4PKIG

Complex of atp-actin with the c-terminal actin-binding domain of tropomodulin
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
306
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFGYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin, alpha skeletal muscle
publication title Actin cytoskeleton. Mechanism of actin filament pointed-end capping by tropomodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein/actin-binding protein
total genus 103
structure length 306
sequence length 324
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4pkiG01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4pkiG02
2FT3A 3M19A 1Z7XW 4H09A 5KYNA 2QTVA 3EG9A 3P72A 2V9SA 1NMDG 4R07A 3OGKB 3GOZA 3E4GA 5GQRK 2Z63A 3RFEA 1EQYS 1HQZ1 3OGLB 1TVJA 2OMWA 2W0IA 2XF1A 1Q8GA 4KXFB 4CILA 2HD7A 1H6UA 4KEDA 3FFKA 1SVQA 2LLFA 1P9AG 5CMPA 2IFGA 1M2VB 1FT8A 1XECA 1M9LA 1AHQA 3FXIA 1D0BA 2R9UA 4G8AA 4FHOA 2JQDA 3G3AA 4R6FA 4KEFA 4S10C 3CI5G 2OMZA 5AWAA 2BEXA 3G39A 1WM4A 4ARRA 4KNGA 4NKHA 2OMXA 2WQXA 1QPVA 5IYXC 1OTMA 2UZXA 3WPIA 3G06A 2VACA 1COFA 4AW4A 3W3LA 3ZYOA 4PKIG 2NUPB 4Z94G 4R08A 3EGDB 3G04C 5B4PA 3JB9j 3G3BA 5L6WC 2OMVA 4QXEA 4CC4A 4FMZA 3CIGA 2UZYA 4Z79A 4LXSA 2Z64A 2CA6A 3UL7A 3DZEA 2P1OB 2OMYA 4FS7A 4NKGA 5KYUA 5DD2A 1ZIWA 2Z65A 4LXRA 4UFRA 3EG9B 4U09A 3REZA 4CC4C 3CVRA 2ASTB 2P1MB 1SVRA 1DCEA 1M2OA 4PKGG 1K5GC 4GT6A 1SVYA 4R09A 4Q62A 4V2EA 5AWBA 4I6JB 4U06A 4CNCA 3RGZA 3WPCA 4P8SA 1OGQA 2FF3A 1T44G 4LSAA 5HVKD 2ELLA 1M9SA 1KOHA 3RJ0A 3ZYJA 4L3FA 1IO0A 4U08A 1OOKG 4R5DA 2LJ8A 2VILA 5AZ5A 4R58A 3ULAA 3A5NS 3WPHA 5CMNA 1NLVG 2JE0A 2V70A 3WPBA 1CFYA 5KYXA 4ECNA 1J72A 5HDHA 4BSUA 4P91A 2P1QB 3W3KA 1CNUA 3A5LS 5KYUB 1AK6A 3E2JA 1H6TA 4EZGA 1P8ZG 2FH4A 3C6PB 3OGMB 4ARNA 1O6VA 4BV4R 3CJBG 4LSXC 2Y5QA 1T3YA 4B8CD 5IJDA 3ULVA 1O6SA 4BSSA 2KVKA 3EFOA 5A5CA 5GMGA 2FGHA 4U7LA 1PGVA 3BZ5A 2Z62A 3O53A 4C2BB 5GMHA 1XEUA 4PKHB 4CNMA 3RIZA 4BSRA 4HQ1A 2A0ZA 1YVNG 3EH2A 1DEJS 1D0NA 4R5CA 4M7EC 1A4YA 4L3AA 3WPEA 1V6FA 3L50A 2Z7XA 3FG6A 3ULUA 1DS9A 3W3JA 1QYYA 4FDWA 4PEQB 3E3ZA 1WNJA 1P8TA 1O6TA 1RGIG 5B0NA 2FH1A 3SB4A 3RFSA 1M4JA 2O6RA 1T3XA 2P1NB 1X67A 1P8XA 3CIPG 5KYXB 4LIZA 2FF6G 4Z8GA 5AWDA 2O6QA 4GLPA 5GS0A 2MP4A 2OMTA 4CBUG 3ZYNA 2RA8A 4CP6A 2P1PB 3C6OB 4K17A 2L72A 4C2AB 3VQ1A 1F7SA 1H1VG 3RFJA 4OQTA 2Z66A 5GMFA 3TSRE 1XWDC 4ECOA 2WFHA 3W3MA 2Q4GW 1ESVS 3UL9A 4XOSA 3EFOB 1SQ0B 4XGOA 1JL5A 3RW6A 5KYYA 2D8BA 2XFAA 2Z81A 4Z61C 3RW7A 4LSCA 1VKKA 1LTXA 3RGXA 1FS2A 5FTTB 1PD1A 1XCDA 2ID5A 4R0AA 4QBZA 2BNHA 3WPFA 3PMHG 4CBXG 1P8VA 3WPGA 5FAEA 3UN9A 1OTNA 2MV2A 4Z64C 3EGXA 4LSXA 4LI1A 1NM1G 1UDMA 2NUTA 4J4LA 4AY9X 4PQ8A 4TZHA 2Z7XB 3C6NB 1C0GS 1W8AA 2O6SA 2Z82A 3OJAA 4LI2A 4MN8B 1JHWA 3A79B 1YRGA 1C0FS 5HZLB 1Q8XA 2I2QA 1FO1A 3DAWB 3M18A 4KEEA 4Y61B 4YEBB 3CIYA 5D3IA 5KYWA 3ZYIA 4RCWA 2ASSB 4M7EA 3WN4A 2V9TB 3WPDA 1KCQA 4JD2H 1M10B 3A5MS 4R6JA 2XWTC 1AK7A 1WFSA 4FCGA 4BEX1 2WQUA 3Q2BA 5IVUA 5IJCA 2FH2A 3FG7A 1OZNA 4RWTC 1NPHA 2FH3A 2JE1A 5GS2B 4CBWG 4Q3GA 4RCAB 3VQ2A 1WWLA 1PCXA 3FFNA 2LXXA 3CJCG 1TMWA 2OMUA 4IM6A 3TU5B 4Q3IA 5KYYB 3A5OS 1M2VA 4V2CA 3W3NA 4R6AA 3EH1A 5B0TA 4R6GA 3EGXB 5HVKB 1GWBA 2WQVA 3E6JA 2NUTB 2RR6A 4J0MA 1VFQA 2MOTA 3O6NA 1A9NA 3OJAB 2VIKA 1T2LA 3KJ4A 2NUPA 1MDUA 2WQWA 5A1MA 4KT1A 1D4XG 1G9UA 4XSQA 4FD0A 1YAGG 3EGDA 1M0ZA 4PERA 5KYWB 4MQWX 1PD0A 1DFJI 4QC0A 1KOOA 1U0ND 3UL8A 1K5DC 5AWCA 4WYKA 4PSJA 3W3GA 1FQVA 1XKUA 2XOTA 5LFNA 4V2DA 5IJBA 1OTOA 4WP6A 5FAFA
chains in the Genus database with same CATH superfamily
2FT3A 3M19A 1Z7XW 4H09A 5KYNA 2QTVA 3EG9A 3P72A 2V9SA 1NMDG 4R07A 3OGKB 3GOZA 3E4GA 5GQRK 2Z63A 3RFEA 1EQYS 1HQZ1 3OGLB 1TVJA 2OMWA 2W0IA 2XF1A 1Q8GA 4KXFB 4CILA 2HD7A 1H6UA 4KEDA 3FFKA 1SVQA 2LLFA 1P9AG 5CMPA 2IFGA 1M2VB 1FT8A 1XECA 1M9LA 1AHQA 3FXIA 1D0BA 2R9UA 4G8AA 4FHOA 2JQDA 3G3AA 4R6FA 4KEFA 4S10C 3CI5G 2OMZA 5AWAA 2BEXA 3G39A 1WM4A 4ARRA 4KNGA 4NKHA 2OMXA 2WQXA 1QPVA 5IYXC 1OTMA 2UZXA 3WPIA 3G06A 2VACA 1COFA 4AW4A 3W3LA 3ZYOA 4PKIG 2NUPB 4Z94G 4R08A 3EGDB 3G04C 5B4PA 3JB9j 3G3BA 5L6WC 2OMVA 4QXEA 4CC4A 4FMZA 3CIGA 2UZYA 4Z79A 4LXSA 2Z64A 2CA6A 3UL7A 3DZEA 2P1OB 2OMYA 4FS7A 4NKGA 5KYUA 5DD2A 1ZIWA 2Z65A 4LXRA 4UFRA 3EG9B 4U09A 3REZA 4CC4C 3CVRA 2ASTB 2P1MB 1SVRA 1DCEA 1M2OA 4PKGG 1K5GC 4GT6A 1SVYA 4R09A 4Q62A 4V2EA 5AWBA 4I6JB 4U06A 4CNCA 3RGZA 3WPCA 4P8SA 1OGQA 2FF3A 1T44G 4LSAA 5HVKD 2ELLA 1M9SA 1KOHA 3RJ0A 3ZYJA 4L3FA 1IO0A 4U08A 1OOKG 4R5DA 2LJ8A 2VILA 5AZ5A 4R58A 3ULAA 3A5NS 3WPHA 5CMNA 1NLVG 2JE0A 2V70A 3WPBA 1CFYA 5KYXA 4ECNA 1J72A 5HDHA 4BSUA 4P91A 2P1QB 3W3KA 4NZTM 1CNUA 3A5LS 5KYUB 1AK6A 3E2JA 1H6TA 4EZGA 1P8ZG 2FH4A 3C6PB 3OGMB 4ARNA 1O6VA 4BV4R 3CJBG 4LSXC 2Y5QA 1T3YA 4B8CD 5IJDA 3ULVA 1O6SA 4BSSA 2KVKA 3EFOA 5A5CA 5GMGA 2FGHA 4U7LA 1PGVA 3BZ5A 2Z62A 3O53A 4C2BB 5GMHA 1XEUA 4PKHB 4CNMA 3RIZA 4BSRA 4HQ1A 2A0ZA 1YVNG 3EH2A 1DEJS 1D0NA 4R5CA 4M7EC 1A4YA 4L3AA 3WPEA 1V6FA 3L50A 2Z7XA 3FG6A 3ULUA 1DS9A 3W3JA 1QYYA 4FDWA 4PEQB 3E3ZA 1WNJA 1P8TA 1O6TA 1RGIG 5B0NA 2FH1A 3SB4A 3RFSA 1M4JA 2O6RA 1T3XA 2P1NB 1X67A 1P8XA 3CIPG 5KYXB 4LIZA 2FF6G 4Z8GA 5AWDA 2O6QA 4GLPA 5GS0A 2MP4A 2OMTA 4CBUG 3ZYNA 2RA8A 4CP6A 2P1PB 3C6OB 4K17A 2L72A 4C2AB 3VQ1A 1F7SA 1H1VG 3RFJA 4OQTA 2Z66A 5GMFA 3TSRE 1XWDC 4ECOA 2WFHA 3W3MA 2Q4GW 1ESVS 3UL9A 4XOSA 3EFOB 1SQ0B 4XGOA 1JL5A 3RW6A 5KYYA 2D8BA 2XFAA 2Z81A 4Z61C 3RW7A 4LSCA 1VKKA 1LTXA 3RGXA 1FS2A 5FTTB 1PD1A 1XCDA 2ID5A 4R0AA 4QBZA 2BNHA 3WPFA 3PMHG 4CBXG 1P8VA 3WPGA 5FAEA 3UN9A 1OTNA 2MV2A 4Z64C 3EGXA 4NZRM 4LSXA 4LI1A 1NM1G 1UDMA 2NUTA 4J4LA 4AY9X 4PQ8A 4TZHA 2Z7XB 3C6NB 1C0GS 1W8AA 2O6SA 2Z82A 3OJAA 4LI2A 4MN8B 1JHWA 3A79B 1YRGA 1C0FS 5HZLB 1Q8XA 2I2QA 3DA7A 1FO1A 3DAWB 3M18A 4KEEA 4Y61B 4YEBB 3CIYA 5D3IA 5KYWA 3ZYIA 4RCWA 2ASSB 4M7EA 3WN4A 2V9TB 3WPDA 1KCQA 4JD2H 1M10B 3A5MS 4R6JA 2XWTC 1AK7A 1WFSA 4FCGA 4BEX1 2WQUA 3Q2BA 5IVUA 5IJCA 2FH2A 3FG7A 1OZNA 4RWTC 1NPHA 2FH3A 2JE1A 5GS2B 4CBWG 4Q3GA 4RCAB 3VQ2A 1WWLA 1PCXA 3FFNA 2LXXA 3CJCG 1TMWA 2OMUA 4IM6A 3TU5B 4Q3IA 5KYYB 3A5OS 1M2VA 4V2CA 3W3NA 4R6AA 3EH1A 5B0TA 4R6GA 3EGXB 5HVKB 1GWBA 2WQVA 3E6JA 2NUTB 2RR6A 4J0MA 1VFQA 2MOTA 3O6NA 1A9NA 3OJAB 2VIKA 1T2LA 3KJ4A 2NUPA 1MDUA 2WQWA 5A1MA 4KT1A 1D4XG 1G9UA 4XSQA 4FD0A 1YAGG 3EGDA 1M0ZA 4PERA 5KYWB 4MQWX 1PD0A 1DFJI 4QC0A 1KOOA 1U0ND 3UL8A 1K5DC 5AWCA 4WYKA 4PSJA 3W3GA 1FQVA 1XKUA 2XOTA 5LFNA 4V2DA 5IJBA 1OTOA 4WP6A 5FAFA
chains in the Genus database with same CATH topology
2FT3A 3M19A 1Z7XW 4H09A 5KYNA 2QTVA 3EG9A 3P72A 2V9SA 1NMDG 4R07A 3OGKB 3GOZA 3E4GA 5GQRK 2Z63A 3RFEA 1EQYS 1HQZ1 3OGLB 1TVJA 2OMWA 2W0IA 2XF1A 1Q8GA 4KXFB 4CILA 2HD7A 1H6UA 4KEDA 3FFKA 1SVQA 2LLFA 1P9AG 5CMPA 2IFGA 1M2VB 1FT8A 1XECA 1M9LA 1AHQA 3FXIA 1D0BA 2R9UA 4G8AA 4FHOA 2JQDA 3G3AA 4R6FA 4KEFA 4S10C 3CI5G 2OMZA 5AWAA 2BEXA 3G39A 1WM4A 4ARRA 4KNGA 4NKHA 2OMXA 2WQXA 1QPVA 5IYXC 1OTMA 2UZXA 3WPIA 3G06A 2VACA 1COFA 4AW4A 3W3LA 3ZYOA 4PKIG 2NUPB 4Z94G 4R08A 3EGDB 3G04C 5B4PA 3JB9j 3G3BA 5L6WC 2OMVA 4QXEA 4CC4A 4FMZA 3CIGA 2UZYA 4Z79A 4LXSA 2Z64A 2CA6A 3UL7A 3DZEA 2P1OB 2OMYA 4FS7A 4NKGA 5KYUA 5DD2A 1ZIWA 2Z65A 4LXRA 4UFRA 3EG9B 4U09A 3REZA 4CC4C 3CVRA 2ASTB 2P1MB 1SVRA 1DCEA 1M2OA 4PKGG 1K5GC 4GT6A 1SVYA 4R09A 4Q62A 4V2EA 5AWBA 4I6JB 4U06A 4CNCA 3RGZA 3WPCA 4P8SA 1OGQA 2FF3A 1T44G 4LSAA 5HVKD 2ELLA 1M9SA 1KOHA 3RJ0A 3ZYJA 4L3FA 1IO0A 4U08A 1OOKG 4R5DA 2LJ8A 2VILA 5AZ5A 4R58A 3ULAA 3A5NS 3WPHA 5CMNA 1NLVG 2JE0A 2V70A 3WPBA 1CFYA 5KYXA 4ECNA 1J72A 5HDHA 4BSUA 4P91A 2P1QB 3W3KA 1CNUA 3A5LS 5KYUB 1AK6A 3E2JA 1H6TA 4EZGA 1P8ZG 2FH4A 3C6PB 3OGMB 4ARNA 1O6VA 4BV4R 3CJBG 4LSXC 2Y5QA 1T3YA 4B8CD 5IJDA 3ULVA 1O6SA 4BSSA 2KVKA 3EFOA 5A5CA 5GMGA 2FGHA 4U7LA 1PGVA 3BZ5A 2Z62A 3O53A 4C2BB 5GMHA 1XEUA 4PKHB 4CNMA 3RIZA 4BSRA 4HQ1A 2A0ZA 1YVNG 3EH2A 1DEJS 1D0NA 4R5CA 4M7EC 1A4YA 4L3AA 3WPEA 1V6FA 3L50A 2Z7XA 3FG6A 3ULUA 1DS9A 3W3JA 1QYYA 4FDWA 4PEQB 3E3ZA 1WNJA 1P8TA 1O6TA 1RGIG 5B0NA 2FH1A 3SB4A 3RFSA 1M4JA 2O6RA 1T3XA 2P1NB 1X67A 1P8XA 3CIPG 5KYXB 4LIZA 2FF6G 4Z8GA 5AWDA 2O6QA 4GLPA 5GS0A 2MP4A 2OMTA 4CBUG 3ZYNA 2RA8A 4CP6A 2P1PB 3C6OB 4K17A 2L72A 4C2AB 3VQ1A 1F7SA 1H1VG 3RFJA 4OQTA 2Z66A 5GMFA 3TSRE 1XWDC 4ECOA 2WFHA 3W3MA 2Q4GW 1ESVS 3UL9A 4XOSA 3EFOB 1SQ0B 4XGOA 1JL5A 3RW6A 5KYYA 2D8BA 2XFAA 2Z81A 4Z61C 3RW7A 4LSCA 1VKKA 1LTXA 3RGXA 1FS2A 5FTTB 1PD1A 1XCDA 2ID5A 4R0AA 4QBZA 2BNHA 3WPFA 3PMHG 4CBXG 1P8VA 3WPGA 5FAEA 3UN9A 1OTNA 2MV2A 4Z64C 3EGXA 4LSXA 4LI1A 1NM1G 1UDMA 2NUTA 4J4LA 4AY9X 4PQ8A 4TZHA 2Z7XB 3C6NB 1C0GS 1W8AA 2O6SA 2Z82A 3OJAA 4LI2A 4MN8B 1JHWA 3A79B 1YRGA 1C0FS 5HZLB 1Q8XA 2I2QA 3DA7A 1FO1A 3DAWB 3M18A 4KEEA 4Y61B 4YEBB 3CIYA 5D3IA 5KYWA 3ZYIA 4RCWA 2ASSB 4M7EA 3WN4A 2V9TB 3WPDA 1KCQA 4JD2H 1M10B 3A5MS 4R6JA 2XWTC 1AK7A 1WFSA 4FCGA 4BEX1 2WQUA 3Q2BA 5IVUA 5IJCA 2FH2A 3FG7A 1OZNA 4RWTC 1NPHA 2FH3A 2JE1A 5GS2B 4CBWG 4Q3GA 4RCAB 3VQ2A 1WWLA 1PCXA 3FFNA 2LXXA 3CJCG 1TMWA 2OMUA 4IM6A 3TU5B 4Q3IA 5KYYB 3A5OS 1M2VA 4V2CA 3W3NA 4R6AA 3EH1A 5B0TA 4R6GA 3EGXB 5HVKB 1GWBA 2WQVA 3E6JA 2NUTB 2RR6A 4J0MA 1VFQA 2MOTA 3O6NA 1A9NA 3OJAB 2VIKA 1T2LA 3KJ4A 2NUPA 1MDUA 2WQWA 5A1MA 4KT1A 1D4XG 1G9UA 4XSQA 4FD0A 1YAGG 3EGDA 1M0ZA 4PERA 5KYWB 4MQWX 1PD0A 1DFJI 4QC0A 1KOOA 1U0ND 3UL8A 1K5DC 5AWCA 4WYKA 4PSJA 3W3GA 1FQVA 1XKUA 2XOTA 5LFNA 4V2DA 5IJBA 1OTOA 4WP6A 5FAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FT3 A;  3M19 A;  1Z7X W;  4H09 A;  5KYN A;  2QTV A;  3EG9 A;  3P72 A;  2V9S A;  1NMD G;  4R07 A;  3OGK B;  3GOZ A;  3E4G A;  5GQR K;  2Z63 A;  3RFE A;  1EQY S;  1HQZ 1;  3OGL B;  1TVJ A;  2OMW A;  2W0I A;  2XF1 A;  1Q8G A;  4KXF B;  4CIL A;  2HD7 A;  1H6U A;  4KED A;  3FFK A;  1SVQ A;  2LLF A;  1P9A G;  5CMP A;  2IFG A;  1M2V B;  1FT8 A;  1XEC A;  1M9L A;  1AHQ A;  3FXI A;  1D0B A;  2R9U A;  4G8A A;  4FHO A;  2JQD A;  3G3A A;  4R6F A;  4KEF A;  4S10 C;  3CI5 G;  2OMZ A;  5AWA A;  2BEX A;  3G39 A;  1WM4 A;  4ARR A;  4KNG A;  4NKH A;  2OMX A;  2WQX A;  1QPV A;  5IYX C;  1OTM A;  2UZX A;  3WPI A;  3G06 A;  2VAC A;  1COF A;  4AW4 A;  3W3L A;  3ZYO A;  4PKI G;  2NUP B;  4Z94 G;  4R08 A;  3EGD B;  3G04 C;  5B4P A;  3JB9 j;  3G3B A;  5L6W C;  2OMV A;  4QXE A;  4CC4 A;  4FMZ A;  3CIG A;  2UZY A;  4Z79 A;  4LXS A;  2Z64 A;  2CA6 A;  3UL7 A;  3DZE A;  2P1O B;  2OMY A;  4FS7 A;  4NKG A;  5KYU A;  5DD2 A;  1ZIW A;  2Z65 A;  4LXR A;  4UFR A;  3EG9 B;  4U09 A;  3REZ A;  4CC4 C;  3CVR A;  2AST B;  2P1M B;  1SVR A;  1DCE A;  1M2O A;  4PKG G;  1K5G C;  4GT6 A;  1SVY A;  4R09 A;  4Q62 A;  4V2E A;  5AWB A;  4I6J B;  4U06 A;  4CNC A;  3RGZ A;  3WPC A;  4P8S A;  1OGQ A;  2FF3 A;  1T44 G;  4LSA A;  5HVK D;  2ELL A;  1M9S A;  1KOH A;  3RJ0 A;  3ZYJ A;  4L3F A;  1IO0 A;  4U08 A;  1OOK G;  4R5D A;  2LJ8 A;  2VIL A;  5AZ5 A;  4R58 A;  3ULA A;  3A5N S;  3WPH A;  5CMN A;  1NLV G;  2JE0 A;  2V70 A;  3WPB A;  1CFY A;  5KYX A;  4ECN A;  1J72 A;  5HDH A;  4BSU A;  4P91 A;  2P1Q B;  3W3K A;  1CNU A;  3A5L S;  5KYU B;  1AK6 A;  3E2J A;  1H6T A;  4EZG A;  1P8Z G;  2FH4 A;  3C6P B;  3OGM B;  4ARN A;  1O6V A;  4BV4 R;  3CJB G;  4LSX C;  2Y5Q A;  1T3Y A;  4B8C D;  5IJD A;  3ULV A;  1O6S A;  4BSS A;  2KVK A;  3EFO A;  5A5C A;  5GMG A;  2FGH A;  4U7L A;  1PGV A;  3BZ5 A;  2Z62 A;  3O53 A;  4C2B B;  5GMH A;  1XEU A;  4PKH B;  4CNM A;  3RIZ A;  4BSR A;  4HQ1 A;  2A0Z A;  1YVN G;  3EH2 A;  1DEJ S;  1D0N A;  4R5C A;  4M7E C;  1A4Y A;  4L3A A;  3WPE A;  1V6F A;  3L50 A;  2Z7X A;  3FG6 A;  3ULU A;  1DS9 A;  3W3J A;  1QYY A;  4FDW A;  4PEQ B;  3E3Z A;  1WNJ A;  1P8T A;  1O6T A;  1RGI G;  5B0N A;  2FH1 A;  3SB4 A;  3RFS A;  1M4J A;  2O6R A;  1T3X A;  2P1N B;  1X67 A;  1P8X A;  3CIP G;  5KYX B;  4LIZ A;  2FF6 G;  4Z8G A;  5AWD A;  2O6Q A;  4GLP A;  5GS0 A;  2MP4 A;  2OMT A;  4CBU G;  3ZYN A;  2RA8 A;  4CP6 A;  2P1P B;  3C6O B;  4K17 A;  2L72 A;  4C2A B;  3VQ1 A;  1F7S A;  1H1V G;  3RFJ A;  4OQT A;  2Z66 A;  5GMF A;  3TSR E;  1XWD C;  4ECO A;  2WFH A;  3W3M A;  2Q4G W;  1ESV S;  3UL9 A;  4XOS A;  3EFO B;  1SQ0 B;  4XGO A;  1JL5 A;  3RW6 A;  5KYY A;  2D8B A;  2XFA A;  2Z81 A;  4Z61 C;  3RW7 A;  4LSC A;  1VKK A;  1LTX A;  3RGX A;  1FS2 A;  5FTT B;  1PD1 A;  1XCD A;  2ID5 A;  4R0A A;  4QBZ A;  2BNH A;  3WPF A;  3PMH G;  4CBX G;  1P8V A;  3WPG A;  5FAE A;  3UN9 A;  1OTN A;  2MV2 A;  4Z64 C;  3EGX A;  4LSX A;  4LI1 A;  1NM1 G;  1UDM A;  2NUT A;  4J4L A;  4AY9 X;  4PQ8 A;  4TZH A;  2Z7X B;  3C6N B;  1C0G S;  1W8A A;  2O6S A;  2Z82 A;  3OJA A;  4LI2 A;  4MN8 B;  1JHW A;  3A79 B;  1YRG A;  1C0F S;  5HZL B;  1Q8X A;  2I2Q A;  1FO1 A;  3DAW B;  3M18 A;  4KEE A;  4Y61 B;  4YEB B;  3CIY A;  5D3I A;  5KYW A;  3ZYI A;  4RCW A;  2ASS B;  4M7E A;  3WN4 A;  2V9T B;  3WPD A;  1KCQ A;  4JD2 H;  1M10 B;  3A5M S;  4R6J A;  2XWT C;  1AK7 A;  1WFS A;  4FCG A;  4BEX 1;  2WQU A;  3Q2B A;  5IVU A;  5IJC A;  2FH2 A;  3FG7 A;  1OZN A;  4RWT C;  1NPH A;  2FH3 A;  2JE1 A;  5GS2 B;  4CBW G;  4Q3G A;  4RCA B;  3VQ2 A;  1WWL A;  1PCX A;  3FFN A;  2LXX A;  3CJC G;  1TMW A;  2OMU A;  4IM6 A;  3TU5 B;  4Q3I A;  5KYY B;  3A5O S;  1M2V A;  4V2C A;  3W3N A;  4R6A A;  3EH1 A;  5B0T A;  4R6G A;  3EGX B;  5HVK B;  1GWB A;  2WQV A;  3E6J A;  2NUT B;  2RR6 A;  4J0M A;  1VFQ A;  2MOT A;  3O6N A;  1A9N A;  3OJA B;  2VIK A;  1T2L A;  3KJ4 A;  2NUP A;  1MDU A;  2WQW A;  5A1M A;  4KT1 A;  1D4X G;  1G9U A;  4XSQ A;  4FD0 A;  1YAG G;  3EGD A;  1M0Z A;  4PER A;  5KYW B;  4MQW X;  1PD0 A;  1DFJ I;  4QC0 A;  1KOO A;  1U0N D;  3UL8 A;  1K5D C;  5AWC A;  4WYK A;  4PSJ A;  3W3G A;  1FQV A;  1XKU A;  2XOT A;  5LFN A;  4V2D A;  5IJB A;  1OTO A;  4WP6 A;  5FAF A; 
#chains in the Genus database with same CATH topology
 2FT3 A;  3M19 A;  1Z7X W;  4H09 A;  5KYN A;  2QTV A;  3EG9 A;  3P72 A;  2V9S A;  1NMD G;  4R07 A;  3OGK B;  3GOZ A;  3E4G A;  5GQR K;  2Z63 A;  3RFE A;  1EQY S;  1HQZ 1;  3OGL B;  1TVJ A;  2OMW A;  2W0I A;  2XF1 A;  1Q8G A;  4KXF B;  4CIL A;  2HD7 A;  1H6U A;  4KED A;  3FFK A;  1SVQ A;  2LLF A;  1P9A G;  5CMP A;  2IFG A;  1M2V B;  1FT8 A;  1XEC A;  1M9L A;  1AHQ A;  3FXI A;  1D0B A;  2R9U A;  4G8A A;  4FHO A;  2JQD A;  3G3A A;  4R6F A;  4KEF A;  4S10 C;  3CI5 G;  2OMZ A;  5AWA A;  2BEX A;  3G39 A;  1WM4 A;  4ARR A;  4KNG A;  4NKH A;  2OMX A;  2WQX A;  1QPV A;  5IYX C;  1OTM A;  2UZX A;  3WPI A;  3G06 A;  2VAC A;  1COF A;  4AW4 A;  3W3L A;  3ZYO A;  4PKI G;  2NUP B;  4Z94 G;  4R08 A;  3EGD B;  3G04 C;  5B4P A;  3JB9 j;  3G3B A;  5L6W C;  2OMV A;  4QXE A;  4CC4 A;  4FMZ A;  3CIG A;  2UZY A;  4Z79 A;  4LXS A;  2Z64 A;  2CA6 A;  3UL7 A;  3DZE A;  2P1O B;  2OMY A;  4FS7 A;  4NKG A;  5KYU A;  5DD2 A;  1ZIW A;  2Z65 A;  4LXR A;  4UFR A;  3EG9 B;  4U09 A;  3REZ A;  4CC4 C;  3CVR A;  2AST B;  2P1M B;  1SVR A;  1DCE A;  1M2O A;  4PKG G;  1K5G C;  4GT6 A;  1SVY A;  4R09 A;  4Q62 A;  4V2E A;  5AWB A;  4I6J B;  4U06 A;  4CNC A;  3RGZ A;  3WPC A;  4P8S A;  1OGQ A;  2FF3 A;  1T44 G;  4LSA A;  5HVK D;  2ELL A;  1M9S A;  1KOH A;  3RJ0 A;  3ZYJ A;  4L3F A;  1IO0 A;  4U08 A;  1OOK G;  4R5D A;  2LJ8 A;  2VIL A;  5AZ5 A;  4R58 A;  3ULA A;  3A5N S;  3WPH A;  5CMN A;  1NLV G;  2JE0 A;  2V70 A;  3WPB A;  1CFY A;  5KYX A;  4ECN A;  1J72 A;  5HDH A;  4BSU A;  4P91 A;  2P1Q B;  3W3K A;  4NZT M;  1CNU A;  3A5L S;  5KYU B;  1AK6 A;  3E2J A;  1H6T A;  4EZG A;  1P8Z G;  2FH4 A;  3C6P B;  3OGM B;  4ARN A;  1O6V A;  4BV4 R;  3CJB G;  4LSX C;  2Y5Q A;  1T3Y A;  4B8C D;  5IJD A;  3ULV A;  1O6S A;  4BSS A;  2KVK A;  3EFO A;  5A5C A;  5GMG A;  2FGH A;  4U7L A;  1PGV A;  3BZ5 A;  2Z62 A;  3O53 A;  4C2B B;  5GMH A;  1XEU A;  4PKH B;  4CNM A;  3RIZ A;  4BSR A;  4HQ1 A;  2A0Z A;  1YVN G;  3EH2 A;  1DEJ S;  1D0N A;  4R5C A;  4M7E C;  1A4Y A;  4L3A A;  3WPE A;  1V6F A;  3L50 A;  2Z7X A;  3FG6 A;  3ULU A;  1DS9 A;  3W3J A;  1QYY A;  4FDW A;  4PEQ B;  3E3Z A;  1WNJ A;  1P8T A;  1O6T A;  1RGI G;  5B0N A;  2FH1 A;  3SB4 A;  3RFS A;  1M4J A;  2O6R A;  1T3X A;  2P1N B;  1X67 A;  1P8X A;  3CIP G;  5KYX B;  4LIZ A;  2FF6 G;  4Z8G A;  5AWD A;  2O6Q A;  4GLP A;  5GS0 A;  2MP4 A;  2OMT A;  4CBU G;  3ZYN A;  2RA8 A;  4CP6 A;  2P1P B;  3C6O B;  4K17 A;  2L72 A;  4C2A B;  3VQ1 A;  1F7S A;  1H1V G;  3RFJ A;  4OQT A;  2Z66 A;  5GMF A;  3TSR E;  1XWD C;  4ECO A;  2WFH A;  3W3M A;  2Q4G W;  1ESV S;  3UL9 A;  4XOS A;  3EFO B;  1SQ0 B;  4XGO A;  1JL5 A;  3RW6 A;  5KYY A;  2D8B A;  2XFA A;  2Z81 A;  4Z61 C;  3RW7 A;  4LSC A;  1VKK A;  1LTX A;  3RGX A;  1FS2 A;  5FTT B;  1PD1 A;  1XCD A;  2ID5 A;  4R0A A;  4QBZ A;  2BNH A;  3WPF A;  3PMH G;  4CBX G;  1P8V A;  3WPG A;  5FAE A;  3UN9 A;  1OTN A;  2MV2 A;  4Z64 C;  3EGX A;  4NZR M;  4LSX A;  4LI1 A;  1NM1 G;  1UDM A;  2NUT A;  4J4L A;  4AY9 X;  4PQ8 A;  4TZH A;  2Z7X B;  3C6N B;  1C0G S;  1W8A A;  2O6S A;  2Z82 A;  3OJA A;  4LI2 A;  4MN8 B;  1JHW A;  3A79 B;  1YRG A;  1C0F S;  5HZL B;  1Q8X A;  2I2Q A;  3DA7 A;  1FO1 A;  3DAW B;  3M18 A;  4KEE A;  4Y61 B;  4YEB B;  3CIY A;  5D3I A;  5KYW A;  3ZYI A;  4RCW A;  2ASS B;  4M7E A;  3WN4 A;  2V9T B;  3WPD A;  1KCQ A;  4JD2 H;  1M10 B;  3A5M S;  4R6J A;  2XWT C;  1AK7 A;  1WFS A;  4FCG A;  4BEX 1;  2WQU A;  3Q2B A;  5IVU A;  5IJC A;  2FH2 A;  3FG7 A;  1OZN A;  4RWT C;  1NPH A;  2FH3 A;  2JE1 A;  5GS2 B;  4CBW G;  4Q3G A;  4RCA B;  3VQ2 A;  1WWL A;  1PCX A;  3FFN A;  2LXX A;  3CJC G;  1TMW A;  2OMU A;  4IM6 A;  3TU5 B;  4Q3I A;  5KYY B;  3A5O S;  1M2V A;  4V2C A;  3W3N A;  4R6A A;  3EH1 A;  5B0T A;  4R6G A;  3EGX B;  5HVK B;  1GWB A;  2WQV A;  3E6J A;  2NUT B;  2RR6 A;  4J0M A;  1VFQ A;  2MOT A;  3O6N A;  1A9N A;  3OJA B;  2VIK A;  1T2L A;  3KJ4 A;  2NUP A;  1MDU A;  2WQW A;  5A1M A;  4KT1 A;  1D4X G;  1G9U A;  4XSQ A;  4FD0 A;  1YAG G;  3EGD A;  1M0Z A;  4PER A;  5KYW B;  4MQW X;  1PD0 A;  1DFJ I;  4QC0 A;  1KOO A;  1U0N D;  3UL8 A;  1K5D C;  5AWC A;  4WYK A;  4PSJ A;  3W3G A;  1FQV A;  1XKU A;  2XOT A;  5LFN A;  4V2D A;  5IJB A;  1OTO A;  4WP6 A;  5FAF A; 
#chains in the Genus database with same CATH homology
 2FT3 A;  3M19 A;  1Z7X W;  4H09 A;  5KYN A;  2QTV A;  3EG9 A;  3P72 A;  2V9S A;  1NMD G;  4R07 A;  3OGK B;  3GOZ A;  3E4G A;  5GQR K;  2Z63 A;  3RFE A;  1EQY S;  1HQZ 1;  3OGL B;  1TVJ A;  2OMW A;  2W0I A;  2XF1 A;  1Q8G A;  4KXF B;  4CIL A;  2HD7 A;  1H6U A;  4KED A;  3FFK A;  1SVQ A;  2LLF A;  1P9A G;  5CMP A;  2IFG A;  1M2V B;  1FT8 A;  1XEC A;  1M9L A;  1AHQ A;  3FXI A;  1D0B A;  2R9U A;  4G8A A;  4FHO A;  2JQD A;  3G3A A;  4R6F A;  4KEF A;  4S10 C;  3CI5 G;  2OMZ A;  5AWA A;  2BEX A;  3G39 A;  1WM4 A;  4ARR A;  4KNG A;  4NKH A;  2OMX A;  2WQX A;  1QPV A;  5IYX C;  1OTM A;  2UZX A;  3WPI A;  3G06 A;  2VAC A;  1COF A;  4AW4 A;  3W3L A;  3ZYO A;  4PKI G;  2NUP B;  4Z94 G;  4R08 A;  3EGD B;  3G04 C;  5B4P A;  3JB9 j;  3G3B A;  5L6W C;  2OMV A;  4QXE A;  4CC4 A;  4FMZ A;  3CIG A;  2UZY A;  4Z79 A;  4LXS A;  2Z64 A;  2CA6 A;  3UL7 A;  3DZE A;  2P1O B;  2OMY A;  4FS7 A;  4NKG A;  5KYU A;  5DD2 A;  1ZIW A;  2Z65 A;  4LXR A;  4UFR A;  3EG9 B;  4U09 A;  3REZ A;  4CC4 C;  3CVR A;  2AST B;  2P1M B;  1SVR A;  1DCE A;  1M2O A;  4PKG G;  1K5G C;  4GT6 A;  1SVY A;  4R09 A;  4Q62 A;  4V2E A;  5AWB A;  4I6J B;  4U06 A;  4CNC A;  3RGZ A;  3WPC A;  4P8S A;  1OGQ A;  2FF3 A;  1T44 G;  4LSA A;  5HVK D;  2ELL A;  1M9S A;  1KOH A;  3RJ0 A;  3ZYJ A;  4L3F A;  1IO0 A;  4U08 A;  1OOK G;  4R5D A;  2LJ8 A;  2VIL A;  5AZ5 A;  4R58 A;  3ULA A;  3A5N S;  3WPH A;  5CMN A;  1NLV G;  2JE0 A;  2V70 A;  3WPB A;  1CFY A;  5KYX A;  4ECN A;  1J72 A;  5HDH A;  4BSU A;  4P91 A;  2P1Q B;  3W3K A;  1CNU A;  3A5L S;  5KYU B;  1AK6 A;  3E2J A;  1H6T A;  4EZG A;  1P8Z G;  2FH4 A;  3C6P B;  3OGM B;  4ARN A;  1O6V A;  4BV4 R;  3CJB G;  4LSX C;  2Y5Q A;  1T3Y A;  4B8C D;  5IJD A;  3ULV A;  1O6S A;  4BSS A;  2KVK A;  3EFO A;  5A5C A;  5GMG A;  2FGH A;  4U7L A;  1PGV A;  3BZ5 A;  2Z62 A;  3O53 A;  4C2B B;  5GMH A;  1XEU A;  4PKH B;  4CNM A;  3RIZ A;  4BSR A;  4HQ1 A;  2A0Z A;  1YVN G;  3EH2 A;  1DEJ S;  1D0N A;  4R5C A;  4M7E C;  1A4Y A;  4L3A A;  3WPE A;  1V6F A;  3L50 A;  2Z7X A;  3FG6 A;  3ULU A;  1DS9 A;  3W3J A;  1QYY A;  4FDW A;  4PEQ B;  3E3Z A;  1WNJ A;  1P8T A;  1O6T A;  1RGI G;  5B0N A;  2FH1 A;  3SB4 A;  3RFS A;  1M4J A;  2O6R A;  1T3X A;  2P1N B;  1X67 A;  1P8X A;  3CIP G;  5KYX B;  4LIZ A;  2FF6 G;  4Z8G A;  5AWD A;  2O6Q A;  4GLP A;  5GS0 A;  2MP4 A;  2OMT A;  4CBU G;  3ZYN A;  2RA8 A;  4CP6 A;  2P1P B;  3C6O B;  4K17 A;  2L72 A;  4C2A B;  3VQ1 A;  1F7S A;  1H1V G;  3RFJ A;  4OQT A;  2Z66 A;  5GMF A;  3TSR E;  1XWD C;  4ECO A;  2WFH A;  3W3M A;  2Q4G W;  1ESV S;  3UL9 A;  4XOS A;  3EFO B;  1SQ0 B;  4XGO A;  1JL5 A;  3RW6 A;  5KYY A;  2D8B A;  2XFA A;  2Z81 A;  4Z61 C;  3RW7 A;  4LSC A;  1VKK A;  1LTX A;  3RGX A;  1FS2 A;  5FTT B;  1PD1 A;  1XCD A;  2ID5 A;  4R0A A;  4QBZ A;  2BNH A;  3WPF A;  3PMH G;  4CBX G;  1P8V A;  3WPG A;  5FAE A;  3UN9 A;  1OTN A;  2MV2 A;  4Z64 C;  3EGX A;  4LSX A;  4LI1 A;  1NM1 G;  1UDM A;  2NUT A;  4J4L A;  4AY9 X;  4PQ8 A;  4TZH A;  2Z7X B;  3C6N B;  1C0G S;  1W8A A;  2O6S A;  2Z82 A;  3OJA A;  4LI2 A;  4MN8 B;  1JHW A;  3A79 B;  1YRG A;  1C0F S;  5HZL B;  1Q8X A;  2I2Q A;  3DA7 A;  1FO1 A;  3DAW B;  3M18 A;  4KEE A;  4Y61 B;  4YEB B;  3CIY A;  5D3I A;  5KYW A;  3ZYI A;  4RCW A;  2ASS B;  4M7E A;  3WN4 A;  2V9T B;  3WPD A;  1KCQ A;  4JD2 H;  1M10 B;  3A5M S;  4R6J A;  2XWT C;  1AK7 A;  1WFS A;  4FCG A;  4BEX 1;  2WQU A;  3Q2B A;  5IVU A;  5IJC A;  2FH2 A;  3FG7 A;  1OZN A;  4RWT C;  1NPH A;  2FH3 A;  2JE1 A;  5GS2 B;  4CBW G;  4Q3G A;  4RCA B;  3VQ2 A;  1WWL A;  1PCX A;  3FFN A;  2LXX A;  3CJC G;  1TMW A;  2OMU A;  4IM6 A;  3TU5 B;  4Q3I A;  5KYY B;  3A5O S;  1M2V A;  4V2C A;  3W3N A;  4R6A A;  3EH1 A;  5B0T A;  4R6G A;  3EGX B;  5HVK B;  1GWB A;  2WQV A;  3E6J A;  2NUT B;  2RR6 A;  4J0M A;  1VFQ A;  2MOT A;  3O6N A;  1A9N A;  3OJA B;  2VIK A;  1T2L A;  3KJ4 A;  2NUP A;  1MDU A;  2WQW A;  5A1M A;  4KT1 A;  1D4X G;  1G9U A;  4XSQ A;  4FD0 A;  1YAG G;  3EGD A;  1M0Z A;  4PER A;  5KYW B;  4MQW X;  1PD0 A;  1DFJ I;  4QC0 A;  1KOO A;  1U0N D;  3UL8 A;  1K5D C;  5AWC A;  4WYK A;  4PSJ A;  3W3G A;  1FQV A;  1XKU A;  2XOT A;  5LFN A;  4V2D A;  5IJB A;  1OTO A;  4WP6 A;  5FAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...