1F7SA

Crystal structure of adf1 from arabidopsis thaliana
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
ASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAACLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVELQATDPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparative structural analysis of the ADF/cofilin family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords ACTIN DEPOLYMERIZING FACTOR (ADF)
total genus 36
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1f7sA00
3CJCG 2HD7A 2FF3A 3EGDB 2FH4A 1VKKA 5KYWA 3A5MS 5KYUA 4KEEA 1Q8XA 1F7SA 2LXXA 1JHWA 4KEFA 4S10C 1NLVG 2FH3A 2XF1A 1P8XA 4Z94G 1M4JA 1UDMA 5KYNA 3Q2BA 2VACA 1M2VB 1H1VG 5KYXB 3FG7A 5L6WC 1WM4A 1M2VA 1J72A 2QTVA 1PCXA 1TVJA 5HVKB 1WFSA 1WNJA 3EGXB 1T2LA 1C0FS 1T44G 1C0GS 1DEJS 4CBWG 1PD0A 2LLFA 1V6FA 3A5LS 3EFOB 1HQZ1 2NUTB 4CBUG 1NMDG 2FF6G 1CNUA 1D4XG 1SVRA 3TU5B 1P8ZG 2FGHA 1YVNG 2XFAA 3EG9A 2D8BA 1M2OA 5KYYA 2KVKA 1D0NA 5KYUB 3EGXA 2NUPA 2W0IA 1AK6A 1TMWA 4PKGG 2MV2A 5IVUA 3L50A 1RGIG 3EFOA 1AHQA 3A5NS 2FH1A 1CFYA 3CI5G 3EH2A 1AK7A 2MP4A 1T3YA 1NM1G 1PD1A 2VIKA 1KCQA 2L72A 5KYYB 4KEDA 5KYXA 3EGDA 4LIZA 5FAFA 2MOTA 5FAEA 4PKIG 3CJBG 3DAWB 2VILA 4JD2H 1NPHA 1T3XA 5A1MA 2FH2A 1MDUA 1COFA 2NUPB 2I2QA 1SVQA 3FFNA 5KYWB 4BEX1 1X67A 1SVYA 2LJ8A 1ESVS 2NUTA 4PKHB 1VFQA 3EH1A 1QPVA 3FFKA 5HVKD 1EQYS 3CIPG 1Q8GA 5DD2A 1YAGG 3FG6A 4CBXG 3EG9B 3A5OS
chains in the Genus database with same CATH superfamily
3CJCG 2HD7A 2FF3A 3EGDB 2FH4A 1VKKA 5KYWA 3A5MS 5KYUA 4KEEA 1Q8XA 1F7SA 2LXXA 1JHWA 4KEFA 4S10C 1NLVG 2FH3A 2XF1A 1P8XA 4Z94G 1M4JA 1UDMA 5KYNA 3Q2BA 2VACA 1M2VB 1H1VG 5KYXB 3FG7A 5L6WC 1WM4A 1M2VA 1J72A 2QTVA 1PCXA 1TVJA 5HVKB 1WFSA 1WNJA 3EGXB 1T2LA 1C0FS 1T44G 1C0GS 1DEJS 4CBWG 1PD0A 2LLFA 1V6FA 3A5LS 3EFOB 1HQZ1 2NUTB 4CBUG 1NMDG 2FF6G 1CNUA 3DA7A 1D4XG 1SVRA 3TU5B 1P8ZG 2FGHA 1YVNG 2XFAA 3EG9A 2D8BA 1M2OA 5KYYA 2KVKA 1D0NA 5KYUB 3EGXA 2NUPA 2W0IA 1AK6A 1TMWA 4PKGG 2MV2A 5IVUA 3L50A 1RGIG 3EFOA 1AHQA 3A5NS 2FH1A 1CFYA 3CI5G 3EH2A 1AK7A 2MP4A 1T3YA 1NM1G 1PD1A 2VIKA 1KCQA 2L72A 5KYYB 4KEDA 5KYXA 3EGDA 4LIZA 5FAFA 2MOTA 5FAEA 4PKIG 3CJBG 3DAWB 2VILA 4JD2H 1NPHA 1T3XA 5A1MA 2FH2A 1MDUA 1COFA 2NUPB 2I2QA 1SVQA 3FFNA 5KYWB 4BEX1 1X67A 1SVYA 2LJ8A 1ESVS 2NUTA 4PKHB 1VFQA 3EH1A 1QPVA 3FFKA 5HVKD 1EQYS 3CIPG 1Q8GA 5DD2A 1YAGG 3FG6A 4CBXG 3EG9B 3A5OS
chains in the Genus database with same CATH topology
3CJCG 2HD7A 2FF3A 3EGDB 2FH4A 1VKKA 5KYWA 3A5MS 5KYUA 4KEEA 1Q8XA 1F7SA 2LXXA 1JHWA 4KEFA 4S10C 1NLVG 2FH3A 2XF1A 1P8XA 4Z94G 1M4JA 1UDMA 5KYNA 3Q2BA 2VACA 1M2VB 1H1VG 5KYXB 3FG7A 5L6WC 1WM4A 1M2VA 1J72A 2QTVA 1PCXA 1TVJA 5HVKB 1WFSA 1WNJA 3EGXB 1T2LA 1C0FS 1T44G 1C0GS 1DEJS 4CBWG 1PD0A 2LLFA 1V6FA 3A5LS 3EFOB 1HQZ1 2NUTB 4CBUG 1NMDG 2FF6G 1CNUA 3DA7A 1D4XG 1SVRA 3TU5B 1P8ZG 2FGHA 1YVNG 2XFAA 3EG9A 2D8BA 1M2OA 5KYYA 2KVKA 1D0NA 5KYUB 3EGXA 2NUPA 2W0IA 1AK6A 1TMWA 4PKGG 2MV2A 5IVUA 3L50A 1RGIG 3EFOA 1AHQA 3A5NS 2FH1A 1CFYA 3CI5G 3EH2A 1AK7A 2MP4A 1T3YA 1NM1G 1PD1A 2VIKA 1KCQA 2L72A 5KYYB 4KEDA 5KYXA 3EGDA 4LIZA 5FAFA 2MOTA 5FAEA 4PKIG 3CJBG 3DAWB 2VILA 4JD2H 1NPHA 1T3XA 5A1MA 2FH2A 1MDUA 1COFA 2NUPB 2I2QA 1SVQA 3FFNA 5KYWB 4BEX1 1X67A 1SVYA 2LJ8A 1ESVS 2NUTA 4PKHB 1VFQA 3EH1A 1QPVA 3FFKA 5HVKD 1EQYS 3CIPG 1Q8GA 5DD2A 1YAGG 3FG6A 4CBXG 3EG9B 3A5OS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJC G;  2HD7 A;  2FF3 A;  3EGD B;  2FH4 A;  1VKK A;  5KYW A;  3A5M S;  5KYU A;  4KEE A;  1Q8X A;  1F7S A;  2LXX A;  1JHW A;  4KEF A;  4S10 C;  1NLV G;  2FH3 A;  2XF1 A;  1P8X A;  4Z94 G;  1M4J A;  1UDM A;  5KYN A;  3Q2B A;  2VAC A;  1M2V B;  1H1V G;  5KYX B;  3FG7 A;  5L6W C;  1WM4 A;  1M2V A;  1J72 A;  2QTV A;  1PCX A;  1TVJ A;  5HVK B;  1WFS A;  1WNJ A;  3EGX B;  1T2L A;  1C0F S;  1T44 G;  1C0G S;  1DEJ S;  4CBW G;  1PD0 A;  2LLF A;  1V6F A;  3A5L S;  3EFO B;  1HQZ 1;  2NUT B;  4CBU G;  1NMD G;  2FF6 G;  1CNU A;  1D4X G;  1SVR A;  3TU5 B;  1P8Z G;  2FGH A;  1YVN G;  2XFA A;  3EG9 A;  2D8B A;  1M2O A;  5KYY A;  2KVK A;  1D0N A;  5KYU B;  3EGX A;  2NUP A;  2W0I A;  1AK6 A;  1TMW A;  4PKG G;  2MV2 A;  5IVU A;  3L50 A;  1RGI G;  3EFO A;  1AHQ A;  3A5N S;  2FH1 A;  1CFY A;  3CI5 G;  3EH2 A;  1AK7 A;  2MP4 A;  1T3Y A;  1NM1 G;  1PD1 A;  2VIK A;  1KCQ A;  2L72 A;  5KYY B;  4KED A;  5KYX A;  3EGD A;  4LIZ A;  5FAF A;  2MOT A;  5FAE A;  4PKI G;  3CJB G;  3DAW B;  2VIL A;  4JD2 H;  1NPH A;  1T3X A;  5A1M A;  2FH2 A;  1MDU A;  1COF A;  2NUP B;  2I2Q A;  1SVQ A;  3FFN A;  5KYW B;  4BEX 1;  1X67 A;  1SVY A;  2LJ8 A;  1ESV S;  2NUT A;  4PKH B;  1VFQ A;  3EH1 A;  1QPV A;  3FFK A;  5HVK D;  1EQY S;  3CIP G;  1Q8G A;  5DD2 A;  1YAG G;  3FG6 A;  4CBX G;  3EG9 B;  3A5O S; 
#chains in the Genus database with same CATH topology
 3CJC G;  2HD7 A;  2FF3 A;  3EGD B;  2FH4 A;  1VKK A;  5KYW A;  3A5M S;  5KYU A;  4KEE A;  1Q8X A;  1F7S A;  2LXX A;  1JHW A;  4KEF A;  4S10 C;  1NLV G;  2FH3 A;  2XF1 A;  1P8X A;  4Z94 G;  1M4J A;  1UDM A;  5KYN A;  3Q2B A;  2VAC A;  1M2V B;  1H1V G;  5KYX B;  3FG7 A;  5L6W C;  1WM4 A;  1M2V A;  1J72 A;  2QTV A;  1PCX A;  1TVJ A;  5HVK B;  1WFS A;  1WNJ A;  3EGX B;  1T2L A;  1C0F S;  1T44 G;  1C0G S;  1DEJ S;  4CBW G;  1PD0 A;  2LLF A;  1V6F A;  3A5L S;  3EFO B;  1HQZ 1;  2NUT B;  4CBU G;  1NMD G;  2FF6 G;  1CNU A;  3DA7 A;  1D4X G;  1SVR A;  3TU5 B;  1P8Z G;  2FGH A;  1YVN G;  2XFA A;  3EG9 A;  2D8B A;  1M2O A;  5KYY A;  2KVK A;  1D0N A;  5KYU B;  3EGX A;  2NUP A;  2W0I A;  1AK6 A;  1TMW A;  4PKG G;  2MV2 A;  5IVU A;  3L50 A;  1RGI G;  3EFO A;  1AHQ A;  3A5N S;  2FH1 A;  1CFY A;  3CI5 G;  3EH2 A;  1AK7 A;  2MP4 A;  1T3Y A;  1NM1 G;  1PD1 A;  2VIK A;  1KCQ A;  2L72 A;  5KYY B;  4KED A;  5KYX A;  3EGD A;  4LIZ A;  5FAF A;  2MOT A;  5FAE A;  4PKI G;  3CJB G;  3DAW B;  2VIL A;  4JD2 H;  1NPH A;  1T3X A;  5A1M A;  2FH2 A;  1MDU A;  1COF A;  2NUP B;  2I2Q A;  1SVQ A;  3FFN A;  5KYW B;  4BEX 1;  1X67 A;  1SVY A;  2LJ8 A;  1ESV S;  2NUT A;  4PKH B;  1VFQ A;  3EH1 A;  1QPV A;  3FFK A;  5HVK D;  1EQY S;  3CIP G;  1Q8G A;  5DD2 A;  1YAG G;  3FG6 A;  4CBX G;  3EG9 B;  3A5O S; 
#chains in the Genus database with same CATH homology
 3CJC G;  2HD7 A;  2FF3 A;  3EGD B;  2FH4 A;  1VKK A;  5KYW A;  3A5M S;  5KYU A;  4KEE A;  1Q8X A;  1F7S A;  2LXX A;  1JHW A;  4KEF A;  4S10 C;  1NLV G;  2FH3 A;  2XF1 A;  1P8X A;  4Z94 G;  1M4J A;  1UDM A;  5KYN A;  3Q2B A;  2VAC A;  1M2V B;  1H1V G;  5KYX B;  3FG7 A;  5L6W C;  1WM4 A;  1M2V A;  1J72 A;  2QTV A;  1PCX A;  1TVJ A;  5HVK B;  1WFS A;  1WNJ A;  3EGX B;  1T2L A;  1C0F S;  1T44 G;  1C0G S;  1DEJ S;  4CBW G;  1PD0 A;  2LLF A;  1V6F A;  3A5L S;  3EFO B;  1HQZ 1;  2NUT B;  4CBU G;  1NMD G;  2FF6 G;  1CNU A;  3DA7 A;  1D4X G;  1SVR A;  3TU5 B;  1P8Z G;  2FGH A;  1YVN G;  2XFA A;  3EG9 A;  2D8B A;  1M2O A;  5KYY A;  2KVK A;  1D0N A;  5KYU B;  3EGX A;  2NUP A;  2W0I A;  1AK6 A;  1TMW A;  4PKG G;  2MV2 A;  5IVU A;  3L50 A;  1RGI G;  3EFO A;  1AHQ A;  3A5N S;  2FH1 A;  1CFY A;  3CI5 G;  3EH2 A;  1AK7 A;  2MP4 A;  1T3Y A;  1NM1 G;  1PD1 A;  2VIK A;  1KCQ A;  2L72 A;  5KYY B;  4KED A;  5KYX A;  3EGD A;  4LIZ A;  5FAF A;  2MOT A;  5FAE A;  4PKI G;  3CJB G;  3DAW B;  2VIL A;  4JD2 H;  1NPH A;  1T3X A;  5A1M A;  2FH2 A;  1MDU A;  1COF A;  2NUP B;  2I2Q A;  1SVQ A;  3FFN A;  5KYW B;  4BEX 1;  1X67 A;  1SVY A;  2LJ8 A;  1ESV S;  2NUT A;  4PKH B;  1VFQ A;  3EH1 A;  1QPV A;  3FFK A;  5HVK D;  1EQY S;  3CIP G;  1Q8G A;  5DD2 A;  1YAG G;  3FG6 A;  4CBX G;  3EG9 B;  3A5O S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...