U9B A;  3U9F A;  2E1V A;  3CLA A;  5KJW A;  1Q23 A;  1NDB A;  2I9D A;  1CIA A;  2H3P A;  1XMC A;  1XL7 A;  3B2S A;  2FYO A;  1Q6X A;  3B30 A;  2XHG A;  2ZBA A;  1DPC A;  2II5 A;  5FAL A;  3MAE A;  1NOC B;  1EAD A;  5DU9 A;  2CLA A;  2RCU A;  4G0B A;  4KE4 A;  2DEB A;  5FAN A;  5KJV A;  1EAA A;  2H3W A;  1CLA A;  5KJS A;  1DPB A;  2H4T A;  4JN5 A;  1EAE A;  5T3E A;  2E1U A;  4EYW A;  2JGP A;  4EPH A;  1T7Q A;  1NDI A;  3FP0 A;  1L5A A;  1SCZ A;  2II4 A;  1T7N A;  5KJT A;  4KEC A;  1DPD A;  1EAC A;  4EP9 A;  4HVM A;  3FOT A;  4G2M A;  2RKV A;  4CLA A;  1T1U A;  1NM8 A;  4N72 A;  1EAF A;  1XL8 A;  2FY3 A;  2FY4 A;  2RKT A;  1T7O A;  5KJU A;  1NDF A;  3L60 A;  2FY5 A;  1QCA A;  1PD5 A;  1S5O A;  1Q9J A;  2H3U A;  2BGH A;  4G22 A;  2II3 A;  1XMD A;  2VSQ A;  1C4T A;  1EAB A;  2FW3 A;  5DUA A;  2FY2 A;  2IHW A;  1E2O A;  2E1T A;  4JN3 A;  2XR7 A; 
#chains in the Genus database with same CATH homology
 4KEC A;  1DPD A;  5FAN A;  3U9B A;  1EAC A;  4HVM A;  5KJV A;  1Q9J A;  2BGH A;  4G22 A;  3U9F A;  2E1V A;  3FOT A;  1EAA A;  4G2M A;  3CLA A;  5KJW A;  1Q23 A;  1CLA A;  2RKV A;  2I9D A;  4CLA A;  1CIA A;  2XR7 A;  1XMC A;  5KJS A;  1DPB A;  1XL7 A;  2II3 A;  3B2S A;  4JN5 A;  1EAE A;  5T3E A;  1XMD A;  2VSQ A;  4JN3 A;  4N72 A;  1EAF A;  1C4T A;  1EAB A;  1XL8 A;  2E1U A;  2XHG A;  3B30 A;  5DUA A;  2ZBA A;  2JGP A;  1DPC A;  2II5 A;  5FAL A;  3MAE A;  1NOC B;  2RKT A;  2IHW A;  1EAD A;  3FP0 A;  5DU9 A;  1L5A A;  1E2O A;  2CLA A;  5KJU A;  1SCZ A;  2II4 A;  2E1T A;  4G0B A;  4KE4 A;  3L60 A;  1QCA A;  1PD5 A;  5KJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...