1H1VG

Gelsolin g4-g6/actin complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
331
structure length
327
Chain Sequence
MDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Calcium Activation of Gelsolin:Insights from the 3A Structure of the G4-G6/Actin Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Actin-binding
molecule keywords ACTIN
total genus 87
structure length 327
sequence length 331
ec nomenclature
pdb deposition date 2002-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1h1vG01
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1h1vG03
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1h1vG02
1VFQA 2MP4A 2NUTA 5KYUA 1JHWA 2FH2A 4CBXG 1M2OA 2NUPB 1D0NA 2NUPA 4PKGG 3FG7A 3FG6A 1M4JA 1P8XA 2NUTB 2FF6G 2L72A 2FH1A 1T3XA 1RGIG 5KYUB 1YAGG 5KYNA 2XF1A 4CBUG 3CJCG 2VIKA 2D8BA 3CIPG 1F7SA 1Q8GA 3A5NS 1T3YA 4PKHB 3EGDA 3Q2BA 1PD1A 1NLVG 1COFA 4CBWG 3EH1A 1EQYS 1QPVA 5A1MA 1J72A 1VKKA 1AK6A 1PCXA 1TVJA 3CJBG 3EFOA 5KYXA 3EG9A 5KYYB 1AK7A 1P8ZG 2MV2A 4KEDA 2I2QA 5KYWA 2LXXA 3A5MS 3DAWB 4BEX1 1M2VA 2VACA 4PKIG 1SVYA 5HVKD 1SVQA 2KVKA 3FFNA 1NMDG 3EGXB 1HQZ1 2QTVA 1SVRA 1CNUA 4KEEA 3A5LS 5KYWB 1V6FA 4LIZA 3L50A 1MDUA 4Z94G 1H1VG 1WM4A 1C0FS 1D4XG 2LJ8A 2XFAA 1C0GS 3EGXA 1ESVS 1WNJA 5IVUA 1T44G 1CFYA 4JD2H 1M2VB 1NPHA 2LLFA 5L6WC 5HVKB 1UDMA 2HD7A 1DEJS 4S10C 5FAEA 2VILA 3A5OS 3CI5G 5FAFA 3EFOB 5KYXB 1Q8XA 1YVNG 4KEFA 1TMWA 3TU5B 1NM1G 2MOTA 2FGHA 2FH4A 3FFKA 1X67A 1KCQA 3EG9B 5KYYA 2FF3A 3EH2A 1WFSA 1T2LA 2FH3A 1PD0A 2W0IA 3EGDB 1AHQA 5DD2A
chains in the Genus database with same CATH superfamily
1VFQA 2MP4A 2NUTA 5KYUA 1JHWA 2FH2A 4CBXG 1M2OA 2NUPB 1D0NA 2NUPA 4PKGG 3FG7A 3FG6A 1M4JA 1P8XA 2NUTB 2FF6G 2L72A 2FH1A 1T3XA 1RGIG 5KYUB 1YAGG 5KYNA 2XF1A 4CBUG 3CJCG 2VIKA 2D8BA 3CIPG 1F7SA 1Q8GA 3A5NS 1T3YA 4PKHB 3EGDA 3Q2BA 1PD1A 1NLVG 1COFA 4CBWG 3EH1A 1EQYS 1QPVA 5A1MA 1J72A 1VKKA 1AK6A 1PCXA 1TVJA 3CJBG 3EFOA 5KYXA 3EG9A 5KYYB 1AK7A 1P8ZG 2MV2A 4KEDA 2I2QA 5KYWA 2LXXA 3A5MS 3DAWB 4BEX1 1M2VA 2VACA 4PKIG 1SVYA 5HVKD 1SVQA 2KVKA 3FFNA 1NMDG 3EGXB 1HQZ1 2QTVA 1SVRA 1CNUA 4KEEA 3A5LS 5KYWB 1V6FA 4LIZA 3L50A 1MDUA 4Z94G 1H1VG 1WM4A 1C0FS 1D4XG 2LJ8A 2XFAA 1C0GS 3EGXA 1ESVS 1WNJA 5IVUA 1T44G 1CFYA 4JD2H 1M2VB 1NPHA 2LLFA 5L6WC 5HVKB 1UDMA 2HD7A 1DEJS 4S10C 5FAEA 2VILA 3A5OS 3CI5G 5FAFA 3EFOB 5KYXB 1Q8XA 1YVNG 4KEFA 1TMWA 3TU5B 1NM1G 2MOTA 2FGHA 2FH4A 3FFKA 1X67A 1KCQA 3EG9B 5KYYA 2FF3A 3EH2A 1WFSA 1T2LA 2FH3A 3DA7A 1PD0A 2W0IA 3EGDB 1AHQA 5DD2A
chains in the Genus database with same CATH topology
1VFQA 2MP4A 2NUTA 5KYUA 1JHWA 2FH2A 4CBXG 1M2OA 2NUPB 1D0NA 2NUPA 4PKGG 3FG7A 3FG6A 1M4JA 1P8XA 2NUTB 2FF6G 2L72A 2FH1A 1T3XA 1RGIG 5KYUB 1YAGG 5KYNA 2XF1A 4CBUG 3CJCG 2VIKA 2D8BA 3CIPG 1F7SA 1Q8GA 3A5NS 1T3YA 4PKHB 3EGDA 3Q2BA 1PD1A 1NLVG 1COFA 4CBWG 3EH1A 1EQYS 1QPVA 5A1MA 1J72A 1VKKA 1AK6A 1PCXA 1TVJA 3CJBG 3EFOA 5KYXA 3EG9A 5KYYB 1AK7A 1P8ZG 2MV2A 4KEDA 2I2QA 5KYWA 2LXXA 3A5MS 3DAWB 4BEX1 1M2VA 2VACA 4PKIG 1SVYA 5HVKD 1SVQA 2KVKA 3FFNA 1NMDG 3EGXB 1HQZ1 2QTVA 1SVRA 1CNUA 4KEEA 3A5LS 5KYWB 1V6FA 4LIZA 3L50A 1MDUA 4Z94G 1H1VG 1WM4A 1C0FS 1D4XG 2LJ8A 2XFAA 1C0GS 3EGXA 1ESVS 1WNJA 5IVUA 1T44G 1CFYA 4JD2H 1M2VB 1NPHA 2LLFA 5L6WC 5HVKB 1UDMA 2HD7A 1DEJS 4S10C 5FAEA 2VILA 3A5OS 3CI5G 5FAFA 3EFOB 5KYXB 1Q8XA 1YVNG 4KEFA 1TMWA 3TU5B 1NM1G 2MOTA 2FGHA 2FH4A 3FFKA 1X67A 1KCQA 3EG9B 5KYYA 2FF3A 3EH2A 1WFSA 1T2LA 2FH3A 3DA7A 1PD0A 2W0IA 3EGDB 1AHQA 5DD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFQ A;  2MP4 A;  2NUT A;  5KYU A;  1JHW A;  2FH2 A;  4CBX G;  1M2O A;  2NUP B;  1D0N A;  2NUP A;  4PKG G;  3FG7 A;  3FG6 A;  1M4J A;  1P8X A;  2NUT B;  2FF6 G;  2L72 A;  2FH1 A;  1T3X A;  1RGI G;  5KYU B;  1YAG G;  5KYN A;  2XF1 A;  4CBU G;  3CJC G;  2VIK A;  2D8B A;  3CIP G;  1F7S A;  1Q8G A;  3A5N S;  1T3Y A;  4PKH B;  3EGD A;  3Q2B A;  1PD1 A;  1NLV G;  1COF A;  4CBW G;  3EH1 A;  1EQY S;  1QPV A;  5A1M A;  1J72 A;  1VKK A;  1AK6 A;  1PCX A;  1TVJ A;  3CJB G;  3EFO A;  5KYX A;  3EG9 A;  5KYY B;  1AK7 A;  1P8Z G;  2MV2 A;  4KED A;  2I2Q A;  5KYW A;  2LXX A;  3A5M S;  3DAW B;  4BEX 1;  1M2V A;  2VAC A;  4PKI G;  1SVY A;  5HVK D;  1SVQ A;  2KVK A;  3FFN A;  1NMD G;  3EGX B;  1HQZ 1;  2QTV A;  1SVR A;  1CNU A;  4KEE A;  3A5L S;  5KYW B;  1V6F A;  4LIZ A;  3L50 A;  1MDU A;  4Z94 G;  1H1V G;  1WM4 A;  1C0F S;  1D4X G;  2LJ8 A;  2XFA A;  1C0G S;  3EGX A;  1ESV S;  1WNJ A;  5IVU A;  1T44 G;  1CFY A;  4JD2 H;  1M2V B;  1NPH A;  2LLF A;  5L6W C;  5HVK B;  1UDM A;  2HD7 A;  1DEJ S;  4S10 C;  5FAE A;  2VIL A;  3A5O S;  3CI5 G;  5FAF A;  3EFO B;  5KYX B;  1Q8X A;  1YVN G;  4KEF A;  1TMW A;  3TU5 B;  1NM1 G;  2MOT A;  2FGH A;  2FH4 A;  3FFK A;  1X67 A;  1KCQ A;  3EG9 B;  5KYY A;  2FF3 A;  3EH2 A;  1WFS A;  1T2L A;  2FH3 A;  1PD0 A;  2W0I A;  3EGD B;  1AHQ A;  5DD2 A; 
#chains in the Genus database with same CATH topology
 1VFQ A;  2MP4 A;  2NUT A;  5KYU A;  1JHW A;  2FH2 A;  4CBX G;  1M2O A;  2NUP B;  1D0N A;  2NUP A;  4PKG G;  3FG7 A;  3FG6 A;  1M4J A;  1P8X A;  2NUT B;  2FF6 G;  2L72 A;  2FH1 A;  1T3X A;  1RGI G;  5KYU B;  1YAG G;  5KYN A;  2XF1 A;  4CBU G;  3CJC G;  2VIK A;  2D8B A;  3CIP G;  1F7S A;  1Q8G A;  3A5N S;  1T3Y A;  4PKH B;  3EGD A;  3Q2B A;  1PD1 A;  1NLV G;  1COF A;  4CBW G;  3EH1 A;  1EQY S;  1QPV A;  5A1M A;  1J72 A;  1VKK A;  1AK6 A;  1PCX A;  1TVJ A;  3CJB G;  3EFO A;  5KYX A;  3EG9 A;  5KYY B;  1AK7 A;  1P8Z G;  2MV2 A;  4KED A;  2I2Q A;  5KYW A;  2LXX A;  3A5M S;  3DAW B;  4BEX 1;  1M2V A;  2VAC A;  4PKI G;  1SVY A;  5HVK D;  1SVQ A;  2KVK A;  3FFN A;  1NMD G;  3EGX B;  1HQZ 1;  2QTV A;  1SVR A;  1CNU A;  4KEE A;  3A5L S;  5KYW B;  1V6F A;  4LIZ A;  3L50 A;  1MDU A;  4Z94 G;  1H1V G;  1WM4 A;  1C0F S;  1D4X G;  2LJ8 A;  2XFA A;  1C0G S;  3EGX A;  1ESV S;  1WNJ A;  5IVU A;  1T44 G;  1CFY A;  4JD2 H;  1M2V B;  1NPH A;  2LLF A;  5L6W C;  5HVK B;  1UDM A;  2HD7 A;  1DEJ S;  4S10 C;  5FAE A;  2VIL A;  3A5O S;  3CI5 G;  5FAF A;  3EFO B;  5KYX B;  1Q8X A;  1YVN G;  4KEF A;  1TMW A;  3TU5 B;  1NM1 G;  2MOT A;  2FGH A;  2FH4 A;  3FFK A;  1X67 A;  1KCQ A;  3EG9 B;  5KYY A;  2FF3 A;  3EH2 A;  1WFS A;  1T2L A;  2FH3 A;  3DA7 A;  1PD0 A;  2W0I A;  3EGD B;  1AHQ A;  5DD2 A; 
#chains in the Genus database with same CATH homology
 1VFQ A;  2MP4 A;  2NUT A;  5KYU A;  1JHW A;  2FH2 A;  4CBX G;  1M2O A;  2NUP B;  1D0N A;  2NUP A;  4PKG G;  3FG7 A;  3FG6 A;  1M4J A;  1P8X A;  2NUT B;  2FF6 G;  2L72 A;  2FH1 A;  1T3X A;  1RGI G;  5KYU B;  1YAG G;  5KYN A;  2XF1 A;  4CBU G;  3CJC G;  2VIK A;  2D8B A;  3CIP G;  1F7S A;  1Q8G A;  3A5N S;  1T3Y A;  4PKH B;  3EGD A;  3Q2B A;  1PD1 A;  1NLV G;  1COF A;  4CBW G;  3EH1 A;  1EQY S;  1QPV A;  5A1M A;  1J72 A;  1VKK A;  1AK6 A;  1PCX A;  1TVJ A;  3CJB G;  3EFO A;  5KYX A;  3EG9 A;  5KYY B;  1AK7 A;  1P8Z G;  2MV2 A;  4KED A;  2I2Q A;  5KYW A;  2LXX A;  3A5M S;  3DAW B;  4BEX 1;  1M2V A;  2VAC A;  4PKI G;  1SVY A;  5HVK D;  1SVQ A;  2KVK A;  3FFN A;  1NMD G;  3EGX B;  1HQZ 1;  2QTV A;  1SVR A;  1CNU A;  4KEE A;  3A5L S;  5KYW B;  1V6F A;  4LIZ A;  3L50 A;  1MDU A;  4Z94 G;  1H1V G;  1WM4 A;  1C0F S;  1D4X G;  2LJ8 A;  2XFA A;  1C0G S;  3EGX A;  1ESV S;  1WNJ A;  5IVU A;  1T44 G;  1CFY A;  4JD2 H;  1M2V B;  1NPH A;  2LLF A;  5L6W C;  5HVK B;  1UDM A;  2HD7 A;  1DEJ S;  4S10 C;  5FAE A;  2VIL A;  3A5O S;  3CI5 G;  5FAF A;  3EFO B;  5KYX B;  1Q8X A;  1YVN G;  4KEF A;  1TMW A;  3TU5 B;  1NM1 G;  2MOT A;  2FGH A;  2FH4 A;  3FFK A;  1X67 A;  1KCQ A;  3EG9 B;  5KYY A;  2FF3 A;  3EH2 A;  1WFS A;  1T2L A;  2FH3 A;  3DA7 A;  1PD0 A;  2W0I A;  3EGD B;  1AHQ A;  5DD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...