5KJVA

Crystal structure of coleus blumei hct
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
427
structure length
427
Chain Sequence
MKIHVRDSTLVRPSAATPAVSLWNSNVDLVVPNFHTPSVYFYRPSGADNFFDTAVMKAALGRALVSFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGTVDDYGDFAPSLELRRLIPAVDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLDITLPPFIDRTLLSARDPPQPQFKHVEYQPPPAMKTYEPAETVVSIFKLTKDQLTTLKAKSKEDGNTTTYSSYEMLSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQPQLPPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRSALDFLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLLYQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxycinnamoyl transferase
publication title Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.
pubmed doi rcsb
source organism Plectranthus scutellarioides
molecule tags Transferase
total genus 131
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.3.1.133: Shikimate O-hydroxycinnamoyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjvA02
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 5kjvA01
3FOTA 3L60A 2XHGA 3MAEA 4G0BA 4JN5A 1EADA 3B2SA 4HVMA 2IHWA 1CIAA 4G2MA 5KJWA 1XMDA 5DUAA 3B30A 2RKTA 2E1UA 2CLAA 5KJTA 1EABA 3FP0A 3CLAA 1C4TA 4N72A 5FALA 4KE4A 2XR7A 1DPBA 5KJVA 1L5AA 2ZBAA 2VSQA 5KJSA 1E2OA 4JN3A 2II3A 1Q9JA 1SCZA 4KECA 2II5A 3U9BA 5T3EA 2BGHA 2RKVA 2I9DA 5DU9A 5FANA 1EAEA 1XL7A 2JGPA 3U9FA 4CLAA 1DPCA 1XL8A 2E1VA 5KJUA 1NOCB 4G22A 1QCAA 1Q23A 2II4A 1PD5A 1XMCA 1CLAA 1EACA 1EAFA 1DPDA 1EAAA 2E1TA
chains in the Genus database with same CATH superfamily
3FOTA 1NM8A 2XHGA 4HVMA 4G2MA 5KJWA 2FY2A 1XMDA 1T7NA 2RKTA 2E1UA 2CLAA 1T1UA 4KE4A 1DPBA 5KJVA 1EAAA 2VSQA 1E2OA 1SCZA 4CLAA 5KJUA 1CLAA 1CIAA 4G0BA 4JN5A 2RCUA 5DUAA 3FP0A 2ZBAA 2II3A 4KECA 2FY3A 1NDFA 5DU9A 2FY5A 1XL7A 1NDIA 1Q6XA 2II4A 1Q23A 1EACA 2H4TA 3U9FA 3MAEA 3B30A 5KJTA 2FW3A 1EABA 1C4TA 2XR7A 1L5AA 4EP9A 5KJSA 1T7OA 2H3WA 3U9BA 2FYOA 2BGHA 2RKVA 2H3UA 4EPHA 1XL8A 1NOCB 1S5OA 4G22A 1NDBA 1XMCA 1DPDA 2E1TA 3L60A 2DEBA 1EADA 3B2SA 2IHWA 2H3PA 1T7QA 3CLAA 5FALA 4JN3A 1Q9JA 2FY4A 2II5A 5T3EA 2I9DA 5FANA 1EAEA 2JGPA 1DPCA 2E1VA 1QCAA 4EYWA 1PD5A 1EAFA 4N72A
chains in the Genus database with same CATH topology
3FOTA 3L60A 2XHGA 3MAEA 4G0BA 4JN5A 1EADA 3B2SA 4HVMA 2IHWA 1CIAA 4G2MA 5KJWA 1XMDA 5DUAA 3B30A 2RKTA 2E1UA 2CLAA 5KJTA 1EABA 3FP0A 3CLAA 1C4TA 4N72A 5FALA 4KE4A 2XR7A 1DPBA 5KJVA 1L5AA 2ZBAA 2VSQA 5KJSA 1E2OA 4JN3A 2II3A 1Q9JA 1SCZA 4KECA 2II5A 3U9BA 5T3EA 2BGHA 2RKVA 2I9DA 5DU9A 5FANA 1EAEA 1XL7A 2JGPA 3U9FA 4CLAA 1DPCA 1XL8A 2E1VA 5KJUA 1NOCB 4G22A 1QCAA 1Q23A 2II4A 1PD5A 1XMCA 1CLAA 1EACA 1EAFA 1DPDA 1EAAA 2E1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOT A;  3L60 A;  2XHG A;  3MAE A;  4G0B A;  4JN5 A;  1EAD A;  3B2S A;  4HVM A;  2IHW A;  1CIA A;  4G2M A;  5KJW A;  1XMD A;  5DUA A;  3B30 A;  2RKT A;  2E1U A;  2CLA A;  5KJT A;  1EAB A;  3FP0 A;  3CLA A;  1C4T A;  4N72 A;  5FAL A;  4KE4 A;  2XR7 A;  1DPB A;  5KJV A;  1L5A A;  2ZBA A;  2VSQ A;  5KJS A;  1E2O A;  4JN3 A;  2II3 A;  1Q9J A;  1SCZ A;  4KEC A;  2II5 A;  3U9B A;  5T3E A;  2BGH A;  2RKV A;  2I9D A;  5DU9 A;  5FAN A;  1EAE A;  1XL7 A;  2JGP A;  3U9F A;  4CLA A;  1DPC A;  1XL8 A;  2E1V A;  5KJU A;  1NOC B;  4G22 A;  1QCA A;  1Q23 A;  2II4 A;  1PD5 A;  1XMC A;  1CLA A;  1EAC A;  1EAF A;  1DPD A;  1EAA A;  2E1T A; 
#chains in the Genus database with same CATH topology
 3FOT A;  1NM8 A;  2XHG A;  4HVM A;  4G2M A;  5KJW A;  2FY2 A;  1XMD A;  1T7N A;  2RKT A;  2E1U A;  2CLA A;  1T1U A;  4KE4 A;  1DPB A;  5KJV A;  1EAA A;  2VSQ A;  1E2O A;  1SCZ A;  4CLA A;  5KJU A;  1CLA A;  1CIA A;  4G0B A;  4JN5 A;  2RCU A;  5DUA A;  3FP0 A;  2ZBA A;  2II3 A;  4KEC A;  2FY3 A;  1NDF A;  5DU9 A;  2FY5 A;  1XL7 A;  1NDI A;  1Q6X A;  2II4 A;  1Q23 A;  1EAC A;  2H4T A;  3U9F A;  3MAE A;  3B30 A;  5KJT A;  2FW3 A;  1EAB A;  1C4T A;  2XR7 A;  1L5A A;  4EP9 A;  5KJS A;  1T7O A;  2H3W A;  3U9B A;  2FYO A;  2BGH A;  2RKV A;  2H3U A;  4EPH A;  1XL8 A;  1NOC B;  1S5O A;  4G22 A;  1NDB A;  1XMC A;  1DPD A;  2E1T A;  3L60 A;  2DEB A;  1EAD A;  3B2S A;  2IHW A;  2H3P A;  1T7Q A;  3CLA A;  5FAL A;  4JN3 A;  1Q9J A;  2FY4 A;  2II5 A;  5T3E A;  2I9D A;  5FAN A;  1EAE A;  2JGP A;  1DPC A;  2E1V A;  1QCA A;  4EYW A;  1PD5 A;  1EAF A;  4N72 A; 
#chains in the Genus database with same CATH homology
 3FOT A;  3L60 A;  2XHG A;  3MAE A;  4G0B A;  4JN5 A;  1EAD A;  3B2S A;  4HVM A;  2IHW A;  1CIA A;  4G2M A;  5KJW A;  1XMD A;  5DUA A;  3B30 A;  2RKT A;  2E1U A;  2CLA A;  5KJT A;  1EAB A;  3FP0 A;  3CLA A;  1C4T A;  4N72 A;  5FAL A;  4KE4 A;  2XR7 A;  1DPB A;  5KJV A;  1L5A A;  2ZBA A;  2VSQ A;  5KJS A;  1E2O A;  4JN3 A;  2II3 A;  1Q9J A;  1SCZ A;  4KEC A;  2II5 A;  3U9B A;  5T3E A;  2BGH A;  2RKV A;  2I9D A;  5DU9 A;  5FAN A;  1EAE A;  1XL7 A;  2JGP A;  3U9F A;  4CLA A;  1DPC A;  1XL8 A;  2E1V A;  5KJU A;  1NOC B;  4G22 A;  1QCA A;  1Q23 A;  2II4 A;  1PD5 A;  1XMC A;  1CLA A;  1EAC A;  1EAF A;  1DPD A;  1EAA A;  2E1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...