2ZEJA

Structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
177
structure length
157
Chain Sequence
MKLMIVGNTGSGKTTLLQQLMKTVGIDVKDWPILVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat kinase 2
publication title Structure of the ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric GTPase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 157
sequence length 177
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08477 Roc Ras of Complex, Roc, domain of DAPkinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ROC domain from the Parkinson's disease-associated leucine-rich repeat kinase 2 2zejA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2zejA02
1G8HA 1A82A 1OKKD 2X77A 5BW8A 5IK2D 1UBFA 4CEHA 1UADA 2JIZD 1ZUNB 3B6EA 4G0NA 2AKYA 3PUXA 3ZVNA 5F2EA 3SS8A 1J8YF 5KUTA 4WXPA 2REXB 2J87A 1PVOA 2QTVB 1XTQA 2KBFA 4A9AA 3SE0A 4TYWA 4PX9A 4YC7A 4B2PA 5AJYA 2O8FA 3ZYCA 3AVUA 1MABB 1VYVA 2WWGA 3GCGA 4LC1A 4WXRA 2D74A 3VU9B 1FQJA 4L16A 1GRRA 2C98A 1XPRA 1G5TA 3RSLA 4GL2A 2IUUA 2DPXA 4Q7MB 1NBMD 4JYBA 4DSOA 3I32A 5KPDA 3C14C 1ONBA 2C77A 1Z6YA 2BC9A 4M8NE 4URVR 3AVVA 2YWFA 4V0ME 2IA5A 1GVNB 3FMOB 4DZZA 3LH5A 4CEJB 1P73A 4B3BA 1VMAA 1KGDA 5E95A 3T5DA 4D4JA 3A8TA 3FHTA 1WB9A 1H8ED 2Z0MA 1GL6A 1XD2B 1KK1A 4JLBA 3FWYA 4PSKA 3DVLA 4TN1A 3KJIA 4K8OA 1VKJA 3L2OB 4DCUA 5KTYA 2OLJA 4A0HA 1DE0A 4ITRC 1XEWY 2JIZA 1TF7A 221PA 4D0NA 5JJKA 3B1YA 4MGZR 4P32A 2QNRA 2YWGA 4ZI2A 2QT0A 1NVVR 3KFVA 1IN7A 1S2MA 4R98A 1TNDA 4G5OA 5EQTA 2VP2A 2FPKA 1NI3A 2JDIA 2O8CA 1K6MA 1Q57A 4ZCIA 1X3SA 2IS1A 2RB4A 3AVWA 1NSTA 2ZJYA 1UM8A 2ZREA 1Z0FA 1CJKC 1I4DD 2FJUA 3CH5A 4Y0VA 4YLGA 2RMKA 4NBSA 2GAOA 3L82B 1T3LA 5FBWB 3KQLA 3H1TA 1EX7A 3KKMA 2ZRLA 4W5WA 2RAPA 3C5CA 3TUZC 4X8LA 1CIPA 3LVQE 5FTKA 3U3RA 2ZSAA 3CM0A 4BEJA 4JYCA 2HYIC 1L7VC 4GZMA 4B2IA 3CR8A 3A6PC 4U5XA 5A0FA 4JLKA 1KKMA 3SJZA 4Z1MD 3SEAA 2IUTA 4BFSA 4KLNA 2V54A 2PMDA 5CDFA 3KTAA 2WJYA 5LD2C 8OHMA 2R2AA 3NBYC 3AB3A 2FGJA 3AV0B 1XJCA 4JLNA 4OYHA 4KFTA 4JBYA 4JLDA 4F4IA 1G8YA 3PFIA 2MMGA 1T0JB 4LX0A 2JAQA 4EFNA 2A3RA 2C04A 4PC3A 1G8GA 3C5HA 2BWJA 3QXCA 2IYLD 4IXNA 3KTAB 4M4SA 3LV8A 1G9XA 2OCPA 4U02A 2B6HA 2FN4A 2OCYC 4IEIA 5LBIA 2HJVA 4CT4B 2OFWA 5P21A 3FOZA 2VP5A 5H1YA 1ZP6A 4Q4HB 1XP8A 2BBOA 1QRAA 4M1KA 5LB4A 1UKEA 1I4LD 4W9MC 2BDTA 3K09A 3CRMA 1S0UA 4ZIRA 1NSFA 3BWDD 3GLHB 3I5XA 4RKFA 2J7PA 1XTSA 2J7KA 1A4RA 4IW3B 4AG6A 5KHOC 3PUVA 1ZVQA 3LWNA 1XDBA 2VYFA 3SBDA 3Q8XB 5F9HA 3IEVA 1KHTA 4HAXA 5IF9A 1NLFA 1BH2A 2HCJB 4TSFA 2FSGA 1FP6A 2J0UA 2F55A 3I62A 4V0OA 1CU1A 4WBSA 1FNNA 2W6IA 1YQTA 4A8JB 4PC7A 3D3QA 2O8BB 2QAJA 2D2EA 4RCZA 2DFLA 3RRNA 5JBQA 1Z0DA 4PC2A 1OPXA 2XGJA 1AGPA 2KE5A 2OXCA 4O2RA 1S3SA 2NO9A 2QM8A 2H8KA 1VIAA 2ZUBA 3EPLA 5TY0A 2BMDA 2JCSA 2ZTSA 3MWKA 3REFA 1QZXA 3LBNA 2GVDC 4TQ9A 2WIAA 2ZR9A 1MO6A 5HCNA 3P1JA 2FSFA 2O8CB 4C7OB 2RGGA 2ZIAA 2OILA 5DISB 3VAAA 4QBGB 3I73A 4XSGA 3OHMA 4BZXA 1PLLA 1HV8A 2H16A 5K8IA 2LCFA 4LJ8A 4N0EA 3QF4B 2O0HA 2CLCX 2XX3A 4B75A 1XZPA 2NOAA 3EWAA 5HCIA 5TV2A 1BS1A 4Q7JB 1OHHD 2Z4RA 3FFBA 1YRBA 1AN0A 4Q7LA 4NCJA 4UJ5A 5DLQC 4EQ6B 3K0SA 3ZQ6A 1HTWA 2G3YA 3KKNA 4TWZA 4YXWD 2OBNA 4Q5IA 3AGPA 3QOFA 2H57A 4DUGD 2IYTA 4GDFA 3PUWA 2IYZA 2WJJA 1S1MA 3X2SA 2GCPA 2FDCA 1DARA 1G7CA 1NY6A 4ASUA 4BFVA 4BZPA 4A2WA 3CPEA 1T6NA 4QBIA 3PEVA 4LHYA 2BJWA 4US2R 4JMPA 1ZIPA 4QGAA 1G21E 3Q85A 1N5LA 3CW2A 1IBRA 4Q66C 1COWD 3EPHA 1WQ1R 3RLFA 5C18A 4Z54A 1VHLA 1CR1A 5AJWA 1KYIA 3QBTA 1W7AA 1TX4B 2CLSA 4HAWA 3D8BA 3HWSA 3BIFA 3MG9A 3I8SA 1Z06A 2D7DA 3DM5A 2ZJAA 4RZ3A 4FMDF 3DKPA 2ZPTX 3TQCA 2R8RA 2CJWA 2EVWX 4WOPA 1G3RA 1XX6A 1MR3F 5IDVA 2CL0X 4EJSB 2O8EB 1KMQA 3WXMA 1LTQA 2YWHA 1KI1A 2F6RA 2ZI3A 1XCGB 4Q9HA 2X2FA 2PBRA 3TIFA 4KVAA 2PZEA 1NKSA 3ASYA 2BMEA 4LY6A 5EE5B 2ORIA 4EPVA 1YJ5A 2IYUA 1Z0IA 3PENA 3QI2A 5C1BA 2OFXA 3V9PA 4XWOA 4PC1A 2IX3A 1U0LA 2IF0A 1E2QA 1ZC3A 1XJ0A 1KKLA 3FHOA 4HZUA 4Z51A 2IXGA 3RDPA 2ZM5A 1G4UR 1FNMA 4IVRA 4H1VA 4OK5A 3ZGXA 3BFXA 2GZAA 3J81k 1A2KC 1TU4A 5C4GB 2Q3MA 4FN5A 4WZ6A 3GLHA 2OV2A 4X8MA 1P72A 1DAKA 2JDID 1D2MA 1E99A 1ZBDA 2CHGA 2VF8A 1E4VA 4BASA 2G88A 3ZIAD 4MRPA 2AWNA 1E0JA 1HT2E 3K0CA 2ZITA 3HJNA 1AQUA 2W2VA 3RYTC 5B58C 1H65A 3CR7A 5CYOA 3AP1A 1OB2A 4A36A 4LI0A 2ORVA 1TF2A 1E0AA 5BN4A 5L3QB 4XVUA 2REOA 2ZUCA 3QG5A 4C2TA 2NO7A 2VP0A 2DWPA 4PAMA 4RY2A 3ZJYA 4ERNA 4PTLA 4C0AC 1IXSB 2DCUA 3D6TB 3HU2A 3EZ9A 4I1OA 4JVNA 2PL3A 2QP3A 3RWOA 5EE9A 3IIKA 4OHXA 4IDPA 1DTSA 2VSFA 4II7A 4JBXA 4L5BA 2WOJA 3SJAA 2IS6A 1E2DA 1E2NA 1JJVA 2WKPA 3GP8A 5B64A 2OCAA 4HAVA 3ICEA 2P5TB 2VLIA 4TMWA 2AN9A 3AVXA 3E1SA 4A0GA 3ETLA 3VX3A 2PT5A 1W47A 1DAHA 4P4SB 3T35A 3QKRB 1Y3AA 1DAMA 1C1YA 3BH7A 5HR5A 1N2CE 4B3GA 2NPIA 1YR6A 4KJZA 2A5YB 3OFND 3QY0A 2G77B 2G9NA 3EC2A 2YKGA 3AF4A 1D9XA 4F93B 1W4RA 4LPSA 2V6JA 3N2EA 3TSOA 4LV6A 1GITA 3TAUA 3OIYA 3ZIAA 1JPJA 3PEWA 1QHHB 3EIQA 4LJ7A 4CEJA 3OESA 4Q1BA 1F60A 3EARA 1XD8A 1ODFA 3G0HA 4LJAA 5EXTA 4DDTA 1OYWA 3AKEA 4PSAA 5FL7D 3Q5DA 4M21A 1EFRD 3A1TA 2ZANA 3IQXA 3EPKA 2DY1A 2FMXA 4JSYA 3T1QA 4L4UA 2ZI6A 1EX6A 2EFHB 2FF7A 1DVRA 3E70C 3VR1A 3TK1A 2XNDA 4RD3A 2BKUA 2PJZA 1ETUA 4AURA 4PQFA 4CEHB 4BECA 1F2TB 4PZYA 3NBZC 3MLEA 4HLDA 4P31A 1N6OA 2PCJA 1E2IA 1R8QA 1XNJA 3KJGA 2I1VB 2IWRA 1HT1E 4TL6A 4NYIQ 1BOFA 4PAOA 2ZEJA 4HI0E 1N6IA 3VR5A 3MGCA 1A1VA 1E9BA 4CEIB 2AD1A 2Q9BA 2QI9C 3U3KA 4UXJA 5JJIA 1FX0B 2Z43A 4IOKA 4MUAA 2EFEB 5JFGA 1F48A 5J4LA 2QBYA 1DAFA 1FL9A 1KDTA 2CE2X 4OHZA 2QTHA 3UMFA 2VO1A 1AS3A 3FB4A 5J5CA 3ZVLA 4CIDA 3Q72A 5CLLA 4LRWA 2ZS7A 4OQNA 4M2LA 2GF9A 3T61A 4O25A 1KI7A 4Q03A 4A2QA 1KJZA 3L0SA 3T5GA 3CWQA 5FPTA 1E4YA 2H92A 4GT1A 3DDCA 5DE3A 2F9MA 2IBMA 3I72A 4WW0A 3RS3A 4IOLA 4OK3A 2GCOB 3B5JA 2D62A 1E79A 3QBVA 4PZZA 2CNWD 2RGBA 4HLUA 2WAXA 3MUFA 4RVCA 3R8FA 3GJ6A 5LPNA 2HJGA 2NQ2C 4QJ3A 1OHHA 2EFDB 4M1OA 1QDEA 1SXJB 2A5JA 2OAP1 2R44A 4MA4A 4QBHA 4XOIA 4QKQA 2FGKA 3H2YA 1W36C 1UKZA 3S1AA 2VQSA 3K70C 2QSYA 2JLQA 4DSUA 4JVMA 5CB6A 2QRNA 3T15A 1CEEA 2DFNA 2EU8A 2GTPA 3UMRA 4FCTA 3RRMA 3CKLA 3VU9A 2FEMA 1RYHA 5SZKB 2ERYA 1OH6A 4LUCA 1H8HA 3GLIE 4NKRA 1E32A 4D4KA 4M9QA 2BBWA 1YE8A 4MUBA 1JECA 3BRWD 5KO2A 1QHIA 4LJ4A 2D3WA 2GJ8A 3TNFA 1IOZA 4F91B 2VHJA 2LWIA 2PCLA 4HUTA 1N5IA 3RHFA 2GBLC 2ZRKA 5FUVA 1W1WA 5FTJA 2P2LA 1T8UA 3KUCA 4Q1FA 3BFKA 1SVOA 4D6PA 1XMJA 1F3OA 1YR8A 1E1QA 2BOVA 2IC5A 3TSWA 2XJ9A 2BIFA 4QM7A 2CNWA 4OHVA 3TKLA 2ZRDA 5BN5A 3TW8B 5L3SB 4BQSA 4TL9A 4KSBA 4PPGA 4L8GA 3UATA 1NVXQ 4BLOA 1E69A 2JATA 3K9GA 2ZI9A 3SR0A 2WWWA 5JHHB 2QSZA 2WKQA 4TQUS 5AUQA 4OI1A 1W4BA 3NH6A 1FQKA 3QNUA 4RFSA 2ZE7A 4MKIA 2ZJOA 2JJ1A 3LLMA 4PXAA 2WM9B 3I8XA 1GTVA 4DLRA 1MABA 4P3YA 1ZD8A 1R0WA 2OBLA 1M74A 3IPXA 4IFBA 3SOPA 3VX4A 5BYKA 2YYZA 4G5QA 1IN4A 1XD9A 3HU3A 4OL0A 4JLOA 4ZI3A 2BCJQ 4NYMQ 5JECA 2GXAA 4B43A 2V8OA 3GLIB 3NVAA 3THOA 2ZR0A 3NKVA 1WCV1 1VCNA 2P67A 4Q7KA 3U7GA 3ZD6A 4DIEA 3EZ2A 1W2GA 1WF3A 4AKGA 1EFTA 2W58A 2UZ3A 4IEEA 4RZ2A 1P62B 5J40A 1XTRA 2FPLA 3HYTA 4PHGA 5FOSA 1UEJA 1KI6A 4HDQB 1I2DA 1MOZA 4QHTA 5KDDA 2C9CA 4RD1A 4DLSA 4EFMA 1ZRHA 2C9YA 4QC2A 1JR3D 3IDQA 4LBZA 2WWXA 3KQNA 4GP7A 3CX8A 4JVSB 1XJQA 1OXSC 1QVRA 2RHMA 3T06B 2IWHA 4EPWA 4OK6A 2VEDA 3V4RA 4LV8B 3NIBA 1G7TA 1B0UA 1AZTA 2BCGY 3RC8A 4PHFA 2PX3A 2GWHA 4RSGA 1U8ZA 5CLQA 2IYQA 1D9ZA 4NCHA 5FOWA 1N5JA 3Q7QA 4ACAA 3TR5A 1FMJA 1IY0A 1KK2A 2AX4A 1YZQA 2PLFA 4MYUA 4ASUD 2IUSA 1SZPA 3LXRA 4MITA 4BPBA 1LS1A 3E2IA 1HURA 3AVOA 1KTVA 1U0JA 1DAIA 1GG2A 3AF2A 2NO0A 3L8ZA 2EWVA 3GJ0A 3I4LA 1IY2A 1T3HA 2GJSA 5D3MB 4LHWA 5KSYA 1EWRA 4MH0R 4DB2A 1NL3A 3CRRA 2YVUA 4HYYA 4TTRA 2B21A 3C8UA 3CONA 1JBKA 1CJMA 2D06A 2FNAA 3T1OA 5FPKA 1OFHA 2SHKA 1WRBA 2IF2A 4KCGA 4UJ3A 1VG8A 3BGWA 1XRJA 2J0QA 2BJVA 3CF0A 1VG0B 1TADA 3HDTA 5JWOA 5JWRA 2AKAB 1EGAA 4Q21A 4LHXA 3DKVA 721PA 2B7CA 3BOSA 4GP6A 4D26A 4KFRA 2WWFA 1TL7C 3ZQJA 1IY1A 1P75A 3DEFA 1FW6A 3IUYA 2I4IA 2HUPA 4TLAA 4Q4LA 2CEAA 3K9HA 1JR6A 3W8RA 1UFQA 2A30A 1YVDA 4NYJR 4IOMA 4PANA 2V3CC 1L4YA 1AQYA 2P6UA 3VR2A 2FZLA 1E2FA 1BO6A 3AKDA 4PO1A 2C5LA 3LBIA 1ZM3A 1FTNA 4BFYA 4JT2A 1ZM2A 4M9SA 1CS4C 3PITA 2IS2A 2Z5FA 2ZS9A 2NO1A 3KKOA 1OLOA 2WBLC 1N0VC 5FI1B 4CT5A 2QAGA 3H0KA 1M1YE 1AA9A 2P0EA 3ONWA 1J7KA 1XZQA 2QPAA 3B7GA 1S1CA 1SVSA 1DEKA 1G1MA 4PQYA 4G3XA 2DWOA 4C30A 3K0AB 4C0HA 1KO5A 2GJAA 3C41J 2ZE8A 5CIQA 1RC8A 2CMKA 4DIDA 3UANA 2AFIE 1CRPA 4LJ6A 1XTJA 1ZINA 5L8VA 1AGRA 1K5GA 2ZI7A 3BJIC 4MRSA 1HUQA 1HQYE 2J7PD 2Q3HA 2PJRA 1KDOA 1G7SA 1Q22A 4P4TA 3UMSA 1QBKC 2RCNA 1U90A 5BQ5A 4O2LA 3R9WA 4UXHA 3U5ZB 4Q1CA 1II9A 5GJVC 1RW4A 5L3RA 1F2UB 1KJWA 1S9HA 4JLVA 3OZXA 4NHOA 1XEWX 2FPMA 5EJEA 1U8AA 2OFOA 1A2BA 4LBYA 4CGZA 3D7MA 1XBTA 1HYQA 3H86A 1ZCAA 1SKYB 2BM1A 2Q21A 4M9ZA 5K8TA 1W0JD 4Q9LA 3Q7PA 4F92B 3CPHA 5CK4A 3SQWA 1YZUA 4RFVA 5LB2A 4AY2A 3WNCA 2MSCB 4Q4JB 1H8HD 3CX6A 3OFNA 1BMFA 4B47A 3FPAA 3KQHA 3EAQA 4MRRA 1OFUX 3W5IA 1TPZA 3EZFA 1XEXB 2CK3D 2ZU6A 2JLVA 4URZR 1LV7A 1ZM9A 1P60A 3OF5A 2ZRCA 1U94A 2OE2A 3OE7D 1R0YA 3QVUA 4WZAE 4DWJA 3K8YA 1S4QA 2R6CA 4B3FX 4A15A 2OG2A 4TYYA 1CJTC 3W6PA 5F3WB 2F9LA 1KAGA 2EW1A 2FFAA 3LD9A 5FL7A 5BXQC 4HUQA 1Z6TA 4Q01A 1EFRA 2VP9A 4JVLA 4LJ9A 1E1QD 2C9OA 1P2TA 1Q21A 4RD4A 3VHXA 1JQLB 3B82A 1J90A 1KI4A 2ZQ5A 3FMPB 3VR4A 2OZEA 3CWZA 1QG4A 2WWHA 2YHSA 1FPMA 4M1WA 3TE6A 4BFUA 5KSOA 2GCNA 4OQLA 2F3RA 1OF1A 5FBRB 3RNLA 3ZZ0A 4JJZA 1KAOA 2ATVA 4M1SA 1KO7A 2D7CA 3WNDA 1JXOA 1W5TA 1BYIA 2P6NA 3FMFA 1W36B 1OSNA 4B71A 1X8KA 2V9PA 3EIEA 4PHTA 4X8OA 2KWIA 2J1LA 3SFVA 1I2MA 4DT1A 3AP2A 2OAQ1 2Q9AA 1IAQA 4B3DA 4KBFA 3ZS9A 1KIMA 5CYPA 4BLRA 5JS7A 1JXMA 1E96A 2B8WA 3MWLA 2OXRA 3A36A 4NU0A 4Q9JA 2NTYC 4QGHA 2QM7A 2RGNA 3BFVA 1GL9B 1SXJE 1CLUA 2ZRNA 3KQUA 1W4AA 4PR0A 4GZLA 1OB5A 5JEEA 2A2ZA 3OE7A 2JLYA 1NG9A 3KB2A 3BH0A 3QXJA 3GJ5A 4V0LA 1TEXA 4LGMA 3DZ8A 3K0CC 3W90A 1S3GA 3GJ4A 4GNKA 4CVNA 4HAZA 1UAAA 3NEJA 1WXQA 3NWJA 2G1JA 3U7HB 4AI6A 3LNCA 1E9FA 1E79D 3DPUA 1YKSA 3WBKA 1UEIA 2ZJZA 1D6JA 4BLPA 4DRZA 3GFOA 1G5RA 1YHNA 3IBYA 3FHCB 421PA 3R7WA 2ZSFA 3HPQA 4FMDB 4DCNA 3FKQA 1J8MF 5L3QA 2FSHA 5DHAA 2XTZA 4W5HA 4KYIB 2EFCB 3A1VA 1SULA 3AVPA 3CBQA 2BBTA 3F0TA 2IYXA 3LRPA 4OI2A 3TUJC 2WPDD 1E0SA 5EZ6B 4XVRA 1JEEA 1KSJA 1JAIA 3RSOA 2QENA 3ZVMA 1O3YA 1QHHA 1R5NA 4FMBB 3GEEA 2QE7D 5HZHA 3W3AA 3DL0A 3W6NA 1NN0A 4KHZA 3GLGB 1J70A 2IYRA 1E9CA 2P65A 4B2LA 2HT1A 4YDSA 1OIWA 1GM5A 2OT3B 2A5DA 3QF4A 1ANKA 1FOEB 1RRGA 3HR7A 4R7ZA 4C9BA 4TYNA 1G3IA 1WA5A 5AR1A 1YZNA 3W8NA 1ZD9A 3A37A 3K09C 3EPJA 1T9HA 1LNZA 2AXPA 5B2ZA 2FH5B 4GSYA 5FI0B 1IJFA 2A5FA 1N0UA 2ZJ2A 4QHYA 1IN8A 4YMTA 3AF3A 4TYQA 1MO3A 3UG7A 4FCWA 5HZKA 3KUDA 4MGKR 1B23P 1FMLA 1AS0A 2EFGA 2ODBA 4D25A 5K8UA 1JB1A 1OXTA 4I1SA 3WHLA 2R6DA 2IL1A 3RS4A 4MRNA 1JI0A 3BAFA 1OJLA 4PPFA 2G0TA 2W6JD 5FBQB 4JLPA 3V00A 3QQ5A 3OAAA 2D2FA 5HE8A 3W3ZB 2AL7A 1XWIA 3KFXA 4DVGA 4ZV4A 1XEXA 2QN6A 4NYJQ 4P4SA 5EP3A 2J0UB 2NZ8A 2VP6A 4Z8XA 4NZYA 1II8A 1P6XA 1OV4A 4I4LA 1W46A 1R8SA 1V5WA 2CCJA 5GADl 4OJKA 4PSVA 1P61B 2IXFA 3SJCA 1E9EA 4ARZB 2JJ1D 4FWTA 3IBGA 1N6PA 3LW8A 3OEHD 3N2IA 1XB2A 4A0RA 1U81A 2WVJA 1GKIA 4QL3A 4DCSA 3GMTA 3K70B 4TT3A 1PJRA 1SXJA 4FXPA 2ZXUA 1KK0A 5DNYB 1SKYE 5LDDC 4B32A 3I1FA 1E2JA 3A4MA 2CJWB 4H9GA 1G3MA 1SKQA 1R10A 3F8TA 1WBBA 4KODA 4NDZA 1E2MA 2VTKA 2QRZA 4QFMA 4CDGA 1JR3A 2RGAA 3AEZA 3B9QA 3IQWA 1ZNYA 3PIRA 2HDNB 2IHBA 1EFUA 5E4FA 3W9YA 4DHEA 2VL7A 4MKHA 5DO9A 1P9RA 1XTKA 2XEXA 3SC3A 1OXVA 3U7EB 3FGNA 4QG7A 4FMCF 2HLDD 4ACBA 3TBKA 1U9IC 3VR6A 2PLRA 3OIUA 4U00A 5CM9C 2B92A 4OBEA 3B9PA 5DIFA 3KXLA 2ZETA 1K5DA 2W83A 1X1RA 2ATXA 3LQQA 4LV5B 2ZI4A 3RRZA 4DJTA 1J99A 1GRNA 4UXIA 2WMOB 4POAA 5FL3A 4W5JA 4AC9A 4IVPA 4R2HA 3OEHA 3VFDA 5J4KA 1GL7A 1G3QA 1CULC 1KY3A 2CK3A 2WJGA 5FPSA 2PX0A 3QUSA 2N42A 4LBWA 4NL4H 3WRXC 4ZIRB 2WAYA 1KO8A 3SDZA 2O8DB 5EE3A 5CK5A 1YR7A 4ZCMA 3EWSA 3PXGA 1Q0UA 2GZHA 2QP9X 4KFSA 2VF7A 3G82C 2NMVA 3FVQA 1JJ7A 1Z3IX 2ZE5A 2ZYUX 5DI3A 4HZUB 3QE0A 3QKSA 5JI3E 3NDPA 5EP2A 2H7VA 1CTQA 4L9WA 3CRW1 4RFSB 1JEDA 2FE4A 1G17A 4XVQA 4C2UA 4M0LA 1Z2CA 3K9LA 2QL6A 2NZJA 3CNOA 4JT4A 1Z2AA 3GEHA 1MV5A 3DO6A 4NPHA 4E07A 3Q9LA 1QG2A 1E1RA 2A78A 2IT1A 4GRAA 3B1ZA 3QVVA 1PUJA 1R0XA 1HA3A 4B3XA 3CX7A 1EESA 2NGRA 4QRHA 5FPYA 4N3NA 4HDCA 1TQ6A 4Y0AA 3BB4A 4HZIA 1NIPA 1T5IA 1G4AE 1W44A 2IEZA 3T1VA 3ADDA 3QXHA 2FOLA 3HU1A 4BZQA 1N6KA 3MRSA 2UVQA 1GNRA 3X1DA 3O8CA 5DYGA 4GI7A 3H84A 1IQPA 1OW3B 4Q48A 5K8LA 1VIYA 4QNRA 3AGQA 1US8A 4K46A 3P4YA 4KU4A 1F2TA 4A8JC 4ESVA 1X6VA 4BWYA 3VKGA 4DBLC 3U3MA 4RJLA 4OI0A 2XITA 1ZW6A 4A8JA 1G16A 2JASA 1KJYA 3BBPA 4G5RA 5KU1A 1WP9A 4BEBA 4DLZA 1TU3A 4UQOA 2Z4SA 1G19A 1KSFX 4PPNA 1XXHE 1D8TA 3I92A 5GVSA 5CM8B 3L0PA 3QG1A 1XCPA 5HPYB 1JR3E 1N3BA 3K9NA 3KKPA 3I61A 4NYMR 1X8LA 2GJ9A 2HCBA 5EE1A 4XTRA 4ON9A 1N6HA 3Q5EA 1G3UA 1UKVY 4O3MA 2RGEA 5KSZA 5JHGB 1SHKA 4JBWA 4C3ZA 1IJEA 3GJ7A 1GNQA 1US8B 3O8DA 1N0WA 2ONJA 4F4JA 3TRFA 4M1TA 1YZTA 2PEZA 1GUAA 3FYHA 2ZSDA 3N70A 4HB4A 1G64A 1AZSC 2HYDA 1GKYA 3OIWA 2RGDA 4MGIR 4CRWB 2YWEA 2BEJA 3C15C 4I1VA 2GK7A 3QSYA 1CF4A 1X86B 1Z22A 2JGNA 4UNRA 2W0SA 3CRQA 2ZRBA 3VNVA 1KNQA 5KOYA 2IK8A 3IILA 821PA 1N6LA 2OCBA 3LDAA 3NG1A 4DEYA 3P26A 4IRUB 3DOEA 4JKIA 4B33A 4A4DA 3U44A 1NVUQ 1ZU4A 4Q47A 2W00A 1Z0AA 3IO3A 1GZSA 2KBEA 4HATA 2IYWA 4TYPA 1W0KA 2BV3A 3WHKA 4A92A 3ZDQA 1GWNA 1DELA 4JJKA 3T34A 1IONA 3ZZUA 3LX5A 2XXAA 4RD2A 5JSZA 1SVIA 2QMEA 4LJYA 2NIPA 5C46F 3GLFB 4DEXA 3RANA 1SVKA 1W49A 4X8HA 5G41A 5JCPA 1TQDA 1Z08A 5G53C 1TUEA 2WMNB 1FFHA 1N5KA 2GILA 4C4PA 1MO5A 5KYKA 3OAAD 1GIAA 5JLJA 4FW9A 1VG9B 3K0EA 3V4FA 3U44B 1P5ZB 1E6CA 2H5EA 3OIVA 4LYAA 1RVDA 4B74A 4C7OA 2OEPA 1M8PA 1N6RA 2B8TA 2DFTA 5EE0A 4C0LA 1ZNXA 3AKCA 2O0JA 1UDWA 3JZAA 3NC0C 3C7KA 2WSSA 2HXSA 4BFTA 4BLSA 1J2JA 2IW3A 3P4XA 1HH4A 1KNXA 1XMSA 2H1LA 3VHLB 4KV9A 1AKEA 2CXXA 2ECKA 2YOGA 5JSZB 4I1UA 1KK3A 4RZXA 2WV9A 5CIWA 4JLMA 3EC1A 3LBHA 4QM6A 1W0KD 4KXFB 2IS4A 1AM4D 2MSDB 3PEUA 3PUYA 3CF2A 4HLCA 4BLQA 1HEIA 1QHSA 4TMXA 1GAJA 1Q20A 3CPJB 2V4ZA 3QKTA 1T91A 1XD2A 1RRFA 4IFEA 3SFZA 3UXMA 4EIWA 4IDHA 1ELOA 5FBVB 1TQ4A 2I3BA 3PUZA 4BGDA 1RJ9B 2ZI5A 5JI2E 3ADBA 1N6NA 4J0QA 1JPNA 1LVGA 4TLCA 5FFMA 2A5GA 1G291 2JA1A 4GPTA 2VSOA 1OH8A 1Q1ZA 4XIGS 1E9DA 5EUMA 1VDZA 1E2HA 4S2EA 3MD0A 3U3OA 5DI3B 1XXHA 4DSTA 1IHUA 3MCAA 4EFLA 3R9XA 4DLUA 2HLDA 3ADKA 4TMVA 3WNBA 2CLDX 4P33A 2CCGA 4V0NA 2X1VA 4DKXA 3ADCA 2PEYA 1CP2A 4TMKA 1RIFA 3HR8A 4LWZA 2QE7A 2I1QA 4TLEA 1ZM4A 1MT0A 1N25A 3GLGE 1ZC4A 3TMKA 4LPKA 5J47A 1Z6AA 2IEYA 2P5SA 1ZNZA 2OLKA 3WP1B 2O8FB 1X1SA 3AM1A 4I81A 3PV0A 4MQBA 1OIXA 4L15A 4TL7A 1UBGA 2J0VA 2TMKA 4YONB 3CNLA 4DC9A 1FUUA 4Q9IA 1ZIOA 1VCMA 2O8DA 2KB0A 2F7SA 3WMGA 1OXUA 2VHQA 5CB8A 5EUQB 3LX8A 4D4MA 3WMEA 4PZLA 1QHXA 4AYWA 1M7BA 3CH4B 2XZPA 1UBCA 2CVFA 1NLZA 1PZNA 1T5LA 2PT7A 5GJBA 1ZCBA 3B78A 2GEDA 2FFQA 3EA5A 4ARZA 2J59A 3A1UA 1EK0A 4NCIA 5GVRA 4MGYR 3QJYA 5FUYA 4M1MA 3UKDA 2XTNA 2ZJ8A 2FWRA 2JLXA 3PQCA 5LD2B 1NMXA 2N46A 2QMHA 2NG1A 4ZDIA 4YMSA 3RWMB 3AVTA 2IYYA 2MSEB 3KJHA 1G5PA 1U9IA 4Q02A 4MKGA 4BFZA 3W34A 4HLQB 1FTSA 1NVWQ 1W0JA 2F43A 2VHUA 3AUXA 5FR2A 1KSGA 3QXXA 2JEOA 3R9IA 3EZ7A 1UDXA 3VKHA 2XZOA 2XOKD 4V02A 1BMFD 3RC3A 4JSTA 1RFLA 1S96A 1UBEA 2CL6X 4TT3D 1SXJD 4TTQA 3KXIA 3LLUA 4YMWA 3GJXC 3BD9A 4GOJA 3R7WB 2FU5C 1Y63A 1ZJ6A 4TMZA 4C0QC 3THXB 3CUEF 4B44A 3CNNA 5KDLA 1SXJC 2AR7A 2YC4C 4HAYA 4EUNA 1TTTA 1IN5A 4LZZA 2ZR7A 1OE0A 2JLWA 1XTIA 3L0OA 4Q4AB 2GHIA 3FTQA 4US1R 5FOVA 2BMFA 1W48A 2YNMA 2FG5A 2QQ0A 1OXXK 2GETA 5JEDA 3H4MA 5E7JA 1PUIA 2DWQA 2JLSA 1MKYA 1GNPA 2VPPA 2W0MA 3O47A 1SVLA 1VHTA 4JKYA 3X1YA 1GOTA 3QKUA 4AWXA 3BERA 4G1UC 4OQMA 4BRWA 3K1JA 4DLWA 3JZMA 4URWR 2N1BA 3BS4A 2GVZC 3NXSA 4DDVA 4U7DA 4RD0A 4V0KA 1W5SA 2E9SA 2Y8EA 4MYCA 4QOSA 2C95A 1CJVC 2UKDA 2WZQA 4G5SA 3FKSD 4BE7B 2GDJA 4HLUC 3P20A 1KSHA 4IDNA 4Q18A 5G40A 3WMFA 2ZVPX 4NCNA 3IGFA 1EG7A 4FIDA 3SHWA 3LQRA 4Q4HA 4DLXA 2J41A 2BMJA 5J4HA 1TAGA 3TH5A 3VNUA 4JL5A 1E2LA 1Q1EA 1EFHA 1DO2A 2AFHE 3SNHA 1UJ2A 4A6XA 4B34A 3B60A 4GBMA 5JMTA 3M1IA 4BFXA 2J3EA 3REGA 4EPRA 2CBZA 2F43B 4TL8A 3A58B 4NE2A 4D82A 1DADA 2V55B 4EJSC 3M6AA 3F5FA 1EWQA 1PLKA 4KYUA 1NJGA 4WZBE 2ODEA 2PZFA 3PEYA 2XZLA 3U6BA 2GRJA 1PV4A 4TLDA 1JNYA 1P4SA 3WYGA 4B76A 3KDSE 4DLVA 3RS7A 2BBSA 3A4NA 4NP6A 2FA9A 3B1XA 5BYJA 1IN6A 4Q1DA 3IKJA 1LF5A 1CR4A 3OEEA 1M2OB 1A7JA 2Q9CA 2ZRMA 3A1SA 3DZDA 4JZKA 4AD8A 1SQ5A 3IIMA 5CDFE 2WPDA 3N5CA 3SYLA 3F3YA 4GOXA 3VQTA 4B35A 1Z5ZA 3CLVA 1AJEA 1MRNA 1IM2A 1AS2A 3QKSB 4E09A 5KNDA 3KZ1E 5FH9A 4ZKEA 4S35A 4HDOB 3AQ4A 2FSIA 2KSQA 3GLFA 2DHRA 3VR3A 2D4HA 2ZAMA 4JL6A 2WWIA 4UNPA 4DDWA 3U2QA 4DT1B 5BN3A 5ELXA 1BKDR 4PPQA 2F1HA 4KO8A 1NNEA 2QG6A 1XMIA 3WP0A 3WYAA 2AWOA 3CB4A 1NG1A 2DR3A 2ZYVX 3RS0A 2Z6VA 1JAHA 2V1UA 3K0FA 4EAQA 4LHZA 1KO4A 2RKOA 2CHVA 2YZ2A 2IXEA 5FOTA 5IK2A 4QBFA 3VKWA 5AUOB 5H70A 4EKDA 3IIJA 2O0KA 3LO5A 4M1YA 3VMFA 4A82A 3ZVRA 4QGGA 2R6AA 4ZDJA 4RCYA 1KOFA 2FEOA 1E2EA 1R7RA 1II8B 2W6JA 3MJRA 121PA 4C0SA 1RE0A 1RRCA 3Q3JB 2REBA 1NN1A 2IYVA 2W2XA 1CR2A 3R20A 4EPXA 2ZJ5A 1D2NA 1OYYA 1G6HA 2QMUA 2Q3FA 3QENA 4UNSA 3UG6A 4QHSA 1CRQA 5JS8A 2C2HA 3O8RA 2X2EA 1ZNWA 1QHGA 1NBMA 3QPVA 1Z8FA 2AXNA 2BKEA 3SQXA 2O8BA 2OBMA 4Q00A 4XWKA 5TMPA 2F3TA 2VHCA 2G1KA 3B13B 5CITA 5DN6D 5JRZA 1PLJA 4MKFA 4BLTA 3QIAA 1LY1A 2ANCA 4UKDA 1DAEA 3PG5A 3KQKA 3PR1A 2ZRIA 2J5XA 2XJ4A 2ZRJA 3RS2A 1LF0A 5C4MA 1M34E 5EXSA 3A4LA 2QGNA 4HB0A 5FOXA 2WJHA 5FTLA 5HKKA 3I5YA 3AF1A 3SZRA 5TARA 4P4UA 3BB1A 3EG5A 1NN3A 2GF0A 4B3CA 1AK2A 4PO9A 2QY9A 2V6IA 3NHBA 4ABYA 1IXRC 2Q6TA 1MRSA 5EXPA 3U4QB 2ZSEA 3LFUA 1R5OA 3THWB 1KMHA 1O87A 1DS6A 2FV8A 2VH5R 1OIVA 2V1XA 3GQBA 1NRJB 4F7WA 1NIJA 4ESHA 1R0ZA 2L0XA 4LJ5A 3EA0A 2HXYA 4OHWA 4XSHA 4TZ0A 5SZJA 2YV5A 3FFAA 2F1RA 4IKEA 2WTUA 2KI5A 2XSZA 3AKYA 4CYMA 5A4JA 1Q1BA 5F98A 2ONKA 1WBDA 3QF7A 2J46A 4NYIR 4RZUA 3QEJA 2QGZA 4TZ6A 1OFTA 2ZE6A 3GLFE 2GZDA 3ZLJA 2OUKA 3KKQA 2HEIA 3KL4A 2YOFA 3VTKA 3NC1C 3BK7A 4HB2A 2DFKB 2X19A 4LYHA 5KNCA 4KI0A 3EZ6A 4W7SA 5FBLB 5TB5A 1E2KA 3L8YA 2ERXA 4KSCA 2WSSD 1GSIA 3WYFA 5UKDA 3AVYA 1TEVA 5GJCA 1A5TA 2VHTA 3GJ8A 2QU8A 2ZYTX 2GJKA 1G18A 1TF5A 1E94E 2EWWA 1TMKA 2QUZA 4KFUA 5HKKD 4URYR 4AKHA 4E22A 2ZS8A 3AP3A 4HUQB 5G3YA 4FINA 4I99A 2P3SA 3ICQB 3B2EA 3ECCA 1U98A 4Z1MA 4G5GA 2F1IA 4P0TA 3EASA 1TUIA 1JQJC 2OO7A 5AK0A 3KX2A 3AF0A 4LOAA 2AHOA 3SJBA 3GD7A 3KJEA 4GMDA 2V7QD 3NBFA 4FD2A 4LDJA 3P32A 4HSEA 3TLXA 4AKEA 2GBLA 4E03A 4IVQA 1L8QA 2XTMA 3QEOA 4IDOA 3MMPA 2WJVA 2XSZD 5FPHA 4F38A 5EXXA 3IEUA 4WAUA 3TW4A 3DMDA 4D4LA 1E1RD 3JVVA 1XF9A 1AKYA 2A7QA 3FDIA 4XTCS 3TVDA 4FCVA 3EXAA 3THWA 1KDPA 2QZ4A 2EQBA 1G7RA 4RD6A 1E2PA 2ZU0C 1MO4A 2HF8A 5IRCD 1R6BX 1VECA 2FX3A 5CJ2A 5JCZA 2Q0HA 3BORA 1SVWA 5EZ5A 2PZGA 1GRQA 4IOJA 3SYNA 4KLZA 3THYB 1HQCA 3CZPA 3NBXX 2ZRPA 3M0EA 4RKEA 5KSPA 1DOAA 4MDFA 3RS5A 2GAAA 5M04A 5DHFA 3ZS8A 4LBVA 1NBME 2LKCA 2GEUA 1EFCA 2DBYA 4FWIB 4L9SA 1SGWA 2NO6A 5BWMA 4TSFD 3BH6A 2LKDA 3LY5A 4ILEA 5E7MA 4DDUA 3PJRA 3TQFA 1F2UA 1FUKA 1P9WA 5FUXA 1L2TA 4V0MA 3C4JA 2X8AA 1XPUA 1E3MA 1Z63A 2PMKA 4NONA 4QXAA 3MWJA 4NH0A 4NCKA 2YJTD 4PAQA 2EYQA 1C4OA 4BFWA 4PHHA 2ZSBA 3U6KA 3EX7C 4PQRA 3HP1A 4V03A 3GLGA 2C03A 2QTFA 1YZGA 2WSMA 4WVFA 3X1ZA 4CW7A 4PC6A 1DAGA 1FP7A 1CXZA 1P2VA 3UK6A 2K5UA 3TR0A 3NH9A 1GKUB 1QVAA 1KI8A 2AK2A 5HE9A 4HB3A 2QEQA 3L0IB 4LCBA 2XB4A 1VG1A 3LXXA 1GFIA 2VRWA 3DOFA 1U0HC 5JWHA 4B73A 4US0R 1Q12A 5DSZA 3IHWA 2VIIA 4KITB 4FMCB 1Q3HA 1DBSA 1Z6XA 4M9XA 1ESNA 1OT3A 3ASZA 1NY5A 4HAUA 4LSGA 5TVKA 3DHWC 2GKSA 2RHDA 4GMXA 3ZD7A 1ZAKA 1UKYA 2B7BA 3A1WA 2F1JA 4PO8A 5IHPA 1DG1G 2ODNA 4EPYA 1YRAA 1T8TA 2VBCA 2JJ2D 1WDTA 3X1WA 3TAHA 2HT6A 2W2TA 2CDNA 4EPTA 4UNNA 5FUWA 4B6FA 3JVUA 3BE4A 3BB3A 1H8EA 4YXWA 3K0AA 1YZLA 4DUGA 4C0BA 1II0A 1K8RA 2JJ8A 1LW7A 1CBUA 4YMVA 2GCOA 3EW9A 3ZZTA 2ZUDA 3CF6R 4JLAA 1VCOA 2R65A 3FE2A 3WBJA 1E9RA 1NF3A 1G6OA 5JJLA 3SN6A 4CZ2A 3TUIC 2MMCA 2QORA 4NMMA 4WIAA 5D3QA 1G8FA 2BEKA 4OQXA 4EDHA 1CJUC 1U2RA 1COWA 2NPFA 5JZVA 3T1TA 3K0FB 5SZIA 5J4YA 1UF9A 3QPUA 1VCIA 1W4CA 3LW7A 2C78A 3TVTA 2ZRAA 3BC1A 4ZDKA 3T12A 4OJQA 1Z83A 2ASEA 4H1UA 2RH5A 1G41A 1NLYA 2OM2A 1UPTA 1OFIA 6Q21A 5KNBA 4Q9KA 4QGFA 4M22A 3U61B 2BM0A 2VSXA 3GEIA 4R2IA 3R8CA 3RRYA 3U3JA 2C99A 4AKIA 2O52A 4TMTA 3P27A 1E98A 4AK9A 3THYA 2JJ2A 1XPOA 4DLTA 2GXUA 1NMYA 3U60B 3TSZA 1LFDB 1D5CA 4DLYA 3CIOA 4QJ5A 3O8BA 3KB1A 3FMIA 2WWYA 4IJMA 1DPFA 3MFYA 3MSXA 5L3SA 5KPJA 3RAPR 1Z6GA 1D2EA 1RRPA 1VYUA 5HTKA 1Z07A 1DG3A 5FOUA 4KVGA 5JRJA 1KDRA 1YU9A 4OKSA 4Q1EA 4TTPA 1ZUHA 1YZKA 2YOHA 1XFAA 4MYTA 1GDDA 4D0LB 2OESA 2RGNC 2WIBA 4EQ6A 1M6NA 2R6GA 3OEED 1Z47A 4WA7A 4URXR 1T0HB 4C0KA 2FFHA 1HE8B 1GILA 1P2UA 2BHRA 3AUYA 3CO5A 2JLRA 3TJZA 3GLIA 1I4TD 2GXSA 1M7GA 1NVVQ 1R4AA 1FZQA 1TQ2A 2KJQA 2RGCA 3GFPA 5EP4A 3W6OA 5KDOA 4TLBA 4B6EA 2HF9A 2QPOA 5ANRB 4N0DA 1VTKA 1KI9A 3ND8A 4UNQA 2AK3A 2VP4A 1ZYUA 1FX0A 2OHFA 3C16C 2G83A 4MRVA 1VYTA 3LA6A 521PA 1Z0KA 2H18A 2WKRA 3CRVA 3K53A 4GOKA 4R71A 2CVHA 1NKTA 2J45A 5FTNA 2H17A 2GEVA 1KY2A 4FI3C 4IDQA 4AG5A 5A5GA 4HEJA 2ORWA 1RPZA 3KXKA 4YQFA 2GK6A 1ZM7A 2ANBA 2W6ID 4DCVA 1OH5A 2CL7X 4OQFA 5EP1A 2ODWA 1R2QA 5H8WA 1JALA 1EXMA 2V7QA 2ZVQX 4LHVA 3MWYW 5GJWC 3X1XA 5IT5A 3HPRA 1IXZA 1NN5A 4A6PA 2JLZA 1Z29A 4MYHA 1BIFA 2IYSA 3IO5A 4Q4JA 5B57C 1YR9A 4B48A 2UZIR 2JLUA 1W2HA 1Q44A 3GJ3A 1BYUA 2GXQA 1XEFA 4YMUA 1S9DA 1X8JA 4GFDA 4A1FA 1KI6B 5C2JB 1F5NA 1KMHB 4XJXA 3SI7A 3U4QA 1DO0A 3GPLA 4R9UC 5AJZA 4BRUA 2O5VA 4ZKDA 2WICA 2XNSA 3L43A 4XD7A 3K70D 2WHXA 2HV8A 5DN6A 3QPWA 3B85A 4PFSA 5D3MA 2E87A 3MJHA 2XOKA 5FTMA 4A2PA 1KI2A 4C0JA 1AIPA 1F6BA 2QPTA 4XH9B 1LS6A 1S8FA 2QQEA 2XNDD 3WY9A 4MDEA 4YDHB 1U8YA 3QKRA 2DYKA 5G3ZA 2XXAB 5AUPB 1V43A 4Q4AA 4BUJA 1QHNA 2ZRHA 4ZPXA 2C96A 4DCTA 4OHYA 2C8VA 1NJFA 1R5BA 2ZJBA 1U99A 2J0SA 2O8EA 3UIEA 3LVRE 4AYXA 1E2GA 1RKBA 1RYFA 1E9AA 2ZYWX 2ZROA 1WE2A 1VPLA 2WOOA 4D81A 1WMSA 1Z28A 1XXHB 4F4CA 1LB1B 5AJXA 4LYJA 4DXAA 4AIIA 3AVQA 2CE7A 2CHQA 2XAUA 1T4GA 5DH9A 2PH1A 4LC0A 3EIHA 3SBEA 3SU8A 4K81B 4ZDWA 2DB3A 4URUR 3W5JA 4CEIA 1ZUIA 2G6BA 4D2IA 1HE1C 3NTUA 5TXGA 2QA5A 2YC2C 3PCRB 3NEYA 4LK2A 4NTZA 3RABA 4Q1AA 4IHQA 621PA 5CJPA 1OH7A 2OSBA 5FR1A 2QP4A 1CKEA 3UWOA 4XD7D 3B1VA 1E9SA 4A0FA 2E1RA 4Q19A 4E5UA 4QJ4A 1KZGB 2J9RA 5DYIA 2FZ4A 3SHFA 1NMZA 2WJIA 1Z0JA 3B1WA 3U7FB 2GA8A 2AD5A 2GNOA 4ZCLA 4JIMA 3FKSA 3NHAA 4M53A 3LAWA 2IHYA 2ZAOA 5AJVB 3G5UA 3CZQA 2QAGC 1ZU5A 4IXMA 5F9FA 1KO1A 1XMVA 3GFTA 5B30A 2P6RA 5E3HA 3I3SR 2EYUA 2CCKA 1C9KA 4G01B 1QF9A 1T3SA 3WRYC 3THXA 3S1AB 5DI9A 4DSNA 1CR0A 5L3VA 2RGXA 3D31A 3HYRA 3UWKA 4KAXA 3SYKA 2Z83A 4JL8A 1OKKA 1SHZA 2A9KA 3QXSA 3ND9A 3DM9B 4LYFA 1XCMA 1KI3A 3GLHE 2R9VA 2ZRGA 1M7HA 1XU4A 3IPYA 3M4YA 4ZO4A 1NP6A 4JLJA 2QT1A 4DB4A 1ZMXA 2ZRFA 4AYTA 1Q1QA 1GP2A 4CF7A 1RZ3A 1KZ7B 3MAAC 5SZHB 2VA8A 1HY3A 4TQAA 1P7CA 2QROA 4QNMA 1QHYA 3NDBB 1ZD1A 4D80A 1G20E 4O0MA 3TGPA 1P2SA 3RVBA 5H68A 3ZH9B 1ESMA 1P9NA 4OI4A 2QMOA 2QBYB 1Q3TA 3IHLA 3E5HA 4XWAA 3UPUA 2XB2A 1L4UA 2QAGB 3BXZA 3PVSA 4Z8YA 4JS0A 5TDHA 5DGXA 4D0GA 4N1AA 5AUNB 2G0NA 1RJ9A 3B8HA 5J4VA 2R6FA 5E7IA 1MH1A 2FFBA 2GESA 3DMNA 3AH8A 4KBGA 1G8PA 1E0KA 2YINC 1W36D 2BVNA 1P3JA 4EJSA 5AWFC 1SVMA 2R62A
chains in the Genus database with same CATH superfamily
1OKKD 1FJGB 4II2A 3ILVA 4A8KA 1NPDA 2XY4A 4HD8A 3IWNC 1XNQB 3WLTA 2DFDA 2C98A 5BSHA 4DL0C 3J7A1 2BR3A 1WHSA 2C0CA 3C14C 4DYVA 3PWSA 3KUGA 3IMGA 4E3WA 4UARA 1R4NB 5YASA 1E6WA 2X8WA 2E1PA 3FHTA 4ZTBA 5HP1A 1U24A 2JAWA 4ME6A 3R9LA 5JJKA 2AF6A 4QREA 2MR5A 4KUGA 5HUQA 3OTEA 1TNDA 2GM5A 2W4IA 3KD2A 4Z4EA 4ZHSA 2I9SA 4FDAA 2IS1A 1SUSA 4XM1A 1FPQA 1ZVMA 5AW5A 2NYHA 3SQLA 5IKXA 4DXDA 4Z3KA 5FBWB 1YI2S 3VYTB 2NO5A 3LVQE 2H9YA 4L3NA 1AV6A 2FZKB 4B2IA 3CR8A 4RL6A 1Y11A 2IUTA 4BFSA 1C2YA 1RAGB 3OPKA 4EG7A 3MCNA 3L93A 4HWKA 1YF3A 3DGVA 3OJSA 3CQ9A 1WC0A 4PC3A 1C50A 1D03A 1HE5A 3DXSX 3ZE7A 1ZP6A 1R0AB 4RTMA 4W9MC 3HHNB 4ZOEA 3GGGA 1YK0A 2J5QA 4PGGA 3ECAA 4MDHA 4OSPA 5EJIA 1QYWA 4D97A 3SBDA 3ENAA 1JLCA 1KHTA 5IC4B 1QV7A 1PYGA 3H3JA 2FVYA 1ESCA 2XY7A 3FNGA 4R0NA 2MQNA 3TLAA 4EO7A 1N2XA 2O8BB 2MZQA 2D2EA 4MTPA 4RADA 5L9XA 3LWDA 3KG1A 1VHWA 1OPXA 4FPRA 2FYTA 2CNLB 3EPLA 3UHOA 1P0PA 2ZH7A 5T4BA 4HI1A 2FSFA 3S6JA 3DQQA 1GGEA 3I73A 5MGBA 5M5BA 3KHRA 3LT1A 4QDUA 3TQ1A 1UXJA 4ILLA 4L0QA 1Z16A 3GUZA 5AKLA 4Q7JB 3ZLUA 1CUJA 4FMPA 2YIVX 5C8YF 3CVKA 5IUNC 2BFDA 1WCIB 4X9XA 2O4UX 4R0JA 5BVGA 1NHWA 3M05A 5EXDA 4GVXA 1JIJA 4ZCPA 3TCKA 3RSQA 1NY6A 4KR9A 5BXIA 4CM2A 2E1AA 3CPEA 2FEKA 4JP5A 4US2R 2Q4TA 1M1XB 1QYDA 1TKZA 4E5PA 4DLKA 1RT3B 3AY6A 1WKVA 3D8BA 4JEMA 3VUFA 3ZN2A 2R68A 1Z06A 5DZ7A 4KIJA 4FMDF 2ZFUA 3O95A 2RQCA 1UAYA 5SY4A 3IFSA 3SZ3A 1G3RA 4RM3A 4CKWB 1F38A 4JI2J 5HAOA 2ZI3A 3B6KA 4G81A 4BQIA 2ORIA 1QLNA 1YJ5A 1SWVA 3QI2A 2OFXA 3NTXA 3LCUA 3HUDA 4LVNP 2IX3A 4OLPA 3SXUB 3RDPA 2ZM5A 5KFAA 2NVBA 5KFEA 3O3OB 4FDUA 1SKUA 1TU4A 4EFKA 4D9HA 4X8MA 5JBNA 4BO3A 2HU2A 2M6KA 4P08A 1ABFA 4B3SJ 2JD1A 4PAAA 1HI9A 1H65A 1L7QA 3BA1A 5JSYA 2PQ2A 1EINA 4P9NA 2DCUA 3D6TB 3QRPA 4OHXA 2WOJA 2QD2A 1FFWA 2XYQA 3GP8A 2I4OA 1QSGA 3OV7A 3TZ6A 3QVJA 3MEEA 2OXFA 3L6DA 5JNWA 2G77B 5EL0A 1D9XA 4FYYB 3OIYA 3V5RA 5CCBA 4R4JA 3OQMA 1AB6A 4HACB 3CZRA 4X7PA 4LRBA 3KT3A 4D9GA 2QN6B 3US5A 3WJAA 1JU3A 3MCVA 1AMNA 1Y7HA 4MRAA 2NSHA 2PX5A 2PCJA 2FSVA 4XR4A 4NOJA 4TL6A 1BOFA 2ZEJA 1E9BA 1UXIA 4E5KA 2YZNA 4GVBB 2Q07A 1VIOA 3L7CA 4BQFA 4CIDA 4ID5B 1E18A 4HH0A 1RXIA 2J8SA 4XRRA 3UOAB 5JSKA 4ZVKA 3L0SA 3T5GA 1FVHA 4BB6A 5B6IA 4OK3A 3EGCA 3SCLE 3MMNA 1XA4A 4N3AA 2YTZA 2WAXA 1W85A 5LPNA 4RPJA 1L8AA 2FGKA 3TZWA 4DSUA 3DBHB 2REQB 5SY6A 2FEMA 2YN2A 5ALYA 2AU0A 3DLKB 2VBGA 2Q0SA 4YXFA 3GV0A 1HNZJ 3HMQA 4LJ4A 4HNHA 5KFGA 2O3JA 4ETMA 3EISA 4BBJA 3CXUA 1JKIA 4OHVA 3NKYA 1USVA 1PTJA 5AK4A 3AIIA 4RLFA 1RHJB 3ADAC 1I9CA 4D9NA 1BE6A 2QSZA 2CSXA 2GX6A 3H8JA 4OHUA 1VR6A 3IULA 2HEKA 2OBLA 2YYZA 5IWAJ 1E89A 5HQJA 4B43A 2MTBA 4REQA 3BH6B 4HR2A 3K8OE 4ZA2A 1X4FA 4DHWA 1NQUA 5ETOA 4IIXA 4DQKA 1X38A 4ID8A 4OYBA 5ALUA 3K2BA 5IKOA 2QQFA 5DLFA 1IWPB 2XWBF 1B0UA 4DDKA 4TY9A 3C8YA 4QWCA 2Y27A 1YFJA 2GVZA 4MYUA 1JFFA 1JYEA 3PTLA 2UUTA 4CV3A 2A0YA 4YV7A 5KT5A 4HNRA 4F4UA 5TNXA 3HDYA 3BIOA 3CRRA 2NNWB 1N5MA 3I9LA 1JBKA 1KBOA 5CCEA 1GG8A 4JI3J 3W79A 1JEAA 2EKDA 2OV8A 2VA9A 1RT7B 3KHTA 3U7RA 3P8BB 3Q0TA 2BJ7A 3R8XA 3JSAA 1U1PA 2QUKA 3NMUF 1A8HA 4LDRA 1LBEA 3ZV4A 1APBA 1ORRA 5B7PA 1FLDA 3WDKA 2AFRA 4XGQA 2R7RA 5DRKA 2RGYA 5FDFA 4BWMA 2P0EA 3JD4A 1SC1B 2VAPA 2QYGA 2Q5OA 1KOOA 1B6TA 4DV3B 3S2IA 3GJRB 3GEGA 4FHDA 4YYEA 2I7XA 2EKLA 1L3TA 2H31A 4OB8A 4JJ4A 2G9QA 1E58A 5ERYA 5K05A 3VDMA 1F4PA 2OECA 5KZMB 1FRMA 3DT9A 5EJEA 2CT8A 1U2EA 3H86A 4UATA 1UPMB 2XRYA 1AKQA 4CZCA 4MP8A 3QGIA 3BRWA 1TPZA 5IHXA 1T1RA 3REOA 2I1LA 4G4IA 1XQIA 1YD7A 3WGNA 4JV5B 3OE7D 3QVUA 1KIAA 1B8NA 2HGNA 3O5TB 1Q74A 5LCXA 3W7AA 1Z6TA 2VP9A 2G80A 1GXSA 2VPXA 2NCKL 1GHTA 1KI4A 4Y7CA 2AEFA 3RRJA 2G6TA 3JVEA 4OQLA 2EC0A 3W1EA 2J3QA 5IXUA 1IYZA 3MM6A 1FVSA 1QTQA 3FMFA 5AKYA 4LZWA 2X1AA 4LJSA 2OFFA 1VJDA 2IV3A 4DV7F 1CEXA 4ZXFA 2B8WA 5LVAA 5GY7A 3ZK9A 2MT9A 4KIAA 3ROTA 1SU8A 2E4ZA 3BH0A 3RK4A 1DJ0A 4YP7A 4BNZA 1KR2A 3RFXA 3D54A 1I1QB 3OLWA 1RCOB 2AI3A 1H73A 1Z8DA 1HQDA 2EEYA 3A13A 3H5SA 2DTXA 4CNYA 4QD3A 5LWQA 5BR8J 1VDMA 1RT6A 4L0CA 3SCKE 3GG0A 3HVRA 1QHHA 2YQ4A 4FMBB 4IZ6A 3VAFA 3JAWB 2DLNA 2X8BA 3W5UA 3ETJA 3H0EA 4Q6BA 1Z0UA 2AXPA 1Y6GA 4LI3X 3E58A 4CG3A 5HZKA 3G8YA 3PC8A 4I1SA 3G2QA 3SCIE 3BAFA 2QRUA 2LMIA 3VA7A 2OC9A 3ZD8A 3GARA 3E18A 4MDYA 2IOFA 4Z8XA 4Y1RB 3K5MA 2PGIA 1YIOA 1PDOA 4PFJA 3HVAA 1V45E 2QRRA 1UCFA 2F63A 4ALZA 5GOZA 2I8LA 4QL3A 4DV4F 2ZZKA 2CB9A 3VZCA 1O08A 2KS6A 2I99A 4V1Ak 4KPFC 3FZBA 1BSVA 1E1YA 4KODA 1W25A 4AICA 4NDZA 1GT91 3ZZMA 2LEBA 3O8OA 3U9SA 1TVCA 2VL7A 2NWQA 2ISSD 4RWWA 2WWTA 3U0BA 2XGMA 3MM5B 1WZNA 1JEJA 3KZOA 3SQNA 2HMWA 4CT0A 2R84A 1SXGA 2LVWA 3DLBA 3MJDA 4PVDA 5CA0B 4KLRA 3KKZA 5J4KA 2G0AA 1GV1A 1M34B 1PGJA 4OU5A 4W92B 5CK5A 4USWA 2DTEA 2BQRA 3EIFA 4LHEA 2ZOGA 2XTAA 4MIKA 5JI3E 4RV4A 3QGGA 3TZCA 3JQDA 2GUWA 1EAYA 2RT3A 3GFYA 4TWBA 1DRUA 5FI3A 2ODTX 3BBBA 1N32B 1O51A 1F8YA 2MINB 1W29A 3H5AA 3CR3C 4GBJA 4GKJJ 4TXSA 1VC0A 1P2BA 1RHUA 3HVHA 3BCSA 3CMQA 4OQJA 4ZPJA 3MWFA 3TQSA 4L8FA 5DYGA 4PXSA 1D2GA 5AHKA 1CQZA 4PLHA 4BATA 1LC0A 4BNFA 4BEBA 2R2SA 2MQLA 4X93A 4F9EA 1NYLA 5B4VA 3UGQA 1G3UA 2UZ0A 4EI8A 5HXAA 3U37A 3TRFA 4G37A 3E3LA 4DIFA 1SD1A 2VZ0A 4HB4A 1GKYA 4LF9J 4CRWB 2BEJA 4CV0A 3VNVA 3M8SA 4MSUA 3WGHA 3IILA 2ZT8A 4KHRA 4G85A 4AXBA 3DDWA 4JJ6A 4BZWA 2BR5A 4XAKA 5A0VA 3GP9A 4EG3A 3TXAA 3TO5A 1ZAXA 5LC1A 13PKA 5BUSA 1XA3A 1TO1E 1N5KA 5BUZA 2PR7A 5TLSA 4ZIVA 1PNVA 4DBLE 1M8PA 2FFRA 2WE8A 1KHHA 2B25A 4OGGA 2UUOA 3X0DA 1PYOA 1J2JA 2C7VA 3L9WA 2H1LA 2ZE2A 4IJQA 4L8WB 3WLRA 2CXXA 2HAEA 3KWMA 4RZXA 2VFSA 3U1BA 3CLUC 3LBHA 1N0HA 1HEIA 1BVYF 4G63A 1RZVA 4MWGA 1Q5YA 8MHTA 4KH1B 4YASA 3FWHA 2AT1B 4DSTA 1B70B 2MR6A 3MRXA 3PC2A 3PTWA 4O6VA 5G1NA 1W6UA 3SFUA 4QYZK 3DE2X 4YHBA 4HLBA 1P7VA 3HR8A 4LWZA 1CUWA 3RAXA 4LF8J 1X1SA 4P71A 3JQRA 3R7BB 1ABBA 3L7PA 2XZPA 4KO0B 3QU7A 4QDXA 4EBCA 1FC0A 2ZJ8A 5KI6A 3RWMB 4HJRA 3ILLA 1W0JA 3MUOA 3FBWA 3TAQA 1CC7A 2M8HA 3FBCA 3EZ7A 2HIGA 4UUMA 1S96A 3GYBA 2I55A 5BXYA 3MMXA 3NDRA 2Q3PA 4RMHA 4EITA 2AR7A 2WNSA 4TXNA 3J80U 5IMSA 3DDOA 5FOVA 3LLSA 4J0EA 2M0GB 5JEDA 5JH7F 1H98A 1PUIA 3LC0A 3PZRA 1NB2A 4WBNF 3RSZA 3W1WA 2W7OA 4FBTA 1L5SA 5HQ8A 1TMYA 4N3CA 3M2RA 2GVZC 4HH4A 5IQQA 1DKNA 1D6SA 1ORHA 3TL3A 4LRFA 2C95A 2FFJA 3FCVA 4Q18A 2ZVPX 3RASA 3IGFA 1QP7A 3GFXA 2O48X 3J7ZT 3V1YA 4HEQA 1Q1EA 4GEGA 5JMTA 2MJNA 2PGAA 4EJSC 4UBIA 4C8YA 1FK9B 2EKZA 5EGNA 4PQEA 5MF6A 2VUSA 2XZLA 2ZUFA 5LLDA 4L27A 3VYSB 1YZ6A 2GFFA 3EVBA 1NI5A 3N5CA 1RDRA 1CR6A 1UZUA 3I6ZA 1HR0B 1CFJA 3UCEA 3ISND 4ND1A 2RHHA 1L6IA 4S35A 4HDOB 1DPGA 4ZT6A 4O1IA 1R8JA 4OH7A 1SPBP 4LA4A 4DDWA 5CFNA 2ZHOA 3Q24A 4P3PA 1CQNA 4KXQA 2J3IA 5F9MA 1AK1A 1ZAYA 4MKYA 4I3HA 3UM9A 3ZVRA 3HMKA 5ERGB 3P2KA 4QYZJ 3Q3JB 4UOGA 3RYHB 3O9MA 1WPGA 1HT3A 1QPGA 4BVJA 5DN6D 5JPDA 4X6YA 3HK2A 2XJ4A 5BVHB 2R2UA 3AB4B 3HZEA 3MD1A 1QV6A 3MWEA 4MJ3A 5L9NA 1U6JA 3CLSD 4CMIB 4P4LA 3DNFA 2HSJA 4ESHA 1LX7A 4Y1RA 3A6ZA 4YUVA 3ADOA 3QEJA 2QGZA 4TZ6A 3UW1A 4P8RA 2OI2A 2OGZA 3D3KA 3GLFE 3KKQA 2ZH9A 2PKYX 3KXPA 5KU7A 4LYHA 4KI0A 1H7WA 2ERXA 2PVCA 2F1FA 2WSSD 5HLFB 1E6LA 2ZYTX 4FZRA 2VP3A 4ZYWA 2V6FA 4KQHA 1E94E 2EWWA 5TT0A 3CB2A 1FIUA 2YKNA 3AP3A 1R1DA 4YDRA 1HRDA 5G3YA 5FXMA 4QR1A 4UQPA 3BGVA 2HYIB 1FRKA 3IIIA 5EUBA 1JQJC 1DURA 1KE1A 4X1YA 3WK7A 2VONA 2JGRA 3CUTA 1XF9A 4HX9A 3N5FA 3RAEC 1VCTA 4ZVQB 1IUPA 2X0NA 3MYYA 3GJQA 1GMWD 4TY8A 3BXHA 2CBGA 5DHQA 3IP8A 3ZDCA 2KT2A 3UAZA 1TJ3A 1DWOA 1GPNA 3DTVB 3O75A 4JP1A 4CUJA 3L8CA 2HWIA 1Y4UA 5AVVA 1YQUA 4NONA 1A3CA 4MYSA 3IUEA 4DIMA 4CE6A 4WT7A 7REQB 2WJ6A 4XO0A 3U4MA 5IN5A 3CC8A 4DLAA 2K5UA 4OX9B 1WY7A 2WTAA 4DR6F 1VG1A 3DOFA 1U0HC 5FOQA 1AU9A 3R3SA 2ZDPA 3MGGA 4JYPA 5DYNA 3DHWC 3OX1A 2BR4A 1EWTA 4PN7A 5B7NA 5IC5A 1T8TA 1WDTA 3MERA 1H3DA 4UNNA 4EB6A 5IH3A 4JI8J 4KB7A 2AJFE 4BUCA 4B7XA 3A8EA 5A62A 3OOEA 5AXCA 2EJVA 3SN6A 2F67A 1Q82T 1S2IA 5HBMA 1KRHA 4CLWA 3LK7A 3P9XA 1VSVA 4PYJA 5KX5F 3L4KA 4EO8A 3EJ6A 4WGGA 1D2CA 1DIRA 2WNHA 1CB0A 1C4WA 1ECBA 4I50F 1BD3A 1GLGA 2ASEA 5ES4B 3O4FA 1OFIA 5M2UA 3PP8A 3OE1A 5H0IA 4M22A 2C20A 4R2IA 1OYVA 1S2LA 3CNEA 4QTYA 2KHZA 3PRYA 4OGKA 5GADU 1DQYA 1IBMF 4AP6A 3GA0A 1SQGA 1T3OA 5B3AA 3TW8A 2MQQA 1LLQA 3UK2A 3JATA 5BV1A 3BD8A 4Q1EA 3ZBPA 5BR8F 1VLOA 2EJBA 1GYQA 3QMWA 2OESA 2Q2WA 1S76D 4NLXA 3UD5A 2A6PA 3CO5A 2RGCA 1ISIA 4M7WA 4Q7QA 1SC9A 3O4GA 3ME5A 1Z12A 3SBOA 4WVLA 2BABA 3OTCA 4ID5A 3ETNA 3FMWA 2ECOA 1DU4A 1RPZA 1WXWA 3T7SA 3HXQA 1GPAA 3I9V1 5KWJA 1UVNA 5H9FK 5EP1A 5IZCC 4DR4J 3C16B 4B6PA 4D4HA 2P9CA 4Q4JA 3E2MA 4D0RA 3TLMA 4CIXA 4AECA 2Y6VA 1AXGA 3T9FA 1DKRA 2WK1A 1KMHB 3RRKA 1SJRA 4R9UC 3WRWA 1UIRA 3OP1A 4DCCA 3EAGA 4ED9A 2OG1A 3BZUA 3HVKA 3WGIA 2QPTA 3W8EA 4JI2F 4C4WA 4YDHB 1GPDG 3B1FA 4PWYA 5AUPB 1V43A 1W5AA 1XLTA 2RE8A 4XGNA 2NV2B 1E9AA 1T5BA 2P0AA 2V3WA 3PUJA 5C7PA 3EQ2A 3RUAA 4D02A 5HGXA 1JVBA 4C7XA 2Q7OE 4QIWD 1JFRA 5J23A 2FLNA 1K7EB 3HXOA 2D00A 2SBTA 3ZR4B 4QJ4A 1PI3A 4IDKA 1F5BA 3W6ZA 4QARA 1QO0A 4TZTA 2HPHA 4CQ1A 2ZWIA 4YR2A 3OCXA 5DYYA 2NU9A 3CISA 4UQGA 1EE9A 4RW6B 1GU1A 4C0OC 1HLWA 5KBYA 5L3VA 2Y76A 3D31A 4E5NA 1M1YA 2GM3A 2MWMA 2Y9MB 1BJTA 1V8DA 1B2LA 1DBQA 3M4YA 4JLJA 3FSGD 2EK1A 1VCHA 1OUMA 5SZHB 2G70A 3DQPA 2V7XA 4IGFA 4RORA 2HHPA 1U8FO 2P6SA 3MTEA 3I2GA 3KJNA 1FVXA 5BSVA 3B8HA 3Q8MA 1U2FA 1KYVA 5CPBA 4KFBB 4KBGA 1UJBA 3TOXA 2BVNA 2EERA 2O2HA 4CEHA 3DNCA 3EEQA 3FVTA 5F2EA 4QJVA 2DPJA 1AD2A 1V96A 1F3VA 3BIWA 4JENA 4OFWA 3RJMA 2D74A 1Z4JA 1LI5A 4B8WA 2WD9A 4Q7MB 2BT4A 1ONBA 2C77A 2VQDA 2A1TR 1Q6ZA 3AVVA 2YWFA 4DPXA 3MCOA 3DVSX 1YO6A 2IA5A 1NHUA 2HI0A 4MIAA 4FFSA 5E95A 4CMCA 3VGPA 1FD8A 5KTYA 2OLJA 4A0HA 3EGDB 5CJJA 4U6SA 4UTOA 1XEWY 4W7IA 1SA0B 1JMKC 1S2MA 4R98A 1OASA 1R9NA 4DZ6A 1EFDN 3ER8A 2OWDA 1RWMB 3A3PB 2W6CX 2NX2A 2AYBA 1RZUA 1R3NA 3E5NA 1UINA 1GU7A 3F98A 4Y0VA 3G2IA 4NBSA 1OC4A 1ZVVA 2ILYA 2VBYA 4ZO7A 3MD3A 5F4BA 5G2OA 3RYHA 3NM5A 1R0AA 5GPBA 2IPXA 4NZ0A 1GQQA 4Z1MD 4KLNA 2PMDA 5DLEA 1UT8A 1DOHA 2APJA 1GA1A 1U6KA 3C14B 4RETA 1NZDA 3MEDA 2VIHA 1RQLA 2IM0A 3M6VA 1WWHA 4TVKA 2IYLD 4OOFA 2OCPA 4YT8A 3JQGB 2C9DA 5KKNB 1VBFA 5GIPE 2HNBA 2VP5A 1Y1QA 2GBIA 1CLEA 4MGHA 1QG0A 4CKWA 3K09A 2MINA 2G63A 3BWDD 1G38A 4BQOA 4RKFA 4LMAA 1RWXB 4IFIA 1XL1A 5EWLB 3PWKA 2HHVA 1DX9A 5KFXA 3VYRB 1IHDA 5A4DA 3ZH2A 2HFUA 4PC2A 1DY3A 2BXJA 5JXHA 1EKXA 4XX0A 2UXCF 3CXRA 1J42A 2APOA 2IYIA 5HCNA 3FK4A 2OZPA 3F6RA 4KNYA 4D5EA 1BG6A 2O8CB 2RGGA 2EW2A 4N77A 1PLLA 4S24A 3S8MA 1HV8A 2H16A 3DW3X 3AIKA 2CLCX 4QUHA 1HQKA 1OU4A 4LQLA 4QOEA 3VPHA 3ZQ6A 4NBVA 2G3YA 1AQJA 3PJFA 1TIBA 4K8RB 4Q5IA 4DUGD 4XD2A 3T5TA 3N75A 3WL5A 2XQJA 2ODQA 3PEVA 3PRKE 4JMPA 2G9OA 2UYQA 1UXHA 2PV7A 3CE6A 4EUFA 4NEGA 1WNFA 3T5HA 5CXSA 2JC0A 1UPCA 1K06A 1KYIA 4Y2RA 3B3AA 2AGPA 4QEZA 4BB0A 1XHEA 1S12A 4LJKA 1MTZA 4RK6A 2CJWA 2XCLA 1XX6A 2PSHA 5GGXA 1QO9A 4KVAA 3PGMA 1M6YA 1VB5A 2ES4A 3D5MA 5REQB 4EPVA 3E7DA 2WZ1A 2ZJ3A 3MN1A 2QRLA 1XNRJ 1N9GA 1U0LA 5FQNA 1WG8A 5D3KA 4EVRA 3RC7A 1KZ9A 2H9IA 2Q3MA 1LWNA 2OV2A 2OYSA 2FSUA 4DL9A 1M5UA 3QLVC 1OAKA 3OY2A 2PWYA 2F3PA 1UBKS 1SUPA 3ITNA 2REOA 2NO7A 2L82A 2PUAA 1V4VA 4OGFA 3H9CA 2V5UA 2C2ZB 2FE1A 3T1YB 2P2NA 3ITEA 5AVOA 4FFBA 4LVCA 4RELA 3UJHA 2A5YB 3CDAA 3IQZA 3N2EA 4LV6A 3P0IA 3EJMA 3GUHA 1HNWF 1LKZA 2VAMA 4DDTA 4PSAA 2R8HA 2P9QA 2CVZA 3LCRA 3HCCA 4B6QA 3IQXA 1OZFA 1NBIA 4PYIA 1K2WA 1MGPA 3GVHA 4LF4J 1Z88A 5LQCA 1E2IA 4EF5A 3PHIA 4AWAA 2JH3A 4H77A 1QQAA 1DDGA 4UFNA 3OWXA 4REQB 4CN9A 1D4ZA 2IAJA 1U9YA 5DWDA 4MUAA 4TU7A 1G2QA 2VO1A 4L57A 5JAOA 1L6RA 4AX4A 2E48A 3Q3VA 1O0PA 2Q66A 3M8YA 3LUGA 1WSAA 5JQWA 3RGGA 5LOVB 2H92A 4ZVLA 2KM8C 1UKBA 2BKXA 4WWHA 3C5WP 4MYDA 5CDTA 4BVBA 1U3VA 4CKYA 1Q8BA 2NZ2A 2EFDB 2A5JA 1L5LA 1PU2A 3AEKB 3FLEA 2ZJQQ 2LQ8A 2WEKA 4CM1A 1Q0HA 3IR5B 1OH6A 3DLHA 3GLIE 4Y9DA 3EOBI 2X5JO 1YE8A 1L5KA 4CI0B 3U1NA 3MMZA 3Q98A 2D3WA 2GJ8A 4F91B 4DV7B 1V1RB 3GZNB 1Y1LA 5HIMA 2WM8A 2CNKA 4CWBA 4K2AA 4Q1FA 1GAWA 3BM5A 5F21A 3UAVA 3A3YA 3UF0A 2IXTA 3T7KA 2DF8A 2DNRA 4XYLA 2AP6A 3FPGA 3VU1A 1Y3BE 5IV4A 3TW8B 3V8VA 3Q7EA 4K6MA 4X3OA 5AUQA 3A70A 3QNUA 4C89A 5CNIA 2EOAA 2ZJOA 4CT8A 4DLRA 1RLIA 1M74A 4IFBA 5LQMA 1IN4A 4P72A 1TAUA 2W2MA 4L73A 5B0DA 2V8OA 2ZR0A 2QTGA 3EZ2A 3MAGA 2A6MA 3VHXB 4EHHA 4RZ2A 2XI3A 2OL4A 1XTRA 1D1TA 2H3EA 1KKHA 1KI6A 1G8KA 1TM4E 4I55F 1RVV1 4RD1A 4DLSA 1PL0A 2RH8A 3MM8A 4PFQA 1QFZA 2M9MA 3EVZA 1VLJA 4EB6B 4L02A 3CLHA 3LG2A 1VLVA 3JXEA 1JKJB 1L1EA 2DY0A 2C2DA 5JDIC 3V1MA 5HBMB 1E6YB 5LSRA 3FQLA 1RYBA 4QU9A 5DWVA 1OY6A 3KD3A 3RROA 5K4AA 1JSRA 1OBHA 1WRBA 2SHKA 3HRKA 3HDTA 4Y6SA 5D87A 1FY2A 2LU1A 2WWFA 3ZTSA 5LOQA 2BBEA 1ENZA 4HEA1 2VZ9A 5AM1A 5JXGA 1NSKL 4R3WA 4EENA 1JG2A 5JS6A 4X66B 4D3HA 4FYVA 4PIVA 4YK7A 3KYIB 2EIHA 1UP6A 1HBOB 2DQSA 3PITA 1R64A 2WBLC 3ABRB 1BMDA 2YUIA 1FF9A 3DOMA 1XKXA 1CQMA 2E9TA 3C41J 2JAXA 2M9KA 3E3XA 3Q8RB 3A0UA 1J06A 1FDBA 1EE2A 2RJNA 2HHWA 1II9A 3NGTA 3IBTA 4F21A 4USJC 1XEWX 1ZOOA 1ORDA 1N8RT 3A9CA 3TTUA 4LBYA 1KTQA 1SKYB 4HL9A 1HW8A 3F4KA 3I23A 1ODLA 4MP3A 1CZKA 3OLQA 5A4KA 2MSCB 2JEIA 2RDDA 4ZOQI 2AYGA 2ZRCA 4EMSA 4RS3A 1Z25A 5ESWA 3M5PA 1S4QA 1ZRMA 3O44A 1ZD4A 1ND5A 4A3SA 2IZ0A 2AJQA 3M5WA 1UKAA 4M8IA 3O1IC 1KH1A 3VR4A 2WWHA 4M1WA 1UWBB 3BMOA 2F3RA 1VJGA 1RI4A 5FBRB 4KN5A 3ZXIA 2D7CA 4JI0F 1X8KA 2H1OA 3OMXA 4Z4FA 1KIMA 2QA4S 3DI6B 2QLNA 4QPPA 4R5PB 1ZO8A 1NBOA 4PR0A 4DR4F 3AUFA 1QIKA 2MOKA 2VNAA 1GZDA 4MIEA 1S3GA 2VDRB 1L9KA 4Q1VA 2XMJA 1VLYA 5IWCA 1F2GA 2R8ZA 5CHCB 5E6RB 5FO1A 2XI2A 4TKTA 1HFJA 3AOBA 2EG2A 1K89A 3GRRA 4PRKA 1NXPA 1KZ6A 2GKOA 3KEGA 1QV9A 3BZBA 4DC0A 1S6YA 2O5EA 5A4AA 3DKIA 3RTBA 2LKZA 3KYCA 3K73O 4UASA 5DK6A 4K2JA 1IJFA 2QTMA 2A5FA 1CUFA 1YJVA 2P2YA 3FJ1A 4MVJE 2EFGA 4D25A 4I2QA 2VBFA 2C4KA 3P97A 2QO3A 3OUYA 3V00A 4JA0A 2D59A 5FFFA 4I68A 4EWTA 3LOUA 1XZJA 1VBNA 3A1CA 1KFCB 4PSVA 3QE9Y 3I2JA 2HNYA 3OEHD 3MSCA 2H2IA 1U81A 2VNIA 4NE7A 4BVKA 2CJBA 5IXSA 1FKPA 5KFCA 1SKQA 1BW9B 3NATA 3DMTA 2B1QA 3AEZA 3V48A 4I8DA 2IHBA 4QUAA 5I7FA 2P79A 3PIOQ 4O33A 5BNFA 2LZ0A 4D57A 3F44A 4R40A 2FN9A 5ETNA 1SXLA 3DBRA 5ARCA 2Z8QA 2EFQA 4UY8T 4OBEA 1LQUA 2ZI4A 4FSHA 5E9JA 3DVAB 1F0PA 4BO4A 4W7HA 8ATCB 2GAHC 1IJEB 1AW0A 4ZIRB 1S7GA 3DDZX 3MTKA 2VOOA 3JQ9C 4J2HA 2PH7A 2VF7A 2AW3A 2PMWA 3QE0A 4TYMA 5IVIA 3HXPA 5E4TA 4CQLB 3DEIA 4I7FA 1RCXB 1Z2CA 3CNOA 2CEKA 3I4CA 4GRAA 3E8SA 2I2FA 5AXKA 3CDBA 3GFVA 2V5HG 2OB1A 3H5LA 2L41A 2OM6A 3TS1A 3PR4A 3GPDG 1PQWA 3GVIA 4ARIA 1S9EB 3U3MA 1CQIA 1AX9A 3OKPA 3D6VA 4UQOA 3T3HA 1HEUA 4QZVA 4L76A 5CM8B 1R3UA 1FSGA 3PK0A 3M9WA 1QUVA 4OGWA 1BHQ1 2RGEA 5BSFA 5JHGB 4BBAA 3IOBA 3O3LA 4TRNA 4NU6A 1GA6A 4MVJH 2QX9A 3T9CA 1DIAA 3K4QA 3W3AD 3QMQA 5IAGA 4IRUB 4B33A 4JKIA 4DXHA 3OY7A 3FDZB 2KBEA 3DMFA 3OSNA 4WMLA 2AR9A 1JLGB 1DELA 1XMPA 4DPUA 1U8EA 1PBTA 3T34A 1PK7A 3ZY6A 4V39A 2G1PA 5C25A 3H5WA 1S9FA 3C5EA 4ZHRB 1TV6A 1P5ZB 1OD6A 1NAHA 4JC4A 1EGHA 5AKXA 1M5HA 3JASB 4PLPA 2HXSA 1KNXA 2H1YA 5D51S 3IUJA 2RF2A 2YOGA 5FUMA 1C1BA 3QYYA 2OBFA 2V5VA 4JLMA 1FZTA 1NOKA 3PNKA 5BUCA 2VV5A 2LP4A 1XZGA 1B4SA 2WSCC 4ZP7A 1K97A 4IQFA 4C5CA 4HDRA 1N6NA 2O2GA 3ZJVA 5TQVA 4BX9A 2O01C 2YWCA 5A2QY 5KYUA 1CVJA 3RKSA 2YVKA 3GBVA 4I8XA 3MCAA 4UU8A 4P33A 1FNDA 3OZVA 1P6TA 3MM7B 4U3JA 4Y65A 5B55A 4TLEA 4BO2A 4TTAA 4YJFB 4QU0A 2XNQA 1GGHA 1F9EA 4RZIA 1ZIOA 2ZYAA 2ROEA 3OL7A 5HZGA 4CKXA 4NEQA 4X65F 1ZPDA 5E3QA 3DRPB 1XRMA 1YA4A 2YZGA 2KJVA 4XPEA 1H2YA 5LUAA 5DF1A 4F7VA 3D6HB 1M34A 1Y81A 5IEJA 4P74A 4HGPA 1B2RA 3H04A 5COAA 1JEQA 3B2QA 2DIVA 5AJ3F 1X7XA 3RC3A 4BPRA 1ZAWA 1UDRA 2BHLA 1JJHA 1XZIA 3H1PA 5E7QA 3ITDA 1U3FA 3F78A 3SOZA 3CNNA 4LECA 3EEIA 1UBTS 3ZEIA 2FG5A 1DEAA 2FQ1A 2QQ0A 5DBOA 3FRIA 3KJQA 2WG0A 1FTWA 4DFDA 1J1ZA 2I3ZA 4DLWA 2UAGA 3N39C 3ORRA 2DEIA 2X0DA 3VV2A 3OPVA 2FC8A 4XPIA 1B6GA 2XVYA 4FR5A 4QOSA 4E5DA 3IAM1 3H8SA 4S1OA 3LQRA 4C3VA 1YZ3A 5F7OA 1KWKA 2HU7A 1EFHA 3PJDA 3T6BA 4CWAA 3KR1A 3MTBA 3SEOA 5FYQA 4OJ1A 1O6ZA 3GHYA 3I12A 4MFBA 5GAJA 4FB5A 2QTZA 1MO2A 4RK7A 4IXDA 2BFOA 5JNUA 4TLDA 5BSGA 3FW1A 4DX7A 5BYJA 3VZIA 2QRVA 2PUHA 2I6UA 2WMDA 2JI6A 4I2PB 4IX9A 2DQKA 1A7JA 4IQGA 4MV6A 2QLFB 3EGDA 1MEOA 4IG4A 3WFJA 4ZKEA 3P0RA 5T7BA 3DLEB 1Y89A 2CPZA 1SCIA 4DMZA 2KPOA 5EWMA 2PT9A 1N2ZA 4AP5A 4UD2A 3HJBA 5EMKA 3JR3A 4FR2A 1THTA 5P8WA 1KU6A 4U9RA 1KQOA 2YZ2A 3DAPA 3H8VA 5FOTA 4QYIA 4PYMA 2Q50A 2EKYA 2CA9A 1U7ZA 4NMHA 4C0SA 2VJQA 1P4GA 2REBA 3TMYA 1ZICA 4KAIA 2QN8A 1U5BB 3O8RA 4RDXA 3TKAA 2X2EA 3I4HX 2ABWA 2OFHX 2BKEA 2OBMA 4F72A 3R7SA 3MW8A 5FBHA 3QOXA 3INTA 3N28A 1P77A 4CKBB 2Q3EA 3CKYA 3LDFA 4RSMA 2M1XA 5AT1B 1AT1B 1ECCA 4P4UA 4M99A 3PKZA 3TI9A 4LKOA 3NNHA 2J9CA 1UC8A 2ISQA 3RTCA 1CDZA 4Y6GB 1IHPA 3TQOA 1XCOA 4F8EA 4LJ5A 4OHWA 2W5UA 5DNWA 2YV5A 2CLMB 4PXEA 1WBDA 4OJTA 3OECA 1OFTA 2B56A 4YO7A 2NTVA 3KFWX 3KE8A 2C4MA 1UODA 2JJMA 3EPIA 2IBOA 4NBNA 2R6HA 2XF2A 1QO0D 3PE4A 2GYWA 5TPZA 5JR3A 2F1IA 1EGMB 3J81U 1V9SA 3CW2C 1Q50A 3GD7A 2Z2KA 3DOLB 2VHYA 1CHDA 3MMPA 1L7DA 5EXXA 1N36J 4WFYA 3BK1A 1YCFA 5HFNA 5JO0A 5DIZA 2E4YA 2HF8A 1QSYA 1JHYA 5JCZA 4YRIA 4ELTA 2JJ4D 2WVEA 4AMVA 4IF4A 2YRWA 4KPCA 4MDFA 4F12A 1H4TA 3ZS8A 5C24A 4NLVA 2HURA 1Q1NA 4L9SA 3SV4A 4F3OA 4EKGA 2VQ3A 3PJRA 2R751 4DDUA 3TQFA 5KFPA 3LPYA 3CU5A 1XC9A 1LWFA 3ORHA 1UM9A 4QXAA 2F9JA 3T9EA 4HUJA 3RWBA 4AD6A 2PWZA 5A8WB 2PUTA 3FWZA 2C03A 3ZHSA 5DHSA 4MPRA 2ZLBA 1IL0A 1Q14A 4B73A 4RBVA 2GFQA 4DNXA 4M8KA 4HTAA 1Q3HA 3EEOA 1BFUA 4Q16A 1H0SA 3QELA 4B6RA 4DL2A 5D6NA 4EDFA 1IC6A 4YY3J 1QYVA 1ZSNA 2OWEA 3G9TA 3MMBB 3DOHA 2QVYX 4JR2A 4P3XA 3TAHA 4FKBA 1PBUA 2W2TA 3L6RA 2HMSA 4UM7A 3K1ZA 4PQAA 2GCOA 5KT3A 5I7EA 1VCOA 1E9RA 2O07A 2FK7A 3EZXA 4XVCA 1NUUA 4P7VA 2AZMA 3DFFA 4J9QA 2PGJA 3KLBA 4NICA 4OQXA 2OB2A 1T8RA 3UGJA 2G28A 2ZUVA 4ZDKA 2W2KA 1YGYA 5TT1A 4OKNA 4MPTA 3LQVA 3DGPB 3UNXA 2WJ4A 1GLNA 1YR1A 3V32A 3WDOA 3GEIA 4YB5A 2PQMA 5DHTA 3ZQKA 4FS8A 5KVSA 1O94C 1GFWA 2KXNB 1AYEA 4FS2A 1FKOB 3ITHB 1RXVA 5HIAA 3KL2A 1SURA 2G4VA 5KPJA 5GVQA 2CV2A 3ZZNA 3KPYA 4KVGA 3WGVA 3KWFA 3BPSP 4AU1A 2WIBA 4TXMA 4NWBA 4C0KA 2BHRA 1WHWA 1EUQA 3ABOB 1VTKA 1ZL2A 4UNQA 3R40A 2V4UA 4G0PA 1S3FA