The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
68
|
sequence length |
234
|
structure length |
234
|
Chain Sequence |
GKDRTEPVKGFHKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQIRSIFEIATELNRLQKLGSAGQLSTNDLIGGTFTLSNIGSIGGTYAKPVILPPEVAIGALGTIKALPRFNEKGEVCKAQIMNVSWSADHRIIDGATVSRFSNLWKSYLENPAFMLLDLK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A synchronized substrate-gating mechanism revealed by cubic-core structure of the bovine branched-chain alpha-ketoacid dehydrogenase complex.
pubmed doi rcsb |
| molecule keywords |
Lipoamide acyltransferase component of branched-chain alpha-
|
| molecule tags |
Transferase
|
| source organism |
Bos taurus
|
| total genus |
68
|
| structure length |
234
|
| sequence length |
234
|
| chains with identical sequence |
B, C, D, E, F, G, H
|
| ec nomenclature |
ec
2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase. |
| pdb deposition date | 2006-09-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00198 | 2-oxoacid_dh | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Chloramphenicol Acetyltransferase | Chloramphenicol acetyltransferase-like domain |
#chains in the Genus database with same CATH superfamily 4CLA A; 1XL7 A; 3CLA A; 1EAA A; 1QCA A; 2CLA A; 2E1T A; 1XL8 A; 5KJT A; 2VSQ A; 4KEC A; 3B2S A; 2JGP A; 2II5 A; 1EAC A; 1PD5 A; 4G0B A; 4G2M A; 5KJW A; 5FAN A; 1DPD A; 5T3E A; 1C4T A; 2BGH A; 2XR7 A; 4G22 A; 3FP0 A; 5DU9 A; 3FOT A; 1Q23 A; 2E1U A; 4JN3 A; 3MAE A; 1EAD A; 3U9F A; 3U9B A; 1CIA A; 5FAL A; 2II3 A; 4N72 A; 1DPC A; 2II4 A; 2RKV A; 5KJU A; 1Q9J A; 1E2O A; 1XMD A; 5KJV A; 1EAF A; 2E1V A; 2XHG A; 1NOC B; 2RKT A; 1L5A A; 1XMC A; 3B30 A; 2IHW A; 5DUA A; 2I9D A; 3L60 A; 2ZBA A; 1SCZ A; 1EAE A; 4JN5 A; 4KE4 A; 1EAB A; 5KJS A; 4HVM A; 1DPB A; 1CLA A; #chains in the Genus database with same CATH topology 4CLA A; 2FY3 A; 1XL7 A; 2FY2 A; 5FAN A; 1NM8 A; 4G22 A; 3FP0 A; 3U9F A; 1S5O A; 1EAD A; 1DPC A; 1NDI A; 2II4 A; 2RKV A; 5KJU A; 2H3U A; 2FW3 A; 5DUA A; 1EAE A; 4JN5 A; 2H4T A; 2VSQ A; 2H3P A; 1T7N A; 1PD5 A; 4G0B A; 2DEB A; 5T3E A; 1C4T A; 1T7O A; 2XR7 A; 2FY5 A; 1CIA A; 4EYW A; 2XHG A; 1L5A A; 2IHW A; 2I9D A; 3L60 A; 2ZBA A; 2FY4 A; 1SCZ A; 1EAB A; 1Q6X A; 3CLA A; 1EAA A; 1QCA A; 2CLA A; 2E1T A; 1XL8 A; 4KEC A; 2II5 A; 1EAC A; 1NDF A; 4EP9 A; 5DU9 A; 1Q23 A; 4EPH A; 4JN3 A; 3MAE A; 5FAL A; 1T1U A; 1E2O A; 1XMD A; 1EAF A; 2E1V A; 1T7Q A; 1NOC B; 1XMC A; 2FYO A; 4KE4 A; 2RCU A; 2H3W A; 5KJS A; 1CLA A; 1NDB A; 3B2S A; 2JGP A; 4G2M A; 5KJW A; 1DPD A; 2BGH A; 3FOT A; 2E1U A; 3U9B A; 2II3 A; 4N72 A; 1Q9J A; 5KJV A; 5KJT A; 2RKT A; 3B30 A; 4HVM A; 1DPB A; #chains in the Genus database with same CATH homology 4CLA A; 1XL7 A; 3CLA A; 1EAA A; 1QCA A; 2CLA A; 2E1T A; 1XL8 A; 5KJT A; 2VSQ A; 4KEC A; 3B2S A; 2JGP A; 2II5 A; 1EAC A; 1PD5 A; 4G0B A; 4G2M A; 5KJW A; 5FAN A; 1DPD A; 5T3E A; 1C4T A; 2BGH A; 2XR7 A; 4G22 A; 3FP0 A; 5DU9 A; 3FOT A; 1Q23 A; 2E1U A; 4JN3 A; 3MAE A; 1EAD A; 3U9F A; 3U9B A; 1CIA A; 5FAL A; 2II3 A; 4N72 A; 1DPC A; 2II4 A; 2RKV A; 5KJU A; 1Q9J A; 1E2O A; 1XMD A; 5KJV A; 1EAF A; 2E1V A; 2XHG A; 1NOC B; 2RKT A; 1L5A A; 1XMC A; 3B30 A; 2IHW A; 5DUA A; 2I9D A; 3L60 A; 2ZBA A; 1SCZ A; 1EAE A; 4JN5 A; 4KE4 A; 1EAB A; 5KJS A; 4HVM A; 1DPB A; 1CLA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
