1T2LA

Three crystal structures of human coactosin-like protein
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Coactosin-like Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Coactosin-like protein
total genus 41
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1t2lA00
1TVJA 1YVNG 1MDUA 5KYXB 1X67A 1F7SA 5FAFA 1EQYS 1PD0A 1SVYA 4LIZA 4Z94G 1NM1G 1T3XA 1HQZ1 2KVKA 3EG9B 2XF1A 1RGIG 1DEJS 1M2VA 2L72A 1SVRA 5KYUB 3EG9A 1UDMA 1AHQA 1TMWA 5KYYA 3CIPG 2XFAA 2MP4A 1NPHA 2LXXA 3EGDA 1C0FS 2MOTA 3A5OS 1WM4A 3L50A 4KEDA 1PCXA 1Q8XA 3CJBG 2NUTB 1VFQA 1T2LA 3EH1A 2LLFA 1KCQA 1M2OA 2QTVA 1COFA 4KEFA 2NUPB 3EFOB 3CJCG 5FAEA 5DD2A 4KEEA 2NUTA 4S10C 5IVUA 1AK7A 1PD1A 3CI5G 2FF3A 3EGDB 5KYYB 2VACA 5A1MA 3A5MS 2FH2A 1CFYA 3DAWB 4JD2H 1ESVS 1VKKA 1D4XG 3EGXA 2MV2A 3A5NS 4CBWG 3Q2BA 2FH4A 1P8XA 1WNJA 2LJ8A 2D8BA 3FFNA 2FGHA 2FH3A 3EGXB 4BEX1 5HVKB 1AK6A 5KYUA 1Q8GA 4CBUG 3A5LS 3FFKA 4PKIG 3TU5B 1J72A 1WFSA 1NMDG 2W0IA 5KYWA 1CNUA 2VIKA 1M2VB 1JHWA 4PKHB 2VILA 2FF6G 1NLVG 1V6FA 2HD7A 1QPVA 2NUPA 3EFOA 5KYNA 5L6WC 1H1VG 1C0GS 1T3YA 3FG6A 1YAGG 3EH2A 3FG7A 5HVKD 1SVQA 4CBXG 5KYWB 1D0NA 2FH1A 4PKGG 5KYXA 1P8ZG 1M4JA 2I2QA 1T44G
chains in the Genus database with same CATH superfamily
1TVJA 1YVNG 1MDUA 5KYXB 1X67A 1F7SA 5FAFA 1EQYS 1PD0A 1SVYA 4LIZA 4Z94G 1NM1G 1T3XA 1HQZ1 2KVKA 3EG9B 2XF1A 1RGIG 1DEJS 1M2VA 2L72A 1SVRA 5KYUB 3EG9A 1UDMA 1AHQA 1TMWA 5KYYA 3CIPG 2XFAA 2MP4A 1NPHA 2LXXA 3EGDA 1C0FS 2MOTA 3A5OS 3DA7A 1WM4A 3L50A 4KEDA 1PCXA 1Q8XA 3CJBG 2NUTB 1VFQA 1T2LA 3EH1A 2LLFA 1KCQA 1M2OA 2QTVA 1COFA 4KEFA 2NUPB 3EFOB 3CJCG 5FAEA 5DD2A 4KEEA 2NUTA 4S10C 5IVUA 1AK7A 1PD1A 3CI5G 2FF3A 3EGDB 5KYYB 2VACA 5A1MA 3A5MS 2FH2A 1CFYA 3DAWB 4JD2H 1ESVS 1VKKA 1D4XG 3EGXA 2MV2A 3A5NS 4CBWG 3Q2BA 2FH4A 1P8XA 1WNJA 2LJ8A 2D8BA 3FFNA 2FGHA 2FH3A 3EGXB 4BEX1 5HVKB 1AK6A 5KYUA 1Q8GA 4CBUG 3A5LS 3FFKA 4PKIG 3TU5B 1J72A 1WFSA 1NMDG 2W0IA 5KYWA 1CNUA 2VIKA 1M2VB 1JHWA 4PKHB 2VILA 2FF6G 1NLVG 1V6FA 2HD7A 1QPVA 2NUPA 3EFOA 5KYNA 5L6WC 1H1VG 1C0GS 1T3YA 3FG6A 1YAGG 3EH2A 3FG7A 5HVKD 1SVQA 4CBXG 5KYWB 1D0NA 2FH1A 4PKGG 5KYXA 1P8ZG 1M4JA 2I2QA 1T44G
chains in the Genus database with same CATH topology
1TVJA 1YVNG 1MDUA 5KYXB 1X67A 1F7SA 5FAFA 1EQYS 1PD0A 1SVYA 4LIZA 4Z94G 1NM1G 1T3XA 1HQZ1 2KVKA 3EG9B 2XF1A 1RGIG 1DEJS 1M2VA 2L72A 1SVRA 5KYUB 3EG9A 1UDMA 1AHQA 1TMWA 5KYYA 3CIPG 2XFAA 2MP4A 1NPHA 2LXXA 3EGDA 1C0FS 2MOTA 3A5OS 3DA7A 1WM4A 3L50A 4KEDA 1PCXA 1Q8XA 3CJBG 2NUTB 1VFQA 1T2LA 3EH1A 2LLFA 1KCQA 1M2OA 2QTVA 1COFA 4KEFA 2NUPB 3EFOB 3CJCG 5FAEA 5DD2A 4KEEA 2NUTA 4S10C 5IVUA 1AK7A 1PD1A 3CI5G 2FF3A 3EGDB 5KYYB 2VACA 5A1MA 3A5MS 2FH2A 1CFYA 3DAWB 4JD2H 1ESVS 1VKKA 1D4XG 3EGXA 2MV2A 3A5NS 4CBWG 3Q2BA 2FH4A 1P8XA 1WNJA 2LJ8A 2D8BA 3FFNA 2FGHA 2FH3A 3EGXB 4BEX1 5HVKB 1AK6A 5KYUA 1Q8GA 4CBUG 3A5LS 3FFKA 4PKIG 3TU5B 1J72A 1WFSA 1NMDG 2W0IA 5KYWA 1CNUA 2VIKA 1M2VB 1JHWA 4PKHB 2VILA 2FF6G 1NLVG 1V6FA 2HD7A 1QPVA 2NUPA 3EFOA 5KYNA 5L6WC 1H1VG 1C0GS 1T3YA 3FG6A 1YAGG 3EH2A 3FG7A 5HVKD 1SVQA 4CBXG 5KYWB 1D0NA 2FH1A 4PKGG 5KYXA 1P8ZG 1M4JA 2I2QA 1T44G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TVJ A;  1YVN G;  1MDU A;  5KYX B;  1X67 A;  1F7S A;  5FAF A;  1EQY S;  1PD0 A;  1SVY A;  4LIZ A;  4Z94 G;  1NM1 G;  1T3X A;  1HQZ 1;  2KVK A;  3EG9 B;  2XF1 A;  1RGI G;  1DEJ S;  1M2V A;  2L72 A;  1SVR A;  5KYU B;  3EG9 A;  1UDM A;  1AHQ A;  1TMW A;  5KYY A;  3CIP G;  2XFA A;  2MP4 A;  1NPH A;  2LXX A;  3EGD A;  1C0F S;  2MOT A;  3A5O S;  1WM4 A;  3L50 A;  4KED A;  1PCX A;  1Q8X A;  3CJB G;  2NUT B;  1VFQ A;  1T2L A;  3EH1 A;  2LLF A;  1KCQ A;  1M2O A;  2QTV A;  1COF A;  4KEF A;  2NUP B;  3EFO B;  3CJC G;  5FAE A;  5DD2 A;  4KEE A;  2NUT A;  4S10 C;  5IVU A;  1AK7 A;  1PD1 A;  3CI5 G;  2FF3 A;  3EGD B;  5KYY B;  2VAC A;  5A1M A;  3A5M S;  2FH2 A;  1CFY A;  3DAW B;  4JD2 H;  1ESV S;  1VKK A;  1D4X G;  3EGX A;  2MV2 A;  3A5N S;  4CBW G;  3Q2B A;  2FH4 A;  1P8X A;  1WNJ A;  2LJ8 A;  2D8B A;  3FFN A;  2FGH A;  2FH3 A;  3EGX B;  4BEX 1;  5HVK B;  1AK6 A;  5KYU A;  1Q8G A;  4CBU G;  3A5L S;  3FFK A;  4PKI G;  3TU5 B;  1J72 A;  1WFS A;  1NMD G;  2W0I A;  5KYW A;  1CNU A;  2VIK A;  1M2V B;  1JHW A;  4PKH B;  2VIL A;  2FF6 G;  1NLV G;  1V6F A;  2HD7 A;  1QPV A;  2NUP A;  3EFO A;  5KYN A;  5L6W C;  1H1V G;  1C0G S;  1T3Y A;  3FG6 A;  1YAG G;  3EH2 A;  3FG7 A;  5HVK D;  1SVQ A;  4CBX G;  5KYW B;  1D0N A;  2FH1 A;  4PKG G;  5KYX A;  1P8Z G;  1M4J A;  2I2Q A;  1T44 G; 
#chains in the Genus database with same CATH topology
 1TVJ A;  1YVN G;  1MDU A;  5KYX B;  1X67 A;  1F7S A;  5FAF A;  1EQY S;  1PD0 A;  1SVY A;  4LIZ A;  4Z94 G;  1NM1 G;  1T3X A;  1HQZ 1;  2KVK A;  3EG9 B;  2XF1 A;  1RGI G;  1DEJ S;  1M2V A;  2L72 A;  1SVR A;  5KYU B;  3EG9 A;  1UDM A;  1AHQ A;  1TMW A;  5KYY A;  3CIP G;  2XFA A;  2MP4 A;  1NPH A;  2LXX A;  3EGD A;  1C0F S;  2MOT A;  3A5O S;  3DA7 A;  1WM4 A;  3L50 A;  4KED A;  1PCX A;  1Q8X A;  3CJB G;  2NUT B;  1VFQ A;  1T2L A;  3EH1 A;  2LLF A;  1KCQ A;  1M2O A;  2QTV A;  1COF A;  4KEF A;  2NUP B;  3EFO B;  3CJC G;  5FAE A;  5DD2 A;  4KEE A;  2NUT A;  4S10 C;  5IVU A;  1AK7 A;  1PD1 A;  3CI5 G;  2FF3 A;  3EGD B;  5KYY B;  2VAC A;  5A1M A;  3A5M S;  2FH2 A;  1CFY A;  3DAW B;  4JD2 H;  1ESV S;  1VKK A;  1D4X G;  3EGX A;  2MV2 A;  3A5N S;  4CBW G;  3Q2B A;  2FH4 A;  1P8X A;  1WNJ A;  2LJ8 A;  2D8B A;  3FFN A;  2FGH A;  2FH3 A;  3EGX B;  4BEX 1;  5HVK B;  1AK6 A;  5KYU A;  1Q8G A;  4CBU G;  3A5L S;  3FFK A;  4PKI G;  3TU5 B;  1J72 A;  1WFS A;  1NMD G;  2W0I A;  5KYW A;  1CNU A;  2VIK A;  1M2V B;  1JHW A;  4PKH B;  2VIL A;  2FF6 G;  1NLV G;  1V6F A;  2HD7 A;  1QPV A;  2NUP A;  3EFO A;  5KYN A;  5L6W C;  1H1V G;  1C0G S;  1T3Y A;  3FG6 A;  1YAG G;  3EH2 A;  3FG7 A;  5HVK D;  1SVQ A;  4CBX G;  5KYW B;  1D0N A;  2FH1 A;  4PKG G;  5KYX A;  1P8Z G;  1M4J A;  2I2Q A;  1T44 G; 
#chains in the Genus database with same CATH homology
 1TVJ A;  1YVN G;  1MDU A;  5KYX B;  1X67 A;  1F7S A;  5FAF A;  1EQY S;  1PD0 A;  1SVY A;  4LIZ A;  4Z94 G;  1NM1 G;  1T3X A;  1HQZ 1;  2KVK A;  3EG9 B;  2XF1 A;  1RGI G;  1DEJ S;  1M2V A;  2L72 A;  1SVR A;  5KYU B;  3EG9 A;  1UDM A;  1AHQ A;  1TMW A;  5KYY A;  3CIP G;  2XFA A;  2MP4 A;  1NPH A;  2LXX A;  3EGD A;  1C0F S;  2MOT A;  3A5O S;  3DA7 A;  1WM4 A;  3L50 A;  4KED A;  1PCX A;  1Q8X A;  3CJB G;  2NUT B;  1VFQ A;  1T2L A;  3EH1 A;  2LLF A;  1KCQ A;  1M2O A;  2QTV A;  1COF A;  4KEF A;  2NUP B;  3EFO B;  3CJC G;  5FAE A;  5DD2 A;  4KEE A;  2NUT A;  4S10 C;  5IVU A;  1AK7 A;  1PD1 A;  3CI5 G;  2FF3 A;  3EGD B;  5KYY B;  2VAC A;  5A1M A;  3A5M S;  2FH2 A;  1CFY A;  3DAW B;  4JD2 H;  1ESV S;  1VKK A;  1D4X G;  3EGX A;  2MV2 A;  3A5N S;  4CBW G;  3Q2B A;  2FH4 A;  1P8X A;  1WNJ A;  2LJ8 A;  2D8B A;  3FFN A;  2FGH A;  2FH3 A;  3EGX B;  4BEX 1;  5HVK B;  1AK6 A;  5KYU A;  1Q8G A;  4CBU G;  3A5L S;  3FFK A;  4PKI G;  3TU5 B;  1J72 A;  1WFS A;  1NMD G;  2W0I A;  5KYW A;  1CNU A;  2VIK A;  1M2V B;  1JHW A;  4PKH B;  2VIL A;  2FF6 G;  1NLV G;  1V6F A;  2HD7 A;  1QPV A;  2NUP A;  3EFO A;  5KYN A;  5L6W C;  1H1V G;  1C0G S;  1T3Y A;  3FG6 A;  1YAG G;  3EH2 A;  3FG7 A;  5HVK D;  1SVQ A;  4CBX G;  5KYW B;  1D0N A;  2FH1 A;  4PKG G;  5KYX A;  1P8Z G;  1M4J A;  2I2Q A;  1T44 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...