4OMFG

The f420-reducing [nife]-hydrogenase complex from methanothermobacter marburgensis, the first x-ray structure of a group 3 family member
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
231
structure length
231
Chain Sequence
AKPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKLVCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLALPGCPPSPEIIAKTVVALLNNDMDYLQPMLDLAGYTEACGCDLQTKVVNQGLCIGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWWPEEQIKKELGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F420-reducing hydrogenase, subunit gamma
publication title The F420-Reducing [NiFe]-Hydrogenase Complex from Methanothermobacter marburgensis, the First X-ray Structure of a Group 3 Family Member.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 72
structure length 231
sequence length 231
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00037 Fer4 4Fe-4S binding domain
G PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4omfG02
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4omfG01
1Y5NB 2FJDB 2C3YA 5CHCB 3MMCB 2WPNA 1A6LA 4URHA 1WUHS 1GT8A 1FDAA 1Y5LB 3MM9B 3H3XA 1WTFA 2WSEC 4CI0B 1FCAA 1WULS 1SJ1A 1FRLA 3ZEAA 4IUBS 1FDDA 4UCXA 1FRJA 2VPYB 3GYXB 2V4JA 5A4FS 2FDNA 2Y0SD 3USCS 1D3WA 4RKUC 3RGWS 1FDNA 6FDRA 3EUNA 1FERA 1KQGB 2IVFB 4U9HS 4C3OB 5JT1A 3MM5A 5FD1A 1Y5IB 1FEHA 1ROFA 4UCWA 1UBHS 3IR6B 3MMBA 4KL8S 1BLUA 1F5CA 4IUDS 1Y4ZB 3MM8A 3MM7B 1F2GA 1B0TA 1H98A 4ID8A 3MM6B 5BYRA 4UE3S 3USES 1BWEA 3MMAA 1KEKA 5JSUA 1DURA 2FD2A 2FJBB 4UCQA 5JSYA 2VKRA 3MM9A 4UD6A 1UBLS 4UE2A 5JSKA 1BC6A 2PMZD 6FD1A 2WSFC 4IUCS 1H2RS 5BYSA 3ZE7A 3PNIA 4KO4S 4KO2S 1FDBA 1UBOS 1UBJS 4XDDA 1C4CA 5BYQA 1Q16B 4AYBD 3MYRA 1G6BA 2PA8D 4TTTS 1XERA 1PC5A 2PDAA 1UBRS 4UPVA 4UEQA 1UBUS 1R27B 1KQFB 1WUKS 4KN9S 4DHVA 1FRVA 4UEWA 4XK8C 1FD2A 3IR5B 1FRIA 1H0HB 1GAOA 2V4JB 3AYXB 5A4MS 4OMFG 4OV1A 3OR1A 1HFEL 2ZVSA 1FXRA 1H7XA 1H2AS 1YQ9A 1K0TA 1BQXA 1C4AA 2VPWB 3MM5B 1UBKS 1WUJS 5CH7B 1JB0C 3CUSA 2WSCC 1FRFS 2UZAA 3LW5C 1SIWB 1VJWA 1JNRB 4UQPA 3IR7B 1FXDA 3HKZD 3ZE6A 1E3DA 3EGWB 4GD3Q 4XDCA 4KO1S 2XSJB 3MM6A 4UD2A 5JSHA 1B0PA 2FJAB 3OR2A 1AXQA 1GTEA 4UE6A 2V2KA 1UBMS 3AYZB 1G3OA 1YQWA 1BD6A 1H7WA 2VPZB 4U9IS 5ADUS 1JNZB 3MMCA 4YDDB 1YRQA 1PC4A 2Z8QA 3ZE8A 4KT0C 4Y28C 4L6V3 3CURA 3ZE9A 5A4IS 2C3MA 3C8YA 3UQYS 4UQLA 2FGOA 7FD1A 1SIZA 2FRVA 1FRKA 1F5BA 3OR1B 1IQZA 2C3OA 5D51S 3MMBB 3EXYA 5E7OB 2C3UA 2XSJA 5JRDS 1UBTS 1B0VA 2C3PA 2VPXB 1IR0A 3MM8B 2C42A 1DFDA 1GTHA 1FTCA 3OR2B 3MMAB 2FJEB 4UPEA 1FRHA 1WUIS 1DAXA 2GMHA 1RGVA 1CLFA 2WAQD 1FRXA 7FDRA 2GMJA 3MM7A 5L8RC 1FRMA 2WB1D 1CC1S 4KO3S 1FF2A 2O01C
chains in the Genus database with same CATH superfamily
1U3TA 5C7OO 4AF8A 5A9RA 1E8DA 1NNI1 3GLVA 3EG9A 1O3YA 2C5AA 1E20A 2EFOA 1RPAA 3EIUA 1K66A 5GVSA 3WSTA 1ENZA 5KFYA 2NUAA 4UF4A 2VYCA 2E89A 2QRGA 5DX1A 4TY8B 5D8DA 3RBXA 1ZNYA 3LQVA 1A95A 2O8CB 2IX3A 3R5FA 4CCYB 2X42A 3JAKA 1OPXA 3MJHA 4BVFA 2ZRKA 2YXDA 4KFBB 4GOJA 1HLDA 4PQFA 3VOAA 1DIAA 3KHUA 4QFBA 2QN6A 2MLYA 1E1QD 1KYVA 1B26A 1Y8QA 5FOWA 1QIEA 2G67A 4Z4HA 4CKWB 1J4AA 1OFVA 4B33A 1MU2B 4JB2A 4DRXA 1PDOA 2J3JA 3DL0A 1U1FA 3QKRA 3I61A 1TTHA 1LFPA 4R8SA 4ZCKA 5EQDA 2I7XA 1AUPA 1MX3A 4H16A 5JQWA 5H8WA 2IPXA 1UUFA 2O2CA 3CDEA 2RGWA 3TSWA 2WK4A 2V8BA 1AH2A 1IBKB 2V6GA 1OH6A 4A0GA 5DGHA 1JR6A 3N2LA 4C0WA 1U3VA 1H0RA 3JYQA 3NI2A 4A6EA 4WEOA 2ZJ6A 3GFBA 4K6CA 3RREA 3Q9NA 4FN4A 1EK0A 2ZR7A 1ECPA 3DBHA 2HQRA 1G4HA 2C4HA 2QM3A 1VQLS 3CZ9A 4BWJA 1ONOA 1TZ0A 3GU3A 3AT1B 3ABSB 1UM9B 4WXHA 3R44A 5D7NA 5SZKB 3SSQA 1G7CA 5EJ2A 3Q5GA 1JG4A 3B2QA 1T11A 4HQ0A 2HK7A 3DLAA 4EJMA 4Q3KA 2UZAA 3CEAA 5EQTA 2HF2A 4Q3DA 3LP0B 3ROPA 1AS2A 4OYRA 1VSTA 1R0AA 2AJLI 2B4OA 4BMNA 3PE4A 2W01A 5DYNA 1NZAA 4PWDB 1Z5VA 1C1CB 3IP7A 2A9FA 4M8NE 4LC0A 5T4HA 4BRUA 3RUIA 4RLQA 5I45A 4DZRA 5D5QA 3BYRA 3GUCA 1VZ3A 2ZRBA 4U2GA 2QD4A 5IAGA 1P0MA 5IG2A 4D0SA 4J0HA 1HFJA 2B7CA 1SVOA 3R75A 4A26A 5CCLA 3CBGA 1I10A 5H83A 1NLZA 1DKNA 1HDYA 2WSYB 1D0IA 1EDBA 3IKMB 1XLTC 4XM2A 3VU9B 3PEYA 3NBPB 3Q72A 1C80A 4GR9A 5IKPA 3BBBA 4LA4A 1VKHA 3CCQS 4KAFA 5L1LA 1G5RA 4QUGA 1M67A 2FEKA 5KTOA 1WL8A 4DSLA 3CLSD 3DRSB 4USTA 4MQMA 1J8MF 2RHLA 1EGMB 2WYHA 1MO3A 4AY5A 4BGIA 3UTDA 4I4NA 2FJXA 2ONYA 1GTG1 3JAMA 4UTVA 4ND6A 4KIGA 4PSUA 1L7NA 2A9RA 3L06A 3V7UA 1R0BG 3TS1A 1RQ7A 4ITVA 3DWEX 2W2VA 3ZGLA 4UVHA 1YRQA 3A9SA 3AHGA 4QAQA 3MM8B 3ELHA 3GCGA 5JCZA 2Z2ZA 1UVLA 2YIVX 2NU8A 1XWLA 5M04A 4OF4A 3TP2A 1UMKA 1N7IA 2XMVA 2Z2YA 4CCHA 2W1BA 1N32J 2BTQB 1YNSA 3T7KA 4F3RA 4JV2A 1PN3A 3L7UA 1QB7A 1MWZA 4ME6A 2PLRA 1DOZA 2WSMA 2GOYA 4FDMA 1JSCA 4Q03A 4CLXA 4PZAA 1E79D 1ULBA 3D1LA 5L3VA 1U11A 1LWFA 4P72A 2PFSA 3IR5B 4JI6J 1NWHA 2I1LA 5H9FJ 1UM8A 2V68A 3QVGA 1RWWB 4QIWD 4QYWA 2ENWA 4ZP6A 1ZJWA 4FOPA 1NUPA 2FWPA 4X7BA 3LA8A 3ANSA 3NAZA 5J4HA 4KQJA 4DV4B 3QEOA 2Y1KA 1EJ6A 3THOA 2QB5A 2DWPA 3U1NA 1XQ6A 3MWFA 2IPMA 3FCWA 3FYTA 2I91A 3GZTB 1EUDA 3SJ7A 2GCNA 3CPSA 4GBGA 4KXNA 3KPWA 1XN4A 2VK8A 4Y34A 1X8JA 4B3MJ 2O01C 2WVHA 1MB0A 3TCNA 2B4VA 5DNWA 1P6XA 4JYAF 5IZHA 3HUUA 3ILSA 3UMFA 4ZEOA 2YOFA 2Y4NA 4CETA 3CNLA 5C5CA 3WLSA 4MPJA 4DUYF 1SY7A 1X39A 4P5EA 5BSEA 3HLYA 4EKNB 2XBUA 1UFLA 3LIIA 1G3IA 1JLAA 4UARA 2YVSA 2J4FA 2WUDA 3FA2A 1WCIA 5IN5A 2Z6AA 3ROFA 1UK7A 2C98A 1IEXA 1OFHA 3J81Y 1V95A 4W82A 2AZ4A 2WNHA 2NO7A 1S1XA 3H97A 3JD3A 7REQA 3KVNA 4UHCA 4PAWA 4WLVA 1XZJA 4EJFA 4CFSA 2OGUA 4G3XA 1N92A 5I7RA 1WI8A 1KS9A 2VAWA 3E23A 3DBIA 5D51S 2Q3LA 2IBKA 1YZNA 3HM9A 1QOZA 5CVDA 3WNVA 2H4XA 4I50F 2FX5A 3TW0A 3HP7A 3EY9A 1XZPA 4KV7A 2W7AA 2REXB 4IGAA 2QLBB 2W83A 1LNZA 2ZQYA 1E9EA 2GWHA 5K09A 4ZC8A 1W5AA 4OSOA 1SQ6A 4KN5A 4JR2A 3K9CA 1VIAA 1XZEA 1CQXA 1TI7A 2HT1A 4EHIA 3QRWA 2PPLA 1HTBA 2OZKA 2BFCB 2FJBB 1H3FA 4DEZA 3U6BA 5BMVA 4DUYJ 2PSFA 4CNBA 3FSGA 3MTBA 5HE8A 2CYAA 4UHJA 4YROA 1OTHA 5BXIA 1DTTA 1TMKA 4YUYA 4QXAA 4HAZA 3ND8A 5IJWA 5CH7B 3WAJA 2B25A 3ZD7A 3OWOA 4PABA 4N54A 4LZNA 4QNMA 3FTEA 2BOVA 4LISA 2YIDA 2HRUA 3FH0A 4O4JB 4UM8B 4CLSA 4TV9B 5KSOA 4D3HA 2GM5A 3T9FA 1GNPA 1H0HA 3AJ9A 2VPYA 1CUWA 4A5SA 1UFVA 4EF6A 2Q7OE 1QE1A 3G79A 4JI3B 4YJ2B 2XOXA 1P5JA 3VR1A 3IERA 2F65A 3L3BA 4DLTA 4TMVA 3NTOA 1Z12A 4FYXB 2O50A 3HT0A 2BEWB 4QFDA 2W6JD 3D66A 1PG0A 1UWKA 3QBVA 2E7VA 5HS4A 2WTBA 4W5JA 2XUPA 1R6VA 5C8YA 4Z7OB 5EXSA 1YVRA 5CB6A 2O48X 4Q7EA 2W2KA 3OIWA 5ICGA 2BAGA 1YDHA 3D3WA 1H5NA 4RTSA 4CMAA 4CE6A 5FPTA 4WCVA 4IHJA 1ICEB 1XRJA 1Y8ZA 3OZDA 5J2UF 2PT6A 4WOBA 5KFNA 1G59A 5DG9A 3DU5A 5C18A 3NWBA 2AXQA 3FMFA 4ZI7A 1E6CA 3CD7A 2RMKA 4XPIB 3HU2A 4N6NA 5HQTA 3I2YX 2G08A 4NBUA 3A7DA 3KOWA 4Z2XA 3CVJA 1VE3A 1VG1A 3BE4A 3KDSE 3JQFC 4BJ6A 4FINA 1IBMB 1AKYA 1PJQA 1DDIA 4NBTA 4RK1A 2PJRA 5HANA 4INAA 4R3UC 1YS9A 5D8HB 2B1GA 1BHNA 4MWBA 5HKAA 1EVKA 2WPNA 1VE6A 4ZU6X 1IJBA 2MEWA 4X71A 4F71A 2HAFA 1JE0A 1JR3A 4JQYA 2JLFA 2IBMA 3QJPA 1VDZA 1E5DA 4LR8A 1SL0A 4AFFA 3BRQA 5BNFA 3RU7A 4MUGA 1V7ZA 3LLVA 4IDFA 4LDZA 4IR9A 5DLPA 2FF5A 3WQQA 1R6BX 1H23A 1ZN7A 3TNJA 5C24B 1TTQB 2QTRA 2IU4A 3OVSA 3ZBUA 1GCUA 1G6KA 4CJXA 3J7AN 1X5SA 4L28A 1N5TA 3DVSX 3HDHA 5DLYA 2OHXA 1ND6A 5HA5A 4KYVA 4ZCLA 3Q6NA 3IX7A 3ZCPA 4M3NA 4NEYA 2BJ1A 1NBMA 1TM5E 2WHEA 3DAPA 3C2QA 4UU7A 1W6UA 2DT9A 3PP8A 4YMTA 4RHYA 3PYDA 3KQNA 1W4BA 2FA9A 4X24A 2P77A 4C1NA 7AT1A 2I3BA 1EDZA 3WQHA 2QVZX 2DNHA 5CDFA 2OB2A 2W11A 4MYHA 2X1AA 3PL5A 3T5LA 2BEWA 1Y5IA 3X1DA 1P17A 1XIQA 5KDLA 4RW8A 1UDCA 4RWXA 3P1JA 2HFJA 3RFCA 2C42A 1A2BA 2UZ1A 3C1OA 3QGGA 4C9DA 1T34A 2X3DA 4WY5A 4HHJA 5C8YB 2YHUA 4M8IA 4U7JA 3L6UA 1WHYA 3FWYA 5COAA 2QN7A 3G6VA 4R2WA 1L4LA 4Q9DA 5LQUA 3IPLA 1RWOA 4HDNB 3ZY4A 5KVVA 4OXKA 1HYHA 2IOHA 2A92A 4PO1A 2GZHA 4DNQA 2MQQA 1ZK2A 1RMQA 3OEHD 3BSSA 1T02A 1S9EA 2HJSA 3GJQA 3TI7A 1BRTA 1R7RA 2G1AA 3B9RA 1GA1A 1Y34E 3THRA 2HMTA 1KWGA 1WHTB 2XNDD 4TKZA 2PS9A 5CD4A 2QX9A 3JQCA 3WAGA 4FE3A 4Y2KA 2DJWA 1DB3A 3AWIA 3U3RA 5P8WA 1IFXA 3JATA 3K70D 2BR4A 1EWQA 1H6KX 1XLUA 1L5HA 5JYDA 4TXLA 1GN9A 2KRRA 3K5OA 1L4MA 1XEFA 4HAWA 2C7RA 4DR1F 1QK3A 1GV0A 2Q5EA 4RY2A 2AGOA 3CVYA 3GDOA 1D2NA 4YP9A 3FWKA 2KT2A 4Z7YA 1HF3A 2MDAA 1M5TA 1R0KA 4CN9A 1P4JA 4DLSA 3ZIUA 3HJTA 5FNVB 3LG2A 4C4RA 1UJMA 4NCAA 3H4TA 3GONA 4QDZA 1YMVA 2ZI6A 4FX2A 1A6LA 1EWKA 4QO7A 4URHA 1GR0A 1OC4A 1ISHA 1IAQA 2BMEA 1XQVA 1Q8BA 2V4JA 3T1AA 3OX2A 4JB8A 3AILA 1U9CA 2WQZA 5ILGA 3UHJA 1HSZA 4ZXFA 2ORIA 3QG1A 4WY8A 5SYAA 4ED3A 1K3FA 3JD4A 5FLYA 1XD9A 1O54A 4X95A 3GLGE 4GQBA 1ZZEA 1L5SA 3W8FA 4LSGA 1N5KA 1E6YB 4PCLA 3GCZA 3HFKA 4RQBA 5A4MS 3Q0IA 1WKJA 4AL5A 3P5BP 3TVKA 1PNVA 2NQ8A 4ZTZB 4ED6A 3UMSA 2PKQO 3FJ1A 4EY7A 4WYLA 1UP7A 3ZS9A 3BSYA 3C6YA 4RSHA 2W5UA 3ZS8A 4YT2A 4URUR 4WIQA 1X92A 2IXEA 4I55F 4E31A 1OCEA 2KT5A 1LBEA 2RGRA 6ADHA 3W5SA 1S1MA 3CY6A 5IC5A 3TTTA 1HMPA 5FA8A 4OYIA 2ETVA 3QNMA 4N9QA 4PYOA 3WAKA 3MWDA 3MINA 1UVMA 3VR6H 4V3BA 2A0KA 4FJ0A 1Z07A 3A9UA 5CQGA 2AHRA 3KOMA 3N4WA 3ZZ1A 4D97A 1JHPA 2PEZA 5EKXA 3SFGA 3OHSX 1NW9B 1P2SA 4AG3A 1VBNA 5ENVA 1OASA 1S9HA 2IC5A 3G02A 3EWSA 1Z6YA 3VTKA 2PL3A 4A1OA 1SEVA 3H4BA 5C8ZA 3HCNA 4N6OA 1V37A 1PQYA 4RX6A 1G1AA 3OWXA 3PT5A 4RM3A 3EUEA 1G0NA 3CCZA 2VJYA 3TNFA 4BLWA 4IL5A 5J2TF 4WU2A 2NSBA 2CNKA 1RZUA 2QKYA 4IH1A 2BFPA 3RPEA 2P69A 3JSAA 5KFSA 4URWR 2R47A 3W7VA 6GPBA 4RLHA 4HN2A 1L4GA 5IYZB 2QNRA 3CF2A 4QG7A 3C6QA 4AWBA 2AVNA 4DCOA 4WVLA 4J0IA 3T7RA 4C04A 4R0NA 3GT4A 3EXIA 1ZGBA 3AQOA 3GLIE 1SZJG 4BIIA 3EZXA 3JYOA 1T0BA 3PYLA 4ZANA 5G1PA 1U4SA 1F7VA 1PJ4A 4KLRA 2CLSA 3G59A 3D2AA 2GN1A 3HNRA 3WSVA 4KKOB 3SDZA 3GA7A 5SUHA 2C2YA 4TTVA 3L0SA 1XU9A 4FT4A 1J9EA 4LR9A 3VO2A 4AN0A 3ESYA 1KIMA 1IQ0A 3LCUA 3U3MA 2XI2A 4N48A 5ETVA 3JSRA 2JLEA 2Y9MB 5CYMB 2IELA 3B8HA 3OFNA 2IVMA 4HEA6 1MUUA 4Z4FA 3PEWA 1LLDA 4QJIA 3W2FA 4MVWA 3TX8A 1BMQB 2BFNA 4RNCA 2AOUB 2BFAA 4I68A 1YS1X 4RVNA 2QV0A 4GI7A 3UYKA 5AKGA 3W9JA 2WHQA 3RQSA 2CHGA 3E6AA 4NMXA 4ARAA 3SD7A 4E5NA 4RA6B 2X7IA 2R85A 3TL3A 4OV6B 4BEJA 3VGTA 3O73A 3MWDB 1KDVA 1I3LA 1HG0A 2VQDA 4KHMA 3LKBA 3U1LA 3VRHA 2I4NA 1X2BA 5P21A 1LBHA 3EPJA 1XPRA 4K0RA 3VM6A 1T6XA 4OVKA 5E7IA 3WLRA 1M0SA 5D0EA 5B0CA 2V3WA 5IHPA 2EFGA 1UODA 3KD3A 3ODPA 2VXOA 3HUFA 3VYSB 2FJVA 2NV2B 3VBEA 3QT7A 5C7PA 3AF5A 1YGPA 1VPDA 2O2IA 4HTAA 4BO0A 3EUWA 2IX9A 4QOIA 2FUG6 2L0XA 3ENZA 5KI6A 1WMAA 5HBGA 2YJ6A 1UJ5A 4JC0A 3CE6A 5L51A 3DHXA 4XDDA 5EIEA 3V5RA 1JKHB 4LBWA 2ZJ1A 2WG1A 3HYNA 4N77A 1IXRC 1BQMB 3QY0A 3VO1A 4HWGA 2V2VA 3KPUA 2FZKB 5CVCA 4DCOB 1X7VA 1MO2A 2OEJA 2W2NA 4EABA 3PW2A 5BRNA 5H9WA 4MHOA 2OZLA 2DFTA 5TE9A 3B20A 4DX6A 1T1EA 4MK9A 1AKNA 1HRKA 3I5BA 3IEXA 2WONA 3BRSA 4V0LA 3AHEA 4WECA 3WIEA 3M49A 1DFDA 4ZPVR 3A27A 3L4SO 1W46A 4XVCA 4P7BA 4OQPA 3IURA 3LXRA 2Y8WA 4QFMA 1YZKA 4ZZIA 2JIZA 1MG0A 3TN7A 3IFSA 2WV9A 3L05A 3TOVA 2CNNB 4FLFA 3MCNA 3MXHP 4UMVA 3H9JA 4WFIA 4HXFB 3TRKA 1BMQA 5J47A 1NF9A 1X4AA 3ZCSA 1OXKB 3M8WA 1POWA 4UVIA 4KVZA 2YNIA 1L4UA 2HQ1A 3QBTA 2PLWA 4JT4A 4O02B 3TJAA 4KXYA 4EHBA 4ZU3A 2PMEA 5IXSA 3BTOA 1R6XA 4EYSA 3OR1A 1MOSA 3KVOA 4CTAA 3I37X 1NULA 4IFVA 3LT0A 4ZLNA 3F78A 1HDXA 4HGPA 2G28A 2HK2A 4L8LA 2JCSA 1E60A 1EFPB 1NYLA 2XWYA 3V2UC 2IODA 1KVTA 5DYWA 4CLUA 1N1EA 3FMGA 3VH2A 4H54A 3AM3A 1CF9A 4PO9A 3ZJTA 2HFNA 2IOFK 4RL4A 1CQWA 1IUNA 2WD8A 3CH5A 1WAMA 3K6RA 1XVUA 2OLEA 3MM7A 2L17A 2FJUA 1P5RA 4BMSA 2IF0A 4W7IA 2HT6A 1YHNA 1XZDA 3ES9A 1TL3A 3QA3E 3B6JA 3JYPA 2FQWA 2FC8A 1ZCJA 4L9WA 4N5DA 3CUUA 3C15A 3ENQA 2VJDA 3JQ8B 3P2JA 3ICOA 1WBJB 3DJFA 1O5OA 1MENA 2D5LA 2IYWA 2H8KA 1QIFA 1R5OA 4PZYA 4OYAA 2CXSA 4O63O 1F8UA 4FVTA 5JJBA 1H1LB 1SUIA 3PPVA 2EARA 1J2RA 1THMA 2BD0A 4LJ5A 4PGFA 5CLLA 4OU5A 1H8ED 3AIOA 4LHXA 1XZGA 2D2XA 5M2PA 4ECXA 5JRZA 5EL0A 4RXTA 1K7SN 5BQ3A 4Q15A 3NL0A 3ZH2A 2O5RA 3FGOA 5HF6A 3FRIA 3PDJA 1M1YB 2HA2A 2FNAA 5ETNA 4J3FA 4I2NA 4LREA 4ECZA 1SO8A 1P31A 3F97A 3RK0A 1R8SA 3I6YA 2FPIB 3V6HA 2RS8A 4CGYA 1J9ZA 1E94E 1Q81T 4OU4A 1XLWA 2KPOA 2NUHA 2H4YB 3DF7A 4K26A 5DMXA 3PT9A 3EEBA 3Q7SA 2X8WA 2AOXA 4LJ6A 5HQJA 3EZGA 2AJCA 4B9MA 3V1LA 5KNCD 3B3GA 2PMWA 1UEKA 4CMBA 4G0NA 2IZ1A 4HB2A 3FDZA 1E3WA 1NNUA 4G37A 4HP8A 1W75A 4LAFA 5BRJA 5KC9A 1D5WA 5EKUA 4MYSA 3AHFA 3A2NA 1QHYA 3H05A 3QT6A 3NKLA 4EW6A 3H8VA 2B6NA 3I2HA 1L1QA 4N5MA 3N9IA 1JIQA 1QAIA 4E4RA 2AV5A 4NULA 2ROEA 1DTEA 1JG6A 3V7YA 3K70B 2NUPA 3H90A 1ZZFA 3FDFA 4NOJA 2O1WA 2OKCA 4FPXA 1BNCA 1VMDA 4X6XA 2YKQA 3GSDA 3V8VA 3K31A 5B6JA 4HJXA 4KZPA 1X70A 3BCRA 4NF2A 2H4JA 2YXLA 3KUHA 4YAWA 4UZBA 2EL9A 2IYUA 3DRPA 2HBZB 1EDEA 2VKTA 3OFSA 2YKNA 1V4VA 2J0VA 1V8OA 1RI4A 4CR7A 3NHWA 3RTBA 1QG6A 3C8DA 3ER9A 3QTBA 4F3OA 4RYLA 4JC8A 4DG9A 3KT8A 3VR6D 4IRXA 2W2QP 1XZQA 1O95D 2XNKA 2XW6A 1QP0A 1MRSA 4UNSA 2JRSA 2VPZA 4LNAA 4KE9A 4KODA 1C4KA 2GC8A 4PW0A 1QH0A 3AIIA 3LWBA 1L5GB 2FSHA 2VDWA 2FPGA 1HNXF 3BOSA 3EMDA 2YVQA 1M6YA 2Y8YA 3GBVA 4KYZA 1MNQA 4KVAA 4JJIA 2XOKD 3TIVA 2ERCA 5D7BA 2C07A 1UP6A 3A12A 1YQUA 5J9FA 4REMA 3W2IA 1ZJ5A 3KTFA 1TB4A 2XY7A 2DHXA 1RHRA 3N0RA 3EXG1 4UPDA 2YHSA 1DC6A 5A4JA 2XRZA 4LF7B 3S1AA 3HK2A 4CTKA 4IDNA 2HX1A 1ORVA 3WL8A 1N3BA 2ZAYA 4JJ6A 4M21A 1X1CA 3QTLA 2R2RA 5B4TA 4AURA 2BKAA 3M4XA 1N8RT 1NF3A 5CDGA 1ABFA 3IR6B 4P6VF 2H5LA 3SE0A 1X14A 2ZC3A 3TVDA 2XD9A 1G5PA 3ZI4A 5AVKA 3OQOA 5BOSB 2NSLA 4NX9A 4UBLA 5IQQA 3BFKA 3HXKA 3ET6B 1RXEA 1CT9A 1JTFA 4OLBA 4RK7A 2JLQA 2Q3CA 1FNMA 3EBPA 4ZAFA 2ZDPA 4WD3A 1GKKA 1XJQA 4Q2MA 3RYLA 3MYYA 3JALA 3NJ4A 1DARA 4Q3CA 3LDAA 1OPRA 3HUEA 3OZFA 2PGIA 4DIEA 2BLLA 4CKCA 5JAMA 1XDBA 5CA0A 1GSAA 1WACA 3ZQKA 2V3VA 5K0BA 3BREA 5L46A 1V1RB 3I01A 3VTFA 2VNHA 1FYFA 3E9CA 2A5GA 4O2BF 1X9WA 3D2CA 2IKSA 4KREA 2Y1WA 2ZBUA 4MWZA 4YUVA 4PN3A 4GKAA 1CJCA 3S7TA 1VPWA 2NZWA 3UY4A 2GA8A 3UC5A 1YITS 1Q7TA 3PYFA 3DDUA 1EHWA 1PV4A 3HP6A 4JBHA 4MUKA 4DRYA 4RTLA 2GHWA 3QLVC 2YKMA 4NA3A 2OI2A 4RA9A 4ZYLA 2JRCA 5GZ6A 4PINA 4PAAA 1DT5A 4RVCA 4A3SA 5JXJA 4KFRA 5FUMA 3DFKA 4JI5J 4L73A 3EEIA 2I2AA 4ZITA 3GBSA 2ZYDA 4BN5A 2MQMA 3WX0A 4GXNA 3V48A 4AN4A 4DCNA 4I1IA 4MAMA 3S1SA 2BCEA 4MR8A 5A0YB 5F77A 4AICA 2PKYX 4C87A 1AD2A 2FFJA 4TWIA 4YR9A 3WQRA 1CEXA 3LY7A 5K3BA 1L5QA 1SKYE 2ECQA 1S76D 1JXEA 2J31A 2CY0A 2QR5A 1VHTA 4DM4A 2IYNA 3BFPA 4NI2A 3LQRA 5IT4A 2XO6A 4JAVC 4XM1A 3IOBA 5FRDA 5LMNB 1II8B 1C41A 3DL4A 3LP1A 5IF9A 4F85A 5F8IA 5HE9A 2FMIA 4J1TC 3DVLA 2YN0A 3HKDB 2F4VB 1MHPA 5T6BA 3L0PA 1SXJB 4BB6A 1E18A 1L5WA 3V55A 3Q8SB 4YEDA 3F5SA 4RGQA 1BDBA 2P2CA 1HYSA 2C83A 2WUFA 3T1HB 4MV0A 3GJSA 2BKXA 2POQX 1VB5A 1FFWA 3NDIA 2YRFA 5DHQA 3HXOA 4K9NA 5AR1A 2ZSFA 2O6LA 2Y1LB 4XASA 5CK4A 4OK6A 3SYTA 5HX7A 4II7A 3OJCA 1XUOA 1GFSA 4NONA 1VHDA 2IPOB 2X13A 1B3RA 1H0SA 4BO7A 2GSWA 3EGDA 1U6IA 5HP4A 4DMLA 3V2HA 1OSDA 2H1FA 2RGXA 3TM4A 2FX2A 4MQLA 4DMKA 3IJRA 1DJQA 5IUNC 4ZMRA 3MCUA 3ICQB 4AJNA 4XJVA 5KG3A 1WULS 1FQWA 3AA8A 1VMIA 4QHYA 1S7IA 4AROA 1YRUA 3OCJA 2CHVA 3GJZA 1HFWA 4R05A 3UG6A 3SLRA 2JIPA 5AE1A 2YNHA 4UUQA 2XCLA 3W9UA 1W30A 3R5JB 1W29A 2YWDA 2NVUB 3KXIA 2R00A 2W58A 1A8SA 4BDPA 1KO7A 3I53A 4MI3A 3BXGA 4DR6B 4P2GA 3CZPA 4ASUA 2QYOA 1KVRA 2EVZA 3TL2A 4A8KA 2BMJA 2GAFA 1BEUB 2VFAA 2CL6X 1N6OA 2BELA 3FBTA 4PXAA 3GUZA 3NW9A 3O1LA 4QW8A 3L7NA 1VKZA 1M8FA 1ZA2B 4JN6B 1WD7A 1RYZA 1RHMA 5H9VA 4NPCA 1C5KA 3S2YA 3DZ8A 3HB7A 1U2ZA 3PACA 2FLKA 3RFVA 2NXCA 4X84A 1T9YA 1N2GA 1RKQA 4BFCA 3D5MA 3RASA 2C20A 3KOXA 2CUZA 4TUYA 2CQHA 1AXEA 3PW5A 3BO3A 2FLPA 2VG7A 4ENSA 2XBLA 2C92A 4CLEA 2O1SA 4J9VA 4A8JA 3MF4A 2IKQA 1EK6A 2PMHA 3M9WA 2QZ4A 2QTLA 1XBTA 3C14C 4KVFA 3U39A 2WCXA 2QTAA 2QU7A 1O5TA 3WWCA 1K4YA 2DLCX 3B3JA 3MCMA 4MUMA 4HUTA 3N3AC 3AZOA 2MSWA 3NT2A 5KFCA 1LBSA 2NPFA 1UA1A 1RLOA 4NYIQ 4DC1A 1SH0A 4Z2YA 2WFAA 3WZMA 2KI2A 1GNSA 2I1VB 3KLPX 3KWFA 1KYIA 1P9NA 4PHFA 5KKAA 4LF8J 1T5IA 3MM6A 2HD4A 2YNFB 4A2CA 4DC9A 1GN8A 3FCOA 1S1TB 4HI0E 4I67A 3T54A 1T8EA 4NNJA 2LEPA 4R2LA 4YI5A 4L0CA 4DSKA 3I45A 4DMMA 2Q27A 5ETTA 2C3UA 2RG7A 3ND6A 1II0A 1YASA 5K14A 5FP0A 1FRHA 1DKPA 3JXOA 2PE8A 1KYTA 4RUCA 3NHFA 1TMYA 3VCDA 3VV3A 4JZYA 3R5JA 4GO7X 2Y93A 3D2WA 2A35A 2I29A 3ZLBA 3SG0A 2YWWA 2DXDA 2DHRA 4ITUA 4ODIA 1EXVA 1PJZA 4K5QA 1QGOA 3HMQA 5BYRA 4QDUA 3PQ3A 1FDRA 3GVHA 1KVIA 4EFNA 1VPTA 1UMBB 2FUG1 2FWJA 4R8VA 3UHFA 3D3NA 1CY7A 1W2BR 1FRVA 4U96A 5G0SA 2A0WA 1NQWA 3DOEA 1WC1A 3C8HA 4D9MA 1TPZA 1SG6A 4CTJA 4NLDA 3CSKA 4YCAA 4X85A 3UNXA 4UD2A 1HNXB 1CUVA 4CT9A 5JDCA 3R0JA 1WHTA 2J5QA 2AB0A 3DTYA 1FSSA 3TRIA 1QIMA 1T36A 1NXSA 2IAJB 2H5IB 2BACA 4FUQA 3RIXA 4R54A 3RFXA 1P18A 3U7QA 3ILHA 3SVLA 2V54A 3BX1A 3ZZTA 2WTAA 3WHLA 3TR5A 5GY7A 4OP1A 4RWZA 7FDRA 5C80A 3GOQA 1HQ2A 3TUIC 1F12A 3CX4A 1GGEA 1NK0A 2E5GA 2HGLA 4CZ2A 4DA9A 5TVKA 1XRRA 4ATNA 2J48A 3QSYA 2EP5A 4UMEA 1WB4A 5J5AA 8OHMA 3KZ1E 5LZ5A 1PSWA 1Z0UA 1Q0UA 1ZCAA 2GXSA 4CPDA 1F17A 2V8VA 2JFGA 1BHO1 3I5XA 4ID9A 3PFNA 1Z4NA 3QHQA 2OFPA 2X41A 2V94A 3I2FA 2DGSA 4DBZA 5JYBA 4S1PA 4FFVA 5JNLA 1RBMA 1E7SA 3SX4A 4JI0F 2AEJA 3ET5A 1OTXA 4CLHA 2R68A 2HQFA 2PXHA 4HNAB 1RZMA 3I8SA 4HDKB 4URVR 3T7JA 2ASYA 4Y6RA 2C99A 2JIOA 1U6BA 4PLPA 1DPFA 5LC1A 5KWJA 4UNQA 5ALOA 1BSVA 2Q0XA 4BN4A 4YP3A 5JTUA 5HF8A 1TGVA 1GTRA 1G7SA 1VGQA 3O8CA 4XRRA 3EDRA 1I2CA 4O2BB 4QDOA 5EHQA 4JYCA 5JISA 1HLPA 2ZH2A 3NBMA 5NLLA 5BNTA 4RW4B 2QX4A 3VGVA 2HHWA 2AN5A 3AEUB 5HKOA 1RI1A 1P9YA 2Q3PA 3RVJA 2HPZA 5IVIA 2EJWA 5LBUA 1NKCA 2V98A 3S40A 1ZUHA 4WEQA 4QYIB 3RYIB 3G13A 1ODKA 1T8YA 5HOQA 1SJQA 3CRW1 1KP2A 4LXUA 4IDHA 4TTTS 1QH1B 3I9V6 4XJXA 1GGHA 3JYNA 4E32A 3FI0A 1JIIA 1ZGCA 5DTMA 3KKOA 4RMNA 1T4MA 4E5SA 2Y76A 3CRNA 1N2OA 4MR7A 1UWBB 1W581 2CKDA 1IJEB 2LA6A 3HR7A 6REQA 1NJ5A 4WKCA 1AUVA 3SZ3A 4NLYA 3VZRA 2AFHB 2R7MA 3OUYB 3OXFA 3SFZA 1XYVA 2RGUA 3JTPA 1KP9A 3NXZA 4EGCB 3CKKA 1Y7PA 3QFSA 6YASA 2VG6B 4WLUA 4KR3A 3FNRA 3W6OA 4C48A 2O3DA 4J5OA 5DDIP 2PWYA 3GH1A 4C4PA 1THZA 4OLPA 5BSHA 1XWIA 4ZN3A 2VG5B 1EWTA 5BN5A 3DOKA 5ELXA 3G89A 1U31A 4FP9A 2HPHA 1XCJA 1T3ZA 4UOEA 2OQIA 2IZ6A 4C5BA 1JHZA 3R2JA 4BMPB 1RJ9A 2P8IA 2PT9A 2WOMA 4FGZA 3K92A 5GADI 3HJAA 1VA5A 3EOZA 3CINA 4NZMA 3AY6A 3CO0S 2ZEJA 4HDGA 1UPAA 3A3NA 4R3WA 2M0GB 3KPJA 1GQFA 4XDCA 2AFIA 1L7AA 3KVVA 3RDPA 5K0JA 3PNVA 2IC3A 1UFKA 2QDKA 1P2GA 4EI9A 4NESA 4EK2A 2GILA 3CC4S 3ORHA 1NWCA 2MQNA 4KR6A 1HYEA 4WK0B 1CEZA 4X8LA 4UVGA 3HWRA 2CJFA 2FMHA 2CRLA 3EA0A 3RQIA 2DITA 5DPMA 1R6UA 2WD9A 3IVGA 2MSSA 3IP5A 4RSMA 1SHKA 3OIVA 3DM5A 2V8GA 2C2GA 4MDFA 1ZUWA 3F2VA 4EZEA 1ESEA 3BTUA 2CNLB 3DMDA 2NNLD 1MT0A 2VN8A 5ECDA 2IEZA 4MPTA 2PEYA 4CU5A 1N32F 3FNFA 3BGSA 4QW9A 5EMHA 1GXLA 3FSRA 3PVXA 3ENAA 3LCMA 3GG1A 3D0OA 4PZCA 2NLWA 4A8TA 2PVPA 1YR9A 1R10A 2JK0A 2G25A 1I36A 4RMGA 3VSEA 5KYTA 2MMCA 1DO2A 5J2PB 4N76A 2AFRA 3TLBA 5KOJB 1DELA 1ZGGA 1PIEA 1VJCA 4ETMA 5IS2A 3BM5A 1KO4A 2QD2A 4HKTA 5KBYA 4EQ6B 1W36C 2UVDA 3BJMA 4DSUA 1LCIA 2J1LA 2QMUB 3IAUA 1JMTA 4QECA 4QUBA 2ILTA 4UXJA 4OJYA 4XWKA 4S0ZA 3D5TA 4MMXB 3E2PA 2WJ6A 4HFRA 2B6AB 3DYAA 4QOSA 5D4OA 2VSFA 4FUTA 3ZKWA 2UXDB 5EWMA 3CG4A 3EPHA 3ADPA 3VNQA 2Z2KA 3NAQA 4PZ9A 4BHQA 2VP4A 1RTJA 1EK5A 5L4NA 3WX8A 4NXMJ 4LZAA 1RMYA 3D4BA 4GLBA 4ND2A 1VMEA 4HY3A 4CM9D 1KI3A 2GZ3A 3AF1A 4NLTA 2E85A 2IYLD 4DV7J 1IXKA 2O1EA 5JH7A 3I5YA 4F6RA 3PDIB 2PUWA 2I5JA 1MH1A 1L1EA 4BO5A 3OV7A 4WOJA 4BDTA 3G2PA 3DLJA 5FKJA 1J7JA 2PX3A 3PTLA 5IAEA 4DR5B 2HHPA 3RW9A 1QANA 4WFQA 1JYSA 3B5EA 3DFZA 3PKYA 3SXUB 4C88A 2A3JA 3K94A 3U1MA 1P0IA 2Y71A 3GUHA 5ED0A 1LFAA 1OLUB 4CVNA 3KKPA 5KJEA 4YAEA 4ECQA 2LPMA 4IQGA 3FE2A 4DV7B 4XD7A 1TCVA 2ZRQA 5DT2A 3TL6A 2Q4BA 4QJ5A 4AUKA 5BR8J 1K9SA 1U99A 4OBEA 1WEKA 4EUFA 3OUZA 3K89A 2YXEA 1MRNA 1UKVY 5E6UA 4XE5A 4MLPA 5E4YA 3HF5A 1H2UX 4KH0B 3NHUA 4JLWA 2WYOA 3KEFA 3CUVA 2ZJAA 4OK3A 4HDMB 4RGVA 3E9NA 4GYYA 1W36B 2G76A 1NXWA 2FG5A 3MM8A 1IOLA 2XBPA 3MELA 3WS7A 1QC5B 4Z7CA 1TJYA 1W9MA 2CFOA 1IY9A 3WMXA 4UCFA 1NSFA 2QG9B 4EAAA 4YRSA 1WCWA 4MICA 1KETA 3TA1A 2RE1A 5AH0A 1GEHA 3THPA 1MP0A 3T7AA 4ALNA 3GU0A 1X9MA 1QG0A 2ZYRA 4I6GA 5EWMB 2M4MA 4PQUA 3UN5A 2NR0A 1T8UA 4K03A 5CXXA 1GP2A 1ID8A 3MUEA 4WFAQ 2ZSIA 2R7SA 5KOYA 1W5FA 1P7YA 1NG1A 4H31A 4HT5A 4DUGD 4C7OB 3M5WA 1NDPA 5FUVA 1RSCA 5H7XA 5GV7A 4M2LA 1VQ7S 4RGYA 1T6BY 1SZCA 5IXYA 4CG1A 1RFGE 4RD4A 3IAEA 2WICA 4BVBA 3LT2A 4TKVA 5MAOA 2UYYA 2GZAA 2DG2A 4GLOA 3RG2A 1TO2E 2E5WA 3FHJA 3OTOB 1FBTA 2F1JA 3ELUA 3S44A 4BMCA 3DZGA 3B52X 4F2PA 5FBVB 2KJWA 2XD4A 3M5DA 1KO5A 3RR2A 4GO1A 5U9CA 4M9RA 5EJEA 1SV5B 3NDRA 2IHNA 3C3BA 4KE8A 2XNRA 1V11A 3OY7A 1UOEA 2J0UA 3ZU5A 2QPTA 1QCYA 1KDYA 3C7AA 3KG0A 1J0EA 4L4YA 4JI0B 3I4HX 2Z5LA 4RESA 2UXCB 4J1SA 3R3TA 2Y4OA 3SM9A 2Y8EA 4MYRA 2IFXA 3HJNA 1QGUB 4P73A 4QPNA 2V7UA 3PFWO 2KHZA 2RU9A 4WFJA 2QL6A 4UQLA 3NEYA 1FHTA 1JDBB 3QPVA 5FH9A 3UWTA 4ZOLB 2QYTA 2HVIA 3CZCA 4L76A 3CUTA 2X4IA 3NYRA 3BBFA 1CJVB 2IXGA 2JLYA 5AW8A 3EGVA 1QLHA 1XK8A 5LJ5Y 3OUTA 3WNQA 1R8HA 4QU9A 3PGVA 4JWTA 1UPMB 4AM8A 2YY3A 4X61A 3BR8A 1RM3A 4J29A 4D9HA 1FKPA 3NDPA 1U0TA 5K2OA 2EKDA 1UDAA 3JASA 3SM3A 3I39X 1AJEA 3KELA 4O0IA 2DCUB 4YPVA 4GU5A 4HNTA 4RMJA 3EQ6A 2I2FA 2UUAF 4G0XA 1N57A 1TM2A 1NR5A 1CF4A 2HSGA 3WQBA 1K68A 4FPRA 4K88A 1K89A 3MTEA 1F2TB 5JXWA 1P1RA 4LHVA 4ECYA 3OPYA 1YH3A 1V5WA 3AFGA 1L9KA 2IP1A 5CVEA 4F4AA 1G8SA 1ETUA 3EW7A 1NPKA 3NGUA 5L1IA 3PRHA 1YIJS 2G5GX 2NG1A 1R0CB 2A5YB 2YV4A 1UINA 3DMFA 5KNCH 5C35A 2QAGC 5M29A 1LK5A 5FORA 1E2JA 3IAM9 1DTTB 4HYKA 3ZHTA 4C4ZA 4RS4A 1AV6A 5K9ZA 4HNQA 2KZMA 1PYDA 2H57A 2H63A 2P3LA 1FTSA 2VKQA 2RNEA 3GDHA 1NXVA 2AC7A 3VJRA 4R41A 4CF4A 1B8VA 3CDBA 3RT9A 4NICA 5MFPA 3NU1A 3PEUA 4OD0A 5A0FA 1YZQA 5M2QA 1E2KA 2PMKA 3T5CA 3CCES 4B3MB 3LF0A 3WI7A 3DQPA 1BCSB 2CJQA 3WNDA 2PZMA 4WK1A 1KI2A 3E5NA 3AHJA 4JBGA 3B1XA 4DIUA 1NR7A 5HKLA 5LU9A 3PRYA 4MYCA 1MAVA 2ASDA 3EXEA 5MFZA 2PGLA 3JWJA 3N2KB 3G17A 5FIUA 2JGDB 1ZNXA 2H31A 3M1LA 1EQUA 2GJAA 3GEIA 4ZO6A 2VJQA 3AKDA 1YRLA 4ALMA 4Y1FA 1DQPA 5T4EA 3VHXB 2KRBA 4U95A 5I7WA 4JUDX 2ZE5A 2IYGA 1TNDA 1WTBA 3ZHQA 3C6TB 3H11A 1M90T 1NK8A 3IMFA 4JB8B 5C3UA 5G2OA 1T1GA 2AMVA 4BY9E 4Y1RB 4ETIA 5F8HA 2BA9A 3A1UA 5J1NA 4Q4AA 5IBCA 2MJLA 3QWUA 5DNEA 3G2QA 3G0GA 3PB3A 3GJ0A 4BBJA 4MB2A 1GL9B 5J2NA 1GT6A 3E3XA 4LYGA 3VJMA 3HBFA 2VYNA 2TRSB 1E1RD 1ROFA 1WCV1 4NBLA 3LRTA 3LLCA 2GZ2A 4M46A 1G9SA 2Q62A 1BA3A 5EE0A 4NG4A 4ID8A 2B0GA 1G8GA 3TX6A 2QEXS 2E5JA 4EW1A 1U2FA 2JD2A 1H2TZ 4TN2A 5ALJA 3GD5A 3W60A 1COWD 3PUKA 3SQWA 2WJAA 1F60B 3KFLA 2VJBA 1XVIA 2ETXA 7GPBA 1JQ3A 1DQYA 2WE8A 1MJHA 3C7CB 3E70C 3DE1X 3F5DA 1E1CB 1NBME 4S1TA 2QLMA 3VNSA 1IBMF 5K99A 1ZOIA 4W9MC 1S0VA 1YI0A 2R3VA 4FJ1A 5BSFA 3MG9A 3QWBA 3T1QA 4H6XA 3HDVA 5H80A 1IONA 1LLQA 5GJBA 5CMLA 3GLKA 3R0IA 2BF4A 1J1ZA 3O1JC 3GFZA 1JZSA 5FUWA 4ZP8A 4OM7A 3HFVA 1SRQA 1TQ8A 5CDTA 2JLXA 1ACLA 1MSWD 4S35A 1Y5IB 1M2OB 4B6QA 4KQZA 3PSAA 4IOBA 4TKLA 4TYMA 4C6SA 1Z5NA 1PJ5A 2B78A 3SCIE 4PR3A 4WZBB 5FPPA 2ZVQX 3VHXA 4II2A 1Z5OA 1RYFA 2X23A 3BRCA 5JLJA 2FW7A 4UPVA 3GLHB 4YRFA 2VBGA 2PIDA 4XDYA 1H2XA 5H1SV 3R5HA 4NCHA 1V41E 1TKCA 3U6KA 3MWEB 5FBQB 3VJKA 2XBMA 2BTOA 2NQ2C 4NVRA 1X9SA 3AP1A 5AE3A 5TPZD 2GCEA 4LZZA 3WOVA 2F3PA 1ZJYA 1J2TA 1FNOA 2GKGA 2VUIB 2ABYA 1R0XA 3H0EA 4Q4AB 4PNEA 3AB8A 3CR8A 3SZRA 4WXMA 1RPJA 2MHNA 1UADA 3D0RA 3O8OB 1PNQA 3KQTA 3UT5B 4DLGA 3GJSB 3QIAA 2YHIB 5DIFA 2IDJA 1QAMA 2QS9A 3ZFVA 1K75A 2QORA 4W1SA 3VYUB 2AJ0A 1J0BA 2WINI 2EBFX 1CJSA 4YFVA 3GXBA 4EECA 2Q5FA 4DSIA 4HQFA 2H4FA 5CFQA 4IJUA 2E2WA 2XYQA 5C1PA 1Z0IA 3LHFA 4WPGA 1S77D 1J33A 3HDQA 4LSNA 2J0QD 1ODCA 4LWQA 4OV6A 4FWTA 4JI2B 2ZI7A 4ZT3A 2IYQA 3ZD8A 4P2MA 4WZAA 3BCSA 1JPNA 3LQFA 5I8ZA 2CNDA 4HDRB 2RCYA 3TJ8A 3X1MA 3R6DA 4F4ZA 2V9ZA 2XTAA 4PYKA 3VPXA 2NXJA 3QENA 5AKLA 1LDGA 1FQKA 2G8LA 3OIUA 2DKNA 1K0FA 5EPUA 1NX6A 3M2RB 1R27A 1XNJA 4FWBA 4HLNA 1BDMA 2WLSA 4O23A 3G7NA 1CY1A 3M6WA 2YY5A 3OTGA 3TKAA 3H5TA 4IUYA 3GIWA 4OI1A 2GVNA 1NAQA 4R51A 2Y9PB 4WZBE 4UCXA 2DR8A 1Z4LA 1IQUA 2L41A 1U7UA 1IEVA 2W00A 4OI2A 3ZJYA 3HHLC 1QX4A 3AUFA 4TUYB 1D2GA 2JEIA 4EGSA 4B3DA 1IG0A 3ZX4A 1UA0A 4UBMA 2R00C 3KEGA 4PC6A 3FKSD 3IUNA 1IUJA 1QLWA 1JLFA 2WJVA 2CWKA 1G1MA 1EXWA 5ARCA 1W36D 4Q7KA 4D3DA 5IFLA 1M2NA 2M70A 4K9KA 3LC0A 2CZCA 3JPWA 3C6UB 3R5XA 4XEHA 1KC1A 1RI5A 4X44A 1EBUA 3KQLA 1FVSA 2HZBA 4W9RA 1WI6A 4LZLA 4KVGA 4JSRA 3DRRA 3FRZA 4OGGA 4URFA 2PANA 1VXOA 2CLCX 4HCJA 4E14A 4YAGA 2B94A 4RQAA 4ZPCA 3IPAA 2BKLA 3LC7O 4MMYB 3THSA 1A96A 3QMWA 4HYEA 1LDEA 2FEPA 4NK5A 4JCOA 4B5KA 3WLOA 1JLHA 4ZTUB 4O44B 2AWNA 3FZ2A 3CPEA 1BRMA 5AI8A 3VZIA 3AH8A 2GQ0A 1FK9A 3K5IA 3LX6A 3KSZO 2P68A 4D3FA 1IQRA 5ELMA 2PTGA 1URNA 5LP6C 1G21E 2AEEA 4OI6A 3SHTA 4P74A 3WDMA 1KR4A 5LQAA 2HM7A 3EXIB 2UUAB 4J1TA 2PA3A 3E8MA 1W93A 2CC2A 3HP1A 1O6ZA 4K40A 1VOMA 4USHA 1GRCA 1EZZA 1BWQA 3Q8UA 3ZHXA 5IC4A 4KTQA 5JVGQ 1EJ2A 2DP4E 3FB1A 3Q8VA 1T2CA 2YNGB 4S0XA 5AD1A 2YYSA 5ES4B 5KX5A 3DVQX 1WY5A 3Q7TA 3UWSA 1A9PA 1PR4A 2EBWA 5EZYA 2GHVC 2VICA 4P7TA 3OJWA 4RU2A 3W9YA 2OHHA 4MCAA 5U4XA 1BC5A 5EXTA 4XQCA 5SYNA 2NVBA 3F1LA 3TVZA 2VDUE 4ALIA 5EIXA 5HWSA 2BX6A 1XGKA 1KRPA 4HEQA 4PVCA 4UFOA 5MN4A 1O5IA 5CLFA 5JAQA 4WWHA 1BVRA 1J5PA 1H1LA 3R1HA 2FPLA 1QYRA 2VHGA 3QKUA 2WILA 1PFUA 5H9EK 3L4BA 4G01B 4K4WA 1OOEA 1PTKA 2FR8C 3IS3A 5KFOA 1NPTO 2ORYA 5BW8A 2GEVA 4R5PA 2WJJA 5NULA 1E98A 4GMFA 1IHXA 1XZ8A 2PXXA 3U62A 3I2KA 4JU9A 2GDZA 4RCZA 4GGPA 4CIDA 3AFNA 2VPWB 3Q87B 3C6ZA 5I9TA 3NNCA 4Q4CA 5EA2A 2KX7A 4ECWA 1IMJA 4QTXA 4UM5A 5B09A 4B02A 2XMMA 4YT5A 2DNZA 5KOWA 2DUJA 1PWXA 1JDSA 5KHLB 3HBJA 2O4UX 1W73A 2IOQA 3LKZA 3C8YA 3VTAA 2MYPA 4KSBA 5EAIA 3SU8A 2E29A 4O1MA 3MCWA 2IS2A 1K9MT 3BCUA 3VAJA 5DHAA 3N0XA 1TUEA 4AMUA 5HJ5A 2BLNA 2BFBA 3T5TA 2GS8A 1GEGA 5CHEA 2OCDA 3SHFA 2J6SA 3G5AA 3OQPA 4QU7A 2XCQA 5I9NA 1WKLA 2EFQA 2HFVA 1M6NA 4UBOA 2PGDA 3LLSA 2J87A 4Y6SA 2WB4A 1SBQA 3CM0A 3PLRA 1NZJA 2CKWA 4JLSA 4V0SA 4X66J 1QGDA 1M3SA 3E3NA 1RWMB 1KL7A 1UWVA 2JVIA 4CQLB 1RCXB 4R98A 1DLJA 3UPTA 2C2WA 4CUZA 1U0RA 5B2FA 5C42A 4FC7A 3DP7A 3HKEB 4BAZA 5AVXA 1UVNA 3DDCA 4QUDA 4QYIA 4I6AA 4RJIA 4R5MA 5JOQA 4GRAA 3VDXA 3R6TA 4JJZA 1Y3BE 4JJEA 1EM8B 3CD0A 3M83A 1O97C 1BXRA 4USJC 4NCGA 4HB0A 1W1IA 1LU9A 4F0KA 1Y6ZA 1UJ2A 4I4TF 1IM2A 2O8FB 2B3DA 4M5HA 1YQQA 5J4LA 5GPBA 1LH0A 3P9SA 1AUXA 5HIAA 3OT4A 2CL0X 1C3JA 3V9PA 4TN1A 4EYKA 1F3VA 2O8EA 5JS2A 2BQ3A 2WUGA 3A7EA 4RVUA 5AHWA 1KQPA 1U0HA 1RP5A 2FK8A 3OQHA 1IBCB 1XCOA 2PKQP 2YBDA 1UPPA 4CFYA 4IH5A 3NYIA 3SIWA 5A0TA 2OBFA 4FEEA 2XMRA 1CERA 1GNKA 4IDQA 3KK1B 2OBBA 5B55A 1MQSA 3O4IA 2JCGA 2GRJA 3OLQA 2V7PA 1Q5YA 2PR7A 2JJ4D 1XP5A 5LDDC 1OHHA 3WA6A 1SOVA 1TD9A 4LY3A 4X41A 1T5SA 1UOOA 4YCCA 3OW2R 1YR2A 3K9LA 4OA8A 4JBYA 1J5EJ 3S2ZA 3ILLA 5FAKA 3IUYA 4ER3A 1V8PA 1J5EB 2ICAA 5EPEA 2HDWA 3KFWX 1SBHA 1F6BA 4FFMA 1YI2S 1J9GA 5TF4A 1NXQA 2CNWA 1MB3A 2XRYA 4OLHA 3AV0B 4L8WB 1VFNA 3N05A 4EL5A 1U8YA 2KJVA 3MPDA 2BC9A 2BEKA 3VALA 1N34B 1XROA 2G5CA 3DXYA 5CFNA 2B5WA 1C30B 1FU7A 5BWLA 3GJ5A 2DIVA 1FX0A 1CR6A 1P73A 1A72A 4C0JA 3TR6A 3RFTA 4IH7A 5DB4A 1J21A 3W5CA 3R24A 3ORQA 3OM8A 3R2DJ 1ESDA 3CGWA 4H6VA 2RB7A 5K8MA 2JC0A 3LTNC 4CKCB 2P6SA 2FPIA 3AY7A 3LO3A 2I0XA 3HA5A 3RODA 5JNVA 3O2SB 2ZYHA 1UBFA 1UKBA 1WUJS 3GPLA 1QAOA 2EGUA 2HEIA 3HBMA 1MA3A 3GFVA 3B51X 2XMBA 2QSYA 1UBSB 4JI7F 1T35A 1XDUA 3T5KA 3FZBA 4XAQA 2V55B 1SXPA 1OILA 4RHEA 5JDIA 1JTEA 1N6PA 2ACVA 4BMDA 1UCNA 1LA2A 2WIJA 2O8EB 2WM9B 3WB2A 5I9BA 1RRVA 4QTTB 4UUXA 4YP5A 2VU5A 4BYMA 3L46A 1YZ3A 3QPWA 5I3ZA 1K8YB 2XT6A 4IJQA 3JVIA 1S8NA 3TSCA 2J3LA 3CJ2A 3ZV6A 1CTQA 5KCMA 7MDHA 5ICFA 3G8SA 2FZGB 4X64B 3PJXA 1UPTA 3OPMA 1T03A 3HD2A 1J42A 4TQ9A 2C57A 2PKWA 4MYTA 1QE3A 1GKYA 2QRZA 3MOJB 1JEDA 2VCHA 4ZI7F 4LF9B 2XODA 2DETA 1Z35A 5F3TA 3K73O 4N12A 3KLIB 5K6TA 4OP3A 3L77A 5DTEA 1Q83A 1JJBA 2GJSA 4B35A 1RXVA 5AT1B 3L0OA 3HHPA 3A1DA 1RTJB 2IFTA 1OXMA 2PWZA 4Q12A 4Q7LA 3F5FA 2OV2A 4AZ0B 5IM0B 1OAKA 1NSPA 1G60A 3HULA 3EQ7A 3RRZA 3GT0A 4R40A 2VYVA 2WMNB 1H2ZA 1OY6A 4Z1MD 3K71B 1CQJB 3WNZA 4JMLA 1PS9A 4AJ1A 4RSGA 3JX9A 1OWPA 4OSPA 1ANKA 1JWLA 2Q9CA 3ZV4A 1K8RA 2YKGA 6AT1A 3D7KA 5TX7A 1NVKA 2HZAA 2GK6A 2DEIA 1ENPA 1Q0QA 2MMGA 3VZDA 3K0CC 3CB4A 3D6MB 3R5KA 1TV6B 2VG8A 4ZVOA 4CH0S 5AE2A 4LBIA 5JBNA 3NWRA 4MAFA 2V0NA 1X4GA 2GZMA 3V4LA 2G2OA 2EEPA 3TUPA 3OLZA 1KQGB 2GVDC 3A0UA 3R9KA 4PYIA 4U02A 4G5YA 1Z4OA 4QPXA 1WKCA 1WLSA 1F2GA 1P1CA 1PL6A 1LXNA 1MGOA 5DZSA 3IEVA 5D6OA 3PHJA 1RLUA 5TT1A 3PO5A 1EVLA 2YH1A 4LRTB 1DIOB 1WLYA 1V35A 4XK8C 2DFKB 2MKSA 2EJBA 4CDMA 4ZP7A 2ZR9A 2HADA 1GUFA 3O9MA 4TV8B 3A8KA 2R9LA 2VT7A 3W4KA 4OIFA 2D7SA 4M7RA 5KJCA 2AUNA 1D0EA 3P52A 4YJ2A 1QAYA 1SA0A 5BOSA 1MG5A 5KMGA 4U2BA 3ZD9A 3QJLA 4ZK6A 5IZCA 2DBVO 2JLGA 1DIGA 3PXEA 2AWZA 4S3MA 4P82A 2YNHB 3OICA 4LCBA 4IGEA 3LCRA 5BSMA 5JBIA 2LU2A 1FXWA 1JLAB 1ESNA 4FXDA 4DUZB 2BGKA 2MQLA 3CT9A 1XKLA 1ZZNA 4DF8A 1EUYA 3KOOA 2AE2A 4F5WA 2C29D 3HDYA 4IHJB 3D8BA 1XFDA 5BN3A 3KT0A 1DZ3A 4ZGWA 1ZGJA 2HGNA 3OL6A 4UCQA 1LVHA 4GUAA 1WDDA 2QFIA 4ND8A 3FYSA 1HPLA 5EQJB 4CM7A 1SVMA 2AW5A 2M3DA 5DOZA 3NANA 4L16A 3QX8A 5F12A 3JD2A 2QVCA 3OCZA 4RPLA 1DKRA 4IKPA 4DCJA 1I3NA 2HAEA 3DM2B 3S27A 1UIRA 4N7TA 3ANLA 3F6SA 3D6MA 1E6WA 4DQLA 2COKA 3V8EA 2GFFA 4XJSA 3JB9k 4CYUB 5LQNA 3PFCA 3PC7A 4MUIA 3TPZA 3VR4D 1BXGA 1UPXA 4H7JA 1C7EA 4AYTA 5LQRA 2PKEA 2VSQA 3HPQA 3P0FA 4IRMA 4F97A 3SQGA 2CL5A 4M63A 2ZRAA 2ZZNA 3COJA 2IYYA 2IY5B 4FB5A 4KR0A 4XGIA 5CYGA 4A2PA 3RVOA 3NLLA 1U8WA 1HC7A 3F56A 2NO5A 4DFMA 4D98A 4D02A 1CUUA 4P3XA 4TRNA 4AJ4A 1ZKDA 1DBSA 5RUBA 1BCRB 2SCUA 2J6BA 2R5FA 3QMVA 1W9HA 2HBYA 3CUWA 1VRTB 4KXMA 1J23A 1P3Y1 4TLCA 3T6KA 3MK31 2YY7A 3OX1A 4DV2J 2ZJRQ 2VHUA 2IZZA 4NAHA 1FDOA 2BEVB 5EZ6B 4YRIA 3KSRA 1WHVA 2WTEA 4A48A 2ZRMA 1A1VA 4FZ5A 4Z8YA 1MWQA 2WBMA 3LP1B 2AYZA 3R5SA 3USZA 3ZYCA 1A8QA 4DG5A 1DEOA 3IP9A 2CPHA 1QG2A 4PSCA 4AP5A 2VAXA 3CIZA 4LYJA 1PGNA 1Q7YT 2ZUFA 1II9A 1GT91 2GPSA 3M6MD 3QLJA 1FZQA 2ONJA 1O6BA 2BJ7A 3UK2A 3UZUA 1V6HA 3ESRA 2XE7A 4EJSB 4O1IA 4BP1A 4YY3B 1WCYA 3TB4A 1S9EB 1XNQF 1NU4A 3GJQB 5JO0A 3OLVA 4AKHA 3K32A 3VNAA 1FDVA 3KBOA 1FWLA 3EGZA 2PL5A 4IJ5A 1ZIOA 2EW8A 3R8CA 2K2PA 2W4QA 2HQOA 4DV6J 5D3KA 4ERDA 2OCIA 2IYRA 4CO3A 1O0CA 1A2QA 4AT1B 3O90A 1WHXA 4ED4A 3S3TA 3ZGZA 4G0WA 3HFJA 5EHGA 4CQ1A 2P9ZA 4O3RA 2PX2A 1FD2A 4P0QB 2HF8A 2H5IA 1Z7YA 3D02A 2LVWA 3BE8A 4YJDA 4BLQA 3EZ5A 5GVRA 4U8YA 3AI3A 3KEMA 5TS3A 5C2GA 2XR1A 1BFKA 4OA5A 3CCSS 1NN3A 2OWEA 4QXRA 3BERA 4DYHA 1J0DA 3SBDA 3EZ9A 1KY4A 4DJ5X 2RHTA 2XA1A 2Q1XA 2WB2A 1JLEB 1S4QA 5A4IS 2D3OR 4ESHA 5ITZB 2XUDA 2P67A 1XJ0A 2J41A 1F7UA 4ANCA 1XV5A 1QHHA 3W34A 3E18A 3AAWB 1O2DA 2W2QA 3WK8A 1KOOA 2QN9A 5ITSA 1OYVA 2P90A 2BRUA 3NHMA 2ZU6A 4ZHRA 5HJEA 3I3SR 2VRWA 1RQ2A 2XQVA 1B7YB 1TYCA 3TUJC 1ZNWA 3QX9A 2XVAA 1Q5VA 2I62A 4L07A 4QWBA 2QRUA 1QQ6A 1SHLA 3RUBL 2D5AA 4MS1A 1WPGA 2Z43A 5KG7A 1Z6QA 3U31A 1H93A 1UMCA 2BKOA 1CLUA 4KAAA 2ZIXA 2CXEA 1PLJA 1ISMA 1S6QB 3U3ZA 2GVDB 2JF0A 3L1KA 5B0GA 3L2OB 3T5PA 3URKA 2Y1IA 4E1VA 2F3JA 2RQKA 2C7VA 1QYXA 2UVRA 1R6AA 1UXGA 3G7SA 1WG1A 1VQ1A 2PUFA 3VPBA 3KQQA 3H98A 1GPWB 3ADCA 1UJ6A 4Q1BA 3R8XA 3DDNA 3TJRA 2BTEA 1WPRA 2EYQA 2ACKA 1QP4A 1GU7A 4E6PA 1MBZA 4DYVA 3RYIA 3QNUA 4MW0A 1EHIA 4MQUA 4L3KA 3H2JA 2ROGA 4KTTE 4HX5A 5KEIA 2PKCA 2GX6A 1FYWA 1ZNZA 2JVJA 3IS9A 3QFRA 3EZ6A 4KV9A 2HH9A 5JUMA 3DZFA 3BGDA 1ITPA 2VS1A 3W06A 5HTOA 2I1QA 1XMBA 2GYUA 4MPRA 3TIIA 4ELVA 2YHBA 3OE7A 1QXSA 2PIAA 2AG0A 1PC5A 1L3IA 4OTZA 1HBUA 2H0QA 1IULA 3V6MA 3KUEA 5DYYA 1FOEB 4CIBA 5C5IA 1M34E 5IYZA 4NRUA 1Z62A 5FOUA 3K57A 3LDGA 3A25A 4BQRA 1Z4MA 5L3QA 1IM5A 2X5JO 1YDMA 3S8MA 1VL5A 4CLRA 1C7IA 1X87A 2IPAB 4EAQA 4Z53A 2AYMA 3EHDA 5AUQA 3OJLA 2UXBF 4CKEB 1JKJB 2XTNA 3G5TA 2XMQA 2DNLA 4D1YA 2PMFA 4ZS6A 4EG5A 4UPEA 3IEMA 4XFDA 4CL0A 4D79A 3K1AA 2YWGA 2PZGA 3DE2X 1HUQA 2ZYIA 2QFJA 5IC6B 1USUA 1SCNE 3IN5A 4LSZA 4WZQA 1FPQA 1ZVVA 4BGEA 3EWAA 4JGGA 2D62A 2BN4A 4TTJA 4I81A 3DEZA 4G0UA 2C9ZA 2DJIA 1EE9A 3CNQS 3TBHA 4RZXA 1E3MA 2XV1A 4B9UA 5HIJA 4P53A 5LUAA 4KDCA 1ZA1B 1TXGA 5L3SB 1Z2OX 4QCLA 1NSAA 4FNGA 3G9CA 5CBKA 2K06A 3WLPA 2LCIA 3BDAA 4ZVNA 1J24A 2FVYA 5J5CA 1NXIA 4GG1A 3EQ9A 4TQGA 2Q6CA 1OS5A 1LQ2A 2A57A 1KYXA 3JQGB 1FVOA 4DU7A 3VPGA 4GNKA 3EVWA 1QO9A 1R37A 1IRXA 4E22A 4E33A 3CXRA 3JQFA 4YO7A 3D6TB 3BPSA 4DB4A 3A9CA 3ZW7A 3T41A 4TQRA 1OSNA 4EPYA 2DERA 4KEAA 5FTKA 3OC0A 1XXHA 4QFCA 1TIKA 4UUAA 2EHJA 1WTFA 1KRHA 1BU8A 2ERXA 1O8CA 1QZ3A 2A33A 1ZX1A 4KPGA 1FFHA 4Y3UA 3EJWA 5FUQA 1I2DA 2A94A 1SR8A 3A31A 4OJHA 1AGYA 4PTZA 3UT0A 3AQIA 4MR9B 4EFDA 4UAUA 1SZPA 2ON6A 1GO2A 2R6AA 3PPWA 4JI3J 4FN5A 1BQMA 4ZJPA 2QBYB 2AD5A 5AFSA 4EMBA 4FLMA 3UA4A 3UD5A 1DAOA 5ADHA 3I52A 3NNDA 3FJYA 4LTMA 1ZN2A 2P9JA 4OMCA 5I9LA 1LOUA 4RUHA 4Q9HA 2LUOA 1G20A 3RR8A 2OV6A 1I14A 5JDIC 1DADA 2EX1A 1VQ6S 5EEHA 1HE8B 1J1UA 3WYAA 2PSZA 5AUNB 5G4KA 4YUZA 1PZHA 3NNSA 2L9NA 1EFRA 2KVIA 3F96A 3WXBA 2CXHA 2DJ5A 3Q2KA 3A8TA 5TQ0A 1B16A 1B2RA 2BSQA 2FB9A 2FRVA 3NRCA 4PONA 3W63A 2H2HA 4BNTA 4ZC1A 3R41A 2B9WA 3TQRA 4FOLA 5JWHA 1OY1A 3DFMA 3WK9A 2UXDF 2KG0A 1SUQA 5AYVA 1KYQA 4IP0A 3P0JA 4MWCA 1ULRA 5GONA 1EPUA 3PGJA 2OAEA 1WRBA 4U7HA 5EN1A 1JI3A 3OP1A 2Q0SA 3I96A 1UPUA 3WICA 1Y8RB 4FFSA 1VIDA 4IH6A 1UBLS 1PAEX 3TNLA 2B8JA 3L8CA 3G0OA 1VRUA 2HIHA 3UB2A 4YRJA 4IJWA 4CT5A 3FGNA 1U4NA 1QMPA 3A3PA 3TZHA 3H99A 1L7OA 5ETSA 1TO6A 3QE3A 1VJGA 1LKZA 1PHPA 2BW7A 4UJ5A 4H27A 2AG8A 1K6MA 3CVKA 3F9CA 3LWDA 2IMWP 5FR2A 2Y0BB 2ZWOA 1NM5C 5L9XA 2FVQA 2ZCUA 5EFZA 4AJ2A 1HRDA 5L95A 1ZI8A 5FX2A 1C0TB 4YJ2F 2EWVA 3FNBA 4B0OA 2HVHA 4GXQA 4KE5A 4US2R 4J9LA 4ED7A 4QLAA 2PE5A 2X76A 1JKMA 3P2YA 2WVBA 4KHZA 2GEJA 2PPVA 1JU9A 2QG9A 4EATA 2E6KA 3GFQA 5HQ3B 2WTNA 3LBYA 1ORHA 1NATA 1QHIA 2RRBA 4D4GA 3AT1A 2SHKA 4GIBA 1Y3CE 3MAJA 3R4CA 3AKYA 4MQEA 3LCVB 1FEHA 3Q7EA 5HFNA 5EWJB 2X1VA 3NMUF 4UNPA 1BE4A 4PNZA 1YK0A 1RA7A 3Q3CA 1T29A 3NT4A 4QUHA 2VD3A 5LYJB 4ZAGA 1HKHA 1PR6A 1GPJA 4W8OA 5BWCA 4DR2J 1QIHA 2RH8A 3FHOA 1TQ6A 2C2KB 2LEAA 3G1WA 4ZVPB 3MJTA 2HUPA 1G5IA 4KPEC 4HXGA 2EC0A 3KEQA 1HO3A 3OM0A 4R9NA 4A2WA 2DQKA 1KNZA 4PUOB 4RE5A 1Q0RA 1NT4A 3HKCB 2GBPA 3H17A 1VISA 1R5BA 4DLXA 2UUTA 2OVFA 1S4FA 1RCFA 3B6BA 3T5MA 2RARA 3IBCB 5IAKA 4C6RA 4FSHA 5AVYA 1GTHA 1L5OA 2QAGB 4JI8J 1XR5A 2VHVA 1RKUA 3N28A 2LBPA 2LCWA 2CLOB 1M5UA 4A10A 4NLQA 3PC6A 2ZUAA 4TXJA 1BY9A 4N8EA 3C4JA 3EGXB 1W47A 1FFYA 5J1PA 5CX1A 2EJCA 5B0DA 3WDSA 5BQOA 1VIYA 1YKGA 3SC2A 4ID5B 4M54A 2D69A 2ZH3A 4JS0A 4YY3F 1LBQA 2JL9A 4KWTA 2H1CA 5ECGC 5K03A 2L9WA 2KJQA 4BU0A 3HVJA 4EKDA 4ESVA 5F9FA 1FTWA 5K8LA 4LK3A 2J5AA 2KYRA 2PUAA 4O4HF 3PNBA 3DNPA 3ZDXB 1E0JA 3GLFE 4ZVEA 3WVNA 4J3NA 3PFKA 1N88A 1BQNB 4NMLA 3AM1A 4R9UC 2NQPA 1LJUA 4TRMA 1ZOPA 1SL1A 1S0MA 3A04A 3PQFA 2VCYA 3L4BC 4B3FX 3TLEA 5GAEU 1FJ2A 2NZXA 1U63A 4F2SA 1YOVB 1R4ZA 3LVRE 4C4AA 4TRRA 4NXNJ 3HWX1 1LPMA 3LWMA 2VDWB 3ZQUA 1KVSA 1KZ1A 4HLUC 5F3WB 3PR1A 4DV6F 5E8JA 4QYMA 3KYIB 4JX8A 3AETA 2GTPA 2O6HA 1VHIA 5KX5F 3CT6A 1E9CA 4G5OA 3JVDA 3CNHA 1HNVA 1AKUA 1ORTA 3LWNA 1ZP6A 2HGZA 1WC6A 3UK1A 1Y3HA 4ER7A 2XYPB 1Q8KA 5BT8A 2HPAA 3JYTB 2DNPA 4QBGB 1JMKC 5GV8A 1AURA 4R0JA 3HN2A 3URMA 2NU9A 4O2AF 1FE4A 2ZDQA 4WFBQ 3Q3EA 4GWKA 1KAOA 5ECWA 3C0KA 4RNMA 1LTKA 4TSFA 4XA8A 3ZLJA 2HRQA 2W2OA 5CLIA 1FE0A 2UU9F 1TVKA 1X19A 5AOCA 3D1VA 3QVTA 4USMA 2MIIA 1EGHA 2P6OA 3CLSC 3CVWA 5EZSA 4DGQA 2HVZA 3JZDA 1A8PA 3LBFA 5HRAA 3BGWA 3HACA 3UATA 3PJDA 3BD9A 3T0IA 4GE3A 4A8WA 4J9KA 2XQKA 2OSVA 1Y48E 1ULTA 1SUAA 3MGJA 1XD2B 1V8ZA 4B9NA 4LRAA 2YINC 2YJ5A 3TWZA 2GAOA 2C5SA 2AMFA 3QEMB 4E5DA 2BE2A 2KBEA 4A8SA 5A0VA 2WNIA 1NQVA 1R89A 2BE7D 2JVOA 4TKVB 5EHNA 3II6X 4C3KA 1K6JA 4CI9A 2PJDA 2HHUA 1LC3A 5CIQA 2V69A 1YQEA 1X7ZB 3NTVA 5GMKa 4DB2A 5FWDA 1QE5A 3WWPA 4TRJA 1RUSA 4GX5A 1WORA 2XYGB 3A13A 4U7WA 1WVIA 5B3AA 1OFTA 2BWJA 4GOND 1WXFA 4ZP1A 1EP9A 2XVYA 5JRDS 4A15A 1YOVA 3ESQA 1WZUA 2W7TA 4EI7A 3DO5A 3JSMB 2CQ4A 3AH6A 1KAMA 2CMGA 1XSEA 2K8GA 1ZK3A 2RKIA 3RB6A 4E13A 2PKXA 2HFZA 1Y0HA 5BV0A 4KYTA 4ISCA 3HB9A 4YBRA 2DSNA 3VMFA 5LSAA 1E2FA 1CEYA 4M1KA 3C3XA 1YJTA 4LMAA 1NUAA 3KYLA 2HNBA 3E7FA 4MRMB 2FHJD 1SC3B 1EWRA 5KKCA 5FUBA 3KTOA 3C6KA 1KOGA 3H2YA 1NL3A 3UG7A 4RZIA 3VH1A 1RDFA 3U26A 1PTJA 2CCJA 3HKZD 3ZE6A 1OWXA 5GAJA 5BR4A 3KR2A 3ZGNA 1XU4A 2HS4A 4KHPJ 4ADSG 2P62A 4LS3A 3HVTB 5EIBD 1MORA 4ZQFA 5GOTA 2CXPA 5I3PA 1T2AA 4AZ0A 2F1RA 2W8LA 5KWIA 4BMVA 4RTPA 3PWZA 5C37A 1II8A 1C8LA 3RRGA 3U49A 2PLNA 3CJ3A 4UOQA 4OQ4A 3SR3A 3H2IA 4LDPA 1DTSA 5H0IA 2ZHAA 5LKAA 5I3UA 4CMEC 3A8IA 2Z2MA 3G2NA 2LTAA 3J81U 1GL3A 4P93A 3LT5A 3D3BJ 3UNGC 3IPXA 4O3SA 3M7IA 2JBHA 3MI7X 5KNBD 1K0UA 3PNOA 2OFHX 2JJ1A 2A6MA 2HSDA 1UZNA 2JFKA 2QY9A 5A5GA 4PHGA 2HMIB 4I4CA 2FUG9 2PO5A 3LAWA 3RVMA 3HEBA 4RPHA 3GCXP 2HLPA 5LMCA 5CVJA 2PC6A 1X7GA 4AZSA 3FYHA 3IDQA 1U0GA 5LN1A 1EESA 2VP0A 3MPYA 4Q1EA 3FCSB 1TFWA 5I7VA 5BYBA 2YJTD 1JIHA 4ZA1A 1T95A 4JBIA 2HRBA 1MN9A 3Q86A 2RKOA 4QJ3A 1Q6YA 3U0BA 2VJLA 2QA4S 2VFSA 3AB2B 4EO4A 4KGDA 2AVDA 2OXRA 4ZYWA 1CQMA 3DU6A 3I82A 1DHRA 1P1HA 3PR3A 1R0LA 1KXJA 4YUDA 5DQGA 4E1AA 2MJUA 1C8VB 5EJIA 3F2IA 2I6UA 3HI6A 3TMAA 2CPIA 2WB1D 4KPUA 4OHUA 1TW2A 3PPXA 1HR0F 1F8YA 4LHEA 3CE8A 3HSJA 4H1TA 3TXXA 2H06A 1RAIB 2CXXA 3ZVKA 1DAMA 3K0JA 1GWNA 4RKFA 1KMMA 2VKZG 1WXWA 1B4DA 3SJBA 3WDKA 3G68A 4ZAXA 5DQIA 2XGGA 1Q7LB 4Y1RA 1RLDA 5D4NA 3ZGXA 1UFOA 4I0WA 2PMBA 3ONEA 2IYXA 4XPZA 2YVKA 3MHPA 4ZYYA 4EUVA 5KFVA 1Y63A 5JCJA 3EXHC 4HVZA 1R27B 5DWDA 5B3LA 4LFAJ 2PD1A 3EGOA 1CPZA 1QF9A 2XE8A 5L9AA 3LCJA 1R4MA 5ETJA 2IM1A 4ZMSA 3O6VA 1RTTA 4IBOA 1OKKA 3O9VA 2F3TA 5EKDA 4YCNA 1A77A 5LU8A 3DE3X 1RIIA 2PSHA 1B2LA 5AVTA 4PR0A 3FNHA 4FYMA 4RKRA 1P2UA 1QS0B 4X62F 1EUZA 5KHOC 2EI5A 3ASYA 4JI6F 4EWLA 3CSDA 1H2FA 4ZAYA 3MPUA 1LK0A 1C9MA 3OD5A 4W1RA 2EW9A 1BXNA 4FFWA 4C2BA 1XMOF 4F7VA 1OGYA 4NMMA 3K8VA 5HJXA 1LFWA 2F67A 4XLZA 1NSYA 5HATA 4AS1A 2PLAA 1RM0A 2NW6A 2R1ZA 2Z09A 3UPFA 3KWJA 4ER8A 4Z1OA 4O0NA 5DBIA 3L4KA 1U28C 4RHCA 5LP6F 2G1HA 3B12A 3O6QA 5HN0A 2X1FA 3OC6A 3EXFB 4DDWA 1NG9A 4MGKR 1ZUD1 3EC2A 4KXVA 4KNWA 4EBFA 2EBUA 4M87A 4CMIB 2HFUA 3FHTA 5JPCA 4YOEA 1VHWA 5CTJA 1IBLJ 2DUMA 3M4NA 3PJFA 4I5IA 5AOBA 1ZG3A 3NJRA 1TL7A 3JQ7B 1LRJA 5LYJF 1PJLA 4CQNA 5LMUJ 2Q49A 5FPYA 2H9YA 2HBRB 3U40A 1D5CA 4LMZA 4JLPA 3PX3A 1AZSC 1QVAA 3HGMA 2IYIA 3LUAA 1ZY2A 3VX3A 4XGQA 3S5UA 3H1BA 1YDWA 5IEBA 4I9NA 3ON5A 5IJAA 3N5BA 1QFYA 3RRJA 1OR8A 2PXAA 1N6QB 1XK7A 2CQGA 1XEWY 3W8GA 4YDHB 1WOYA 5AIAA 1KU6A 3ETMA 2D2FA 1NJFA 4H2DA 4ARZB 5KYNA 4YB1P 2A9OA 3CVXA 2XUQA 4XO0A 5KFEA 5KX5B 3HI9A 4HB3A 1KHHA 2F9FA 4EZ6A 1QPZA 2BKPA 1WF0A 4ELTA 1SCUA 3MQFA 1O9HA 1IY1A 1RHMB 2CBZA 1GCAA 1KVJA 3B60A 1J22A 2GX8A 1V9OA 3PHLA 4KGMA 1Y1SA 2O2GA 3PKZA 4LOJA 1G18A 1HOTA 2A14A 3PUVA 4H9GA 4F0JA 2GM9A 1Z39A 4ES2A 1NVVR 3X44A 5EJGA 3TE6A 3QY9A 3W4JA 2E1AA 1ODSA 4F0HA 1ZU4A 3OI7A 2I67A 3UMMA 4LRSB 1W1WA 2UVPA 2QRPA 5JVDB 1VYUA 2XO7A 2YR0A 3PPYA 1ZAXA 2X0DA 5EJ9A 2WAQD 1SB8A 1LLUA 1UAGA 1PKEA 4IFEA 5HGJA 2HMUA 2UVUA 3JWGA 2RGEA 2NQTA 4H3SA 5J1TB 1AXRA 5HQMA 2IK8A 1CE8A 1ZS6A 1YBFA 4PZLA 5DLFA 3DXSX 4OQNA 1XP8A 2V9PA 2VPWA 1OU4A 4HL6A 2A3NA 1GPYA 3S81A 5I7SA 4HX9A 3DOUA 4P2XA 2Q5IA 4F3MA 5HCUA 5CD9A 3UV6A 3MM6B 3NRJA 4QRIA 4I14A 3REQB 1NLKL 4Z8XA 3CISA 3U3DA 3ETGA 2KHDA 4A82A 4ARBA 1T1JA 3N74A 4OMFG 5ALYA 2VH5R 2FRXA 2E6UX 4F45A 1JIKA 5BSVA 1OB2A 1AHPA 1NVTA 3NUQA 4LYYA 2OUIA 2OA0A 3WC0A 2CPZA 3TFOA 4U67Q 4RFVA 1NVFA 5B7WA 2GBCA 5LZ9A 4DR4F 3DNMA 4NV1A 1JLRA 1U5CA 5LQMA 5DGTA 1O6GA 3W5VA 1N6NA 3GA0A 1IQZA 3Q89A 3F0TA 2JNJA 3UFBA 2JLSA 2I8EA 3SC4A 2ZHOA 4WNAA 3EBOA 2NO4A 1DBIA 2GO1A 3F4LA 3EY4A 1U1OA 3B36A 4BRZA 4CR8A 2IIBA 2MR6A 4AKIA 1VC2A 2N9UA 3TW4A 4DLLA 4F2DA 2CB0A 3QHAA 2ID7A 1Z06A 2C2BA 1TELA 2JGNA 1IJFA 1W4AA 1C2TA 4Q45A 4FS3A 1CUJA 5SV2A 1EUQA 2QQFA 4HLQB 3N2EA 5EMKA 1PRYA 1P61B 5B5SA 4BBAA 2O52A 3NKYA 4AX8A 4UW2A 1XMXA 4LRBA 1Y1PA 3PEJA 3D0IE 1LF5A 4PS1A 1YIAA 3DRXA 1KQKA 2G0TA 5J2QA 4L5CA 1MC5A 1SVWA 3HP4A 2O3QA 2M9MA 3L7PA 1MO5A 1P0QA 2RC5A 2E7XA 2H9ZA 4ILEA 1SPBP 3POTA 3ED1A 5BSGA 3D31A 5BV1A 5DM6Q 5KQPA 1KGSA 1FTCA 1DQRA 2OPQA 4FGKA 2JDIA 3L4JA 4MKGA 1AQ6A 3JARB 1RC8A 1MF7A 2JKVA 2V6BA 1FW6A 2P5VA 5JD4A 5FBHA 1QR2A 5EIOA 1GDDA 2WRZA 2WHRA 3KALA 3T35A 1KC8T 2ZE2A 3TAMA 4N0DA 3OH8A 3NHJA 3ZDYB 2V74B 4K6GA 4PTYA 3IG1A 1RJEA 3DT6A 3KJGA 3RFUA 3EYZA 1UEXC 5LD2C 3AHDA 2BJVA 1RCUA 4GVPA 2H7YA 3KNGA 4YAOA 1V39A 1FXUA 2ZJ4A 2D0DA 3IMKA 3OA0A 4DPLA 2VB6A 3E22A 1S48A 2BZ2A 3BG5A 1K47A 3RRHA 3EDRB 2ZKIA 3WB1A 1SVUA 4TV9F 1DEKA 1CD5A 3DE5X 3EX7C 5DGIA 2XCUA 1R7IA 3OJSA 1YU6A 4AO7A 2OCXA 4FGSA 3UAYA 2OORC 1PEYA 4EEXA 4MO2A 4BE9A 4YMVA 4KSEB 3MMXA 3AESA 5A4DA 4EA6A 3HRHA 1Z36A 4PSDA 1T3HA 4WNCA 3EZ2A 5EERA 2MZRA 3BWEA 3R7NB 1XC7A 2IDMA 4WKPA 3D81A 4S2EA 2YCBA 2V59A 1IOWA 3GFRA 5K1ZA 4ILRA 1CS4A 4IFVB 2HJWA 3BXZA 4Y98A 5JV5A 4DL7A 1XTJA 1IPHA 1Z2ZA 4QBKA 4KO4S 3PEFA 4GOMD 3SE7A 2ZRPA 2NLOA 2QTMA 2I6XA 4ENUA 2RHHA 3OBBA 4GM1A 2JGKA 4I1VA 3GN1A 1RJWA 1IH8A 2MGZA 3LZCA 2CJKA 3R23A 5KYGA 2XQCA 1MLAA 3SMVA 1HNXJ 4EVSA 3BYZA 2C31A 1JHRA 3KOAA 5AXNA 1CC7A 4ETNA 1JDVA 4ZVTA 2FMKA 2OP1A 2OMEA 1AA9A 2P2ZA 3E2MA 1U0JA 5MF6A 2C2XA 2VYFA 4C0LA 4OLFA 3UAZA 5KVAA 3RC1A 5B0AA 4QXPA 5EMMA 3GIDA 1OT5A 4Q9IA 5CEJA 1NXPA 1T5LA 1SKUB 2ZW9A 4A0HA 2F3RA 2IM0A 4YRBA 5I6DA 3GVIA 3OIGA 4D45A 3DLLQ 1CVIA 5BV2P 2DEUA 4DUTA 4P0PB 3R2CJ 2QL9A 4A8JC 1U7TA 3N5CA 3GNTA 1TUBB 2H7XA 3PHCA 4BJ5A 2FJWA 2A1BA 1EARA 1K0VA 1C1DA 1NDKA 1R4AA 5C2CA 5F21A 5JXSA 3SYZA 4BS9A 1V6AA 1F4VA 3UHOA 5T7LA 4Q3OA 5IHXA 1R9NA 4KNVA 4X65B 3ZDZB 2LFVA 5ICSA 4IJMA 2WWHA 2OMLA 3M0EA 4P2BA 3UJBA 1UDXA 1JLGA 4IM7A 4D8TA 4MHTA 1Q2UA 1SUCA 3NP5A 1D09B 1T24A 1M1YA 3W5BA 5CR9A 4KQ6A 4TT3D 4WXYB 1H9CA 1RISA 4GBMA 3I6MA 1UVKA 2QTCA 2YWHA 4O4IF 3NM6B 3T1OA 1U7ZA 2FW1A 4RLEA 4DR3J 2ZCVA 1YI1A 4CMJA 1ACJA 5FTNA 2GHIA 4TS4A 1REQA 5HKKD 821PA 2MZ1A 2H4YA 2ZIZA 4HGNA 3N87A