5KJVA

Crystal structure of coleus blumei hct
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
427
structure length
427
Chain Sequence
MKIHVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPSGADNFFDTAVMKAALGRALVSFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGTVDDYGDFAPSLELRRLIPAVDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDITLPPFIDRTLLSARDPPQPQFKHVEYQPPPAMKTYEPAETVVSIFKLTKDQLTTLKAKSKEDGNTTTYSSYEMLSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQPQLPPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRSALDFLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLYQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Hydroxycinnamoyl transferase
publication title Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.
pubmed doi rcsb
source organism Plectranthus scutellarioides
total genus 131
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjvA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjvA01
3CLAA 2CLAA 3L60A 3FOTA 2RKVA 2E1VA 1DPBA 1PD5A 1DPDA 1XMDA 5DU9A 4G2MA 5FALA 1XMCA 3U9FA 1DPCA 4G0BA 2XHGA 5KJVA 1C4TA 4HVMA 1EAFA 1SCZA 2JGPA 5KJWA 2II5A 1NOCB 2BGHA 1L5AA 5FANA 1EAAA 1EADA 2XR7A 1QCAA 2VSQA 2E1UA 1XL7A 2IHWA 5DUAA 3B30A 3MAEA 1E2OA 3FP0A 1CLAA 5KJUA 1EAEA 5KJSA 2I9DA 1EACA 1Q23A 4G22A 1EABA 5KJTA 4CLAA 2II3A 4KE4A 4JN5A 4KECA 1CIAA 1Q9JA 2E1TA 2RKTA 3B2SA 4N72A 3U9BA 2ZBAA 4JN3A 2II4A 1XL8A 5T3EA
chains in the Genus database with same CATH superfamily
2CLAA 2H4TA 3FOTA 2XHGA 1L5AA 4EYWA 1EAAA 2H3WA 3B30A 3MAEA 1NM8A 5KJSA 4KE4A 2RCUA 2FYOA 1T7QA 2RKTA 1XL8A 2FY4A 1S5OA 1DPBA 1DPDA 1Q6XA 4G2MA 5FALA 3U9FA 5KJVA 4G0BA 2H3UA 1NOCB 1NDFA 2XR7A 1QCAA 2VSQA 2IHWA 1CLAA 1EAEA 1EABA 4CLAA 4EP9A 2II3A 4KECA 4EPHA 3U9BA 2ZBAA 4JN3A 2II4A 2DEBA 2RKVA 1XMDA 5DU9A 1XMCA 4HVMA 1EAFA 2JGPA 5KJWA 2II5A 2BGHA 5FANA 2FY3A 1T1UA 2E1UA 5DUAA 2H3PA 1E2OA 3FP0A 2I9DA 1EACA 4G22A 5KJTA 2FW3A 3B2SA 5T3EA 3CLAA 3L60A 1T7NA 2E1VA 1PD5A 2FY2A 1DPCA 1C4TA 2FY5A 1SCZA 1T7OA 1EADA 1XL7A 5KJUA 1Q23A 4JN5A 1NDBA 1CIAA 1Q9JA 2E1TA 1NDIA 4N72A
chains in the Genus database with same CATH topology
3CLAA 2CLAA 3L60A 3FOTA 2RKVA 2E1VA 1DPBA 1PD5A 1DPDA 1XMDA 5DU9A 4G2MA 5FALA 1XMCA 3U9FA 1DPCA 4G0BA 2XHGA 5KJVA 1C4TA 4HVMA 1EAFA 1SCZA 2JGPA 5KJWA 2II5A 1NOCB 2BGHA 1L5AA 5FANA 1EAAA 1EADA 2XR7A 1QCAA 2VSQA 2E1UA 1XL7A 2IHWA 5DUAA 3B30A 3MAEA 1E2OA 3FP0A 1CLAA 5KJUA 1EAEA 5KJSA 2I9DA 1EACA 1Q23A 4G22A 1EABA 5KJTA 4CLAA 2II3A 4KE4A 4JN5A 4KECA 1CIAA 1Q9JA 2E1TA 2RKTA 3B2SA 4N72A 3U9BA 2ZBAA 4JN3A 2II4A 1XL8A 5T3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLA A;  2CLA A;  3L60 A;  3FOT A;  2RKV A;  2E1V A;  1DPB A;  1PD5 A;  1DPD A;  1XMD A;  5DU9 A;  4G2M A;  5FAL A;  1XMC A;  3U9F A;  1DPC A;  4G0B A;  2XHG A;  5KJV A;  1C4T A;  4HVM A;  1EAF A;  1SCZ A;  2JGP A;  5KJW A;  2II5 A;  1NOC B;  2BGH A;  1L5A A;  5FAN A;  1EAA A;  1EAD A;  2XR7 A;  1QCA A;  2VSQ A;  2E1U A;  1XL7 A;  2IHW A;  5DUA A;  3B30 A;  3MAE A;  1E2O A;  3FP0 A;  1CLA A;  5KJU A;  1EAE A;  5KJS A;  2I9D A;  1EAC A;  1Q23 A;  4G22 A;  1EAB A;  5KJT A;  4CLA A;  2II3 A;  4KE4 A;  4JN5 A;  4KEC A;  1CIA A;  1Q9J A;  2E1T A;  2RKT A;  3B2S A;  4N72 A;  3U9B A;  2ZBA A;  4JN3 A;  2II4 A;  1XL8 A;  5T3E A; 
#chains in the Genus database with same CATH topology
 2CLA A;  2H4T A;  3FOT A;  2XHG A;  1L5A A;  4EYW A;  1EAA A;  2H3W A;  3B30 A;  3MAE A;  1NM8 A;  5KJS A;  4KE4 A;  2RCU A;  2FYO A;  1T7Q A;  2RKT A;  1XL8 A;  2FY4 A;  1S5O A;  1DPB A;  1DPD A;  1Q6X A;  4G2M A;  5FAL A;  3U9F A;  5KJV A;  4G0B A;  2H3U A;  1NOC B;  1NDF A;  2XR7 A;  1QCA A;  2VSQ A;  2IHW A;  1CLA A;  1EAE A;  1EAB A;  4CLA A;  4EP9 A;  2II3 A;  4KEC A;  4EPH A;  3U9B A;  2ZBA A;  4JN3 A;  2II4 A;  2DEB A;  2RKV A;  1XMD A;  5DU9 A;  1XMC A;  4HVM A;  1EAF A;  2JGP A;  5KJW A;  2II5 A;  2BGH A;  5FAN A;  2FY3 A;  1T1U A;  2E1U A;  5DUA A;  2H3P A;  1E2O A;  3FP0 A;  2I9D A;  1EAC A;  4G22 A;  5KJT A;  2FW3 A;  3B2S A;  5T3E A;  3CLA A;  3L60 A;  1T7N A;  2E1V A;  1PD5 A;  2FY2 A;  1DPC A;  1C4T A;  2FY5 A;  1SCZ A;  1T7O A;  1EAD A;  1XL7 A;  5KJU A;  1Q23 A;  4JN5 A;  1NDB A;  1CIA A;  1Q9J A;  2E1T A;  1NDI A;  4N72 A; 
#chains in the Genus database with same CATH homology
 3CLA A;  2CLA A;  3L60 A;  3FOT A;  2RKV A;  2E1V A;  1DPB A;  1PD5 A;  1DPD A;  1XMD A;  5DU9 A;  4G2M A;  5FAL A;  1XMC A;  3U9F A;  1DPC A;  4G0B A;  2XHG A;  5KJV A;  1C4T A;  4HVM A;  1EAF A;  1SCZ A;  2JGP A;  5KJW A;  2II5 A;  1NOC B;  2BGH A;  1L5A A;  5FAN A;  1EAA A;  1EAD A;  2XR7 A;  1QCA A;  2VSQ A;  2E1U A;  1XL7 A;  2IHW A;  5DUA A;  3B30 A;  3MAE A;  1E2O A;  3FP0 A;  1CLA A;  5KJU A;  1EAE A;  5KJS A;  2I9D A;  1EAC A;  1Q23 A;  4G22 A;  1EAB A;  5KJT A;  4CLA A;  2II3 A;  4KE4 A;  4JN5 A;  4KEC A;  1CIA A;  1Q9J A;  2E1T A;  2RKT A;  3B2S A;  4N72 A;  3U9B A;  2ZBA A;  4JN3 A;  2II4 A;  1XL8 A;  5T3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...