1F7SA

Crystal structure of adf1 from arabidopsis thaliana
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
ASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAACLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVELQATDPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparative structural analysis of the ADF/cofilin family.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
molecule keywords ACTIN DEPOLYMERIZING FACTOR (ADF)
total genus 36
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1f7sA00
2VIKA 1P8ZG 2FF3A 5FAEA 1C0FS 2NUTB 2W0IA 1F7SA 1J72A 1V6FA 3FG7A 3CI5G 1TMWA 5KYWA 1ESVS 4PKGG 4KEFA 1DEJS 3CJBG 1SVRA 3DAWB 2XF1A 1NM1G 3EFOA 5KYXB 2QTVA 1M4JA 4CBXG 1QPVA 3FFKA 2NUPB 1D4XG 1COFA 3A5NS 2NUPA 3CIPG 2VACA 1AK6A 1WNJA 1Q8XA 1VFQA 1C0GS 1CFYA 1T3YA 1TVJA 3EGXB 1PD0A 1Q8GA 2KVKA 2VILA 1M2OA 1WM4A 4Z94G 2L72A 1KCQA 2LXXA 4PKHB 3FFNA 2FH2A 1HQZ1 5A1MA 4BEX1 1NMDG 1AHQA 3EGDA 5KYNA 1NLVG 3A5OS 3FG6A 4CBUG 3A5LS 4JD2H 2XFAA 1EQYS 1P8XA 2MOTA 5KYUA 1SVYA 2D8BA 2HD7A 2LLFA 5FAFA 2FH3A 4KEDA 3EG9B 1YAGG 1JHWA 1MDUA 2MP4A 3Q2BA 4KEEA 5HVKD 5KYYA 2FH4A 5HVKB 3A5MS 3TU5B 1RGIG 5L6WC 5KYUB 1X67A 1T3XA 2I2QA 1PD1A 5KYXA 1WFSA 3EH2A 1YVNG 1T2LA 1VKKA 5KYYB 5DD2A 1M2VB 4PKIG 4LIZA 5KYWB 3EFOB 3EH1A 1D0NA 3L50A 4CBWG 1H1VG 1M2VA 2FF6G 3EGXA 1CNUA 1UDMA 1T44G 1SVQA 2FGHA 4S10C 2MV2A 3EG9A 1AK7A 2FH1A 2NUTA 1NPHA 5IVUA 2LJ8A 3EGDB 3CJCG 1PCXA
chains in the Genus database with same CATH superfamily
2VIKA 1P8ZG 2FF3A 5FAEA 1C0FS 2NUTB 2W0IA 1F7SA 1J72A 1V6FA 3FG7A 3CI5G 1TMWA 5KYWA 1ESVS 4PKGG 4KEFA 1DEJS 3CJBG 1SVRA 3DAWB 2XF1A 1NM1G 3EFOA 5KYXB 2QTVA 1M4JA 4CBXG 1QPVA 3FFKA 2NUPB 1D4XG 1COFA 3A5NS 2NUPA 3CIPG 2VACA 1AK6A 1WNJA 1Q8XA 1VFQA 1C0GS 1CFYA 1T3YA 1TVJA 3EGXB 1PD0A 1Q8GA 2KVKA 3DA7A 2VILA 1M2OA 1WM4A 4Z94G 2L72A 1KCQA 2LXXA 4PKHB 3FFNA 2FH2A 1HQZ1 5A1MA 4BEX1 1NMDG 1AHQA 3EGDA 5KYNA 1NLVG 3A5OS 3FG6A 4CBUG 3A5LS 4JD2H 2XFAA 1EQYS 1P8XA 2MOTA 5KYUA 1SVYA 2D8BA 2HD7A 2LLFA 5FAFA 2FH3A 4KEDA 3EG9B 1YAGG 1JHWA 1MDUA 2MP4A 3Q2BA 4KEEA 5HVKD 5KYYA 2FH4A 5HVKB 3A5MS 3TU5B 1RGIG 5L6WC 5KYUB 1X67A 1T3XA 2I2QA 1PD1A 5KYXA 1WFSA 3EH2A 1YVNG 1T2LA 1VKKA 5KYYB 5DD2A 1M2VB 4PKIG 4LIZA 5KYWB 3EFOB 3EH1A 1D0NA 3L50A 4CBWG 1H1VG 1M2VA 2FF6G 3EGXA 1CNUA 1UDMA 1T44G 1SVQA 2FGHA 4S10C 2MV2A 3EG9A 1AK7A 2FH1A 2NUTA 1NPHA 5IVUA 2LJ8A 3EGDB 3CJCG 1PCXA
chains in the Genus database with same CATH topology
2VIKA 1P8ZG 2FF3A 5FAEA 1C0FS 2NUTB 2W0IA 1F7SA 1J72A 1V6FA 3FG7A 3CI5G 1TMWA 5KYWA 1ESVS 4PKGG 4KEFA 1DEJS 3CJBG 1SVRA 3DAWB 2XF1A 1NM1G 3EFOA 5KYXB 2QTVA 1M4JA 4CBXG 1QPVA 3FFKA 2NUPB 1D4XG 1COFA 3A5NS 2NUPA 3CIPG 2VACA 1AK6A 1WNJA 1Q8XA 1VFQA 1C0GS 1CFYA 1T3YA 1TVJA 3EGXB 1PD0A 1Q8GA 2KVKA 3DA7A 2VILA 1M2OA 1WM4A 4Z94G 2L72A 1KCQA 2LXXA 4PKHB 3FFNA 2FH2A 1HQZ1 5A1MA 4BEX1 1NMDG 1AHQA 3EGDA 5KYNA 1NLVG 3A5OS 3FG6A 4CBUG 3A5LS 4JD2H 2XFAA 1EQYS 1P8XA 2MOTA 5KYUA 1SVYA 2D8BA 2HD7A 2LLFA 5FAFA 2FH3A 4KEDA 3EG9B 1YAGG 1JHWA 1MDUA 2MP4A 3Q2BA 4KEEA 5HVKD 5KYYA 2FH4A 5HVKB 3A5MS 3TU5B 1RGIG 5L6WC 5KYUB 1X67A 1T3XA 2I2QA 1PD1A 5KYXA 1WFSA 3EH2A 1YVNG 1T2LA 1VKKA 5KYYB 5DD2A 1M2VB 4PKIG 4LIZA 5KYWB 3EFOB 3EH1A 1D0NA 3L50A 4CBWG 1H1VG 1M2VA 2FF6G 3EGXA 1CNUA 1UDMA 1T44G 1SVQA 2FGHA 4S10C 2MV2A 3EG9A 1AK7A 2FH1A 2NUTA 1NPHA 5IVUA 2LJ8A 3EGDB 3CJCG 1PCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VIK A;  1P8Z G;  2FF3 A;  5FAE A;  1C0F S;  2NUT B;  2W0I A;  1F7S A;  1J72 A;  1V6F A;  3FG7 A;  3CI5 G;  1TMW A;  5KYW A;  1ESV S;  4PKG G;  4KEF A;  1DEJ S;  3CJB G;  1SVR A;  3DAW B;  2XF1 A;  1NM1 G;  3EFO A;  5KYX B;  2QTV A;  1M4J A;  4CBX G;  1QPV A;  3FFK A;  2NUP B;  1D4X G;  1COF A;  3A5N S;  2NUP A;  3CIP G;  2VAC A;  1AK6 A;  1WNJ A;  1Q8X A;  1VFQ A;  1C0G S;  1CFY A;  1T3Y A;  1TVJ A;  3EGX B;  1PD0 A;  1Q8G A;  2KVK A;  2VIL A;  1M2O A;  1WM4 A;  4Z94 G;  2L72 A;  1KCQ A;  2LXX A;  4PKH B;  3FFN A;  2FH2 A;  1HQZ 1;  5A1M A;  4BEX 1;  1NMD G;  1AHQ A;  3EGD A;  5KYN A;  1NLV G;  3A5O S;  3FG6 A;  4CBU G;  3A5L S;  4JD2 H;  2XFA A;  1EQY S;  1P8X A;  2MOT A;  5KYU A;  1SVY A;  2D8B A;  2HD7 A;  2LLF A;  5FAF A;  2FH3 A;  4KED A;  3EG9 B;  1YAG G;  1JHW A;  1MDU A;  2MP4 A;  3Q2B A;  4KEE A;  5HVK D;  5KYY A;  2FH4 A;  5HVK B;  3A5M S;  3TU5 B;  1RGI G;  5L6W C;  5KYU B;  1X67 A;  1T3X A;  2I2Q A;  1PD1 A;  5KYX A;  1WFS A;  3EH2 A;  1YVN G;  1T2L A;  1VKK A;  5KYY B;  5DD2 A;  1M2V B;  4PKI G;  4LIZ A;  5KYW B;  3EFO B;  3EH1 A;  1D0N A;  3L50 A;  4CBW G;  1H1V G;  1M2V A;  2FF6 G;  3EGX A;  1CNU A;  1UDM A;  1T44 G;  1SVQ A;  2FGH A;  4S10 C;  2MV2 A;  3EG9 A;  1AK7 A;  2FH1 A;  2NUT A;  1NPH A;  5IVU A;  2LJ8 A;  3EGD B;  3CJC G;  1PCX A; 
#chains in the Genus database with same CATH topology
 2VIK A;  1P8Z G;  2FF3 A;  5FAE A;  1C0F S;  2NUT B;  2W0I A;  1F7S A;  1J72 A;  1V6F A;  3FG7 A;  3CI5 G;  1TMW A;  5KYW A;  1ESV S;  4PKG G;  4KEF A;  1DEJ S;  3CJB G;  1SVR A;  3DAW B;  2XF1 A;  1NM1 G;  3EFO A;  5KYX B;  2QTV A;  1M4J A;  4CBX G;  1QPV A;  3FFK A;  2NUP B;  1D4X G;  1COF A;  3A5N S;  2NUP A;  3CIP G;  2VAC A;  1AK6 A;  1WNJ A;  1Q8X A;  1VFQ A;  1C0G S;  1CFY A;  1T3Y A;  1TVJ A;  3EGX B;  1PD0 A;  1Q8G A;  2KVK A;  3DA7 A;  2VIL A;  1M2O A;  1WM4 A;  4Z94 G;  2L72 A;  1KCQ A;  2LXX A;  4PKH B;  3FFN A;  2FH2 A;  1HQZ 1;  5A1M A;  4BEX 1;  1NMD G;  1AHQ A;  3EGD A;  5KYN A;  1NLV G;  3A5O S;  3FG6 A;  4CBU G;  3A5L S;  4JD2 H;  2XFA A;  1EQY S;  1P8X A;  2MOT A;  5KYU A;  1SVY A;  2D8B A;  2HD7 A;  2LLF A;  5FAF A;  2FH3 A;  4KED A;  3EG9 B;  1YAG G;  1JHW A;  1MDU A;  2MP4 A;  3Q2B A;  4KEE A;  5HVK D;  5KYY A;  2FH4 A;  5HVK B;  3A5M S;  3TU5 B;  1RGI G;  5L6W C;  5KYU B;  1X67 A;  1T3X A;  2I2Q A;  1PD1 A;  5KYX A;  1WFS A;  3EH2 A;  1YVN G;  1T2L A;  1VKK A;  5KYY B;  5DD2 A;  1M2V B;  4PKI G;  4LIZ A;  5KYW B;  3EFO B;  3EH1 A;  1D0N A;  3L50 A;  4CBW G;  1H1V G;  1M2V A;  2FF6 G;  3EGX A;  1CNU A;  1UDM A;  1T44 G;  1SVQ A;  2FGH A;  4S10 C;  2MV2 A;  3EG9 A;  1AK7 A;  2FH1 A;  2NUT A;  1NPH A;  5IVU A;  2LJ8 A;  3EGD B;  3CJC G;  1PCX A; 
#chains in the Genus database with same CATH homology
 2VIK A;  1P8Z G;  2FF3 A;  5FAE A;  1C0F S;  2NUT B;  2W0I A;  1F7S A;  1J72 A;  1V6F A;  3FG7 A;  3CI5 G;  1TMW A;  5KYW A;  1ESV S;  4PKG G;  4KEF A;  1DEJ S;  3CJB G;  1SVR A;  3DAW B;  2XF1 A;  1NM1 G;  3EFO A;  5KYX B;  2QTV A;  1M4J A;  4CBX G;  1QPV A;  3FFK A;  2NUP B;  1D4X G;  1COF A;  3A5N S;  2NUP A;  3CIP G;  2VAC A;  1AK6 A;  1WNJ A;  1Q8X A;  1VFQ A;  1C0G S;  1CFY A;  1T3Y A;  1TVJ A;  3EGX B;  1PD0 A;  1Q8G A;  2KVK A;  3DA7 A;  2VIL A;  1M2O A;  1WM4 A;  4Z94 G;  2L72 A;  1KCQ A;  2LXX A;  4PKH B;  3FFN A;  2FH2 A;  1HQZ 1;  5A1M A;  4BEX 1;  1NMD G;  1AHQ A;  3EGD A;  5KYN A;  1NLV G;  3A5O S;  3FG6 A;  4CBU G;  3A5L S;  4JD2 H;  2XFA A;  1EQY S;  1P8X A;  2MOT A;  5KYU A;  1SVY A;  2D8B A;  2HD7 A;  2LLF A;  5FAF A;  2FH3 A;  4KED A;  3EG9 B;  1YAG G;  1JHW A;  1MDU A;  2MP4 A;  3Q2B A;  4KEE A;  5HVK D;  5KYY A;  2FH4 A;  5HVK B;  3A5M S;  3TU5 B;  1RGI G;  5L6W C;  5KYU B;  1X67 A;  1T3X A;  2I2Q A;  1PD1 A;  5KYX A;  1WFS A;  3EH2 A;  1YVN G;  1T2L A;  1VKK A;  5KYY B;  5DD2 A;  1M2V B;  4PKI G;  4LIZ A;  5KYW B;  3EFO B;  3EH1 A;  1D0N A;  3L50 A;  4CBW G;  1H1V G;  1M2V A;  2FF6 G;  3EGX A;  1CNU A;  1UDM A;  1T44 G;  1SVQ A;  2FGH A;  4S10 C;  2MV2 A;  3EG9 A;  1AK7 A;  2FH1 A;  2NUT A;  1NPH A;  5IVU A;  2LJ8 A;  3EGD B;  3CJC G;  1PCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...