4PKIG

Complex of atp-actin with the c-terminal actin-binding domain of tropomodulin
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
306
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFGYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Actin cytoskeleton. Mechanism of actin filament pointed-end capping by tropomodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein/actin-binding protein
molecule keywords Actin, alpha skeletal muscle
total genus 103
structure length 306
sequence length 324
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4pkiG01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4pkiG02
1XECA 5KYUA 3EG9B 3CVRA 3RGXA 4CC4C 1XKUA 1SVQA 1AHQA 1F7SA 3WPFA 2LXXA 4CBWG 1PD0A 4LSXC 3EGDA 3UL9A 3PMHG 5AWAA 4S10C 3ZYIA 3E3ZA 4U7LA 1OGQA 3EG9A 5AWDA 4GLPA 2W0IA 2HD7A 3EFOA 5A1MA 2OMWA 2FH1A 5CMPA 2VIKA 4PQ8A 4KT1A 4Q3GA 4FS7A 5KYYB 5IVUA 4IM6A 2BNHA 5DD2A 4H09A 3WN4A 1KCQA 3DAWB 1MDUA 4L3FA 4PKGG 1FO1A 2ELLA 5IYXC 4BEX1 3TU5B 2P1MB 5FAFA 2LJ8A 2V9TB 3WPCA 3O53A 3E2JA 3FG6A 1WWLA 2OMXA 3VQ2A 4P91A 1NM1G 1YRGA 4QC0A 1XEUA 4V2EA 1H1VG 2L72A 2Z7XB 5KYUB 4Z64C 1WNJA 4B8CD 4WP6A 4J0MA 5KYNA 3EFOB 1GWBA 4XSQA 2V9SA 1FS2A 4U06A 4LXSA 4Y61B 5B4PA 1SVRA 2OMTA 4QXEA 5KYWB 2Z62A 3G39A 3A5MS 3W3NA 1Q8XA 1KOOA 4P8SA 2CA6A 1SQ0B 1H6UA 2FH3A 1M2OA 4CILA 3EH1A 4R5CA 1XCDA 3A5NS 4PKIG 2OMVA 4OQTA 5LFNA 1G9UA 4R0AA 1QPVA 1M0ZA 1CFYA 3CIGA 2QTVA 4C2AB 3RIZA 3W3MA 2JE1A 2O6SA 4FHOA 2P1NB 1P8XA 3W3JA 5GQRK 3UN9A 4Z79A 2LLFA 1YVNG 3CJCG 4CC4A 3OGLB 1TMWA 2Z7XA 4LI1A 4PERA 1T2LA 1WFSA 1W8AA 4MN8B 1OTMA 2XFAA 2JE0A 5KYWA 4PEQB 3A5LS 1M2VB 3OJAA 5A5CA 5GS2B 1JHWA 4U08A 1T3YA 4C2BB 4GT6A 3DZEA 2MV2A 1DCEA 4WYKA 1XWDC 5GMHA 2MP4A 4ECNA 4RCAB 1A9NA 1O6TA 4KEFA 5AZ5A 4XOSA 3WPGA 3CI5G 2I2QA 1EQYS 2OMUA 4LSCA 3WPIA 3C6OB 1ESVS 3FFKA 2O6RA 2R9UA 3OGKB 3ZYOA 1CNUA 1M4JA 2OMZA 3RW6A 1H6TA 1COFA 1D0BA 2KVKA 4XGOA 4R58A 4U09A 3ZYNA 3Q2BA 2Y5QA 2WQXA 4RCWA 2RR6A 1HQZ1 2Z65A 2OMYA 2Z81A 4KXFB 5HZLB 4FMZA 3G3BA 4JD2H 2FH4A 3JB9j 1V6FA 1ZIWA 1C0FS 3UL8A 2UZYA 4R09A 1M2VA 3OJAB 5GS0A 1PD1A 4M7EC 4CNMA 4KEEA 4KNGA 1Z7XW 2O6QA 3ULVA 1T3XA 4LSXA 1DEJS 3A5OS 4I6JB 2A0ZA 4TZHA 3P72A 1Q8GA 3E6JA 1OTNA 3TSRE 3C6PB 1OZNA 1X67A 4FDWA 4QBZA 4AW4A 4FCGA 5CMNA 5AWCA 2RA8A 3BZ5A 2XOTA 3ZYJA 2ID5A 3FG7A 4V2DA 1OOKG 2XF1A 3CIYA 5HDHA 2D8BA 3EH2A 3WPEA 1O6VA 2XWTC 1RGIG 1YAGG 5HVKB 2Z82A 5B0NA 4M7EA 1U0ND 4BSSA 3M18A 4Z94G 3G06A 4Z61C 5GMFA 4BSRA 1PGVA 3RFJA 2P1OB 4LSAA 4ARNA 4L3AA 1D4XG 1A4YA 2NUPA 4LXRA 1QYYA 4RWTC 2Z66A 2Z64A 5D3IA 3WPDA 3G3AA 1J72A 5KYXB 2ASSB 4G8AA 5KYYA 2WQWA 3M19A 1P8TA 1K5DC 4ECOA 4PKHB 1JL5A 2JQDA 2BEXA 4V2CA 4CP6A 1VKKA 3RJ0A 1LTXA 1KOHA 2FGHA 1NLVG 3RW7A 1VFQA 1OTOA 3W3KA 4EZGA 4R6AA 1UDMA 4HQ1A 1SVYA 4BV4R 2MOTA 4UFRA 5IJBA 4R5DA 5IJCA 3O6NA 1NMDG 4R08A 3FXIA 5GMGA 3KJ4A 1C0GS 2ASTB 3W3GA 3UL7A 4NKHA 3RFEA 2NUTA 4FD0A 4ARRA 5AWBA 2P1QB 1M9SA 5HVKD 4Q3IA 2VILA 2NUPB 3VQ1A 1P8ZG 4CBUG 5FAEA 2FH2A 5KYXA 2Q4GW 5FTTB 1IO0A 4LIZA 4J4LA 2FF6G 4LI2A 2WQVA 3ULAA 3SB4A 3G04C 1T44G 1TVJA 1M9LA 3RGZA 1PCXA 2WFHA 4R6GA 1FQVA 4R6FA 3WPHA 4AY9X 4CBXG 1P9AG 5IJDA 4KEDA 4R07A 3CIPG 4R6JA 4BSUA 4Z8GA 3EGDB 2FT3A 1K5GC 2Z63A 3C6NB 4PSJA 3REZA 3W3LA 1AK6A 2V70A 4Q62A 4K17A 3L50A 3WPBA 1DFJI 5B0TA 3EGXB 1DS9A 1AK7A 2WQUA 3ULUA 2FF3A 2VACA 3RFSA 5L6WC 3A79B 1FT8A 1O6SA 1M10B 1P8VA 4MQWX 2NUTB 4CNCA 2UZXA 3FFNA 2P1PB 3OGMB 2IFGA 1NPHA 3E4GA 3CJBG 3EGXA 4NKGA 1WM4A 1D0NA 3GOZA 4YEBB
chains in the Genus database with same CATH superfamily
1XECA 5KYUA 3EG9B 3CVRA 3RGXA 4CC4C 1XKUA 1SVQA 1AHQA 1F7SA 3WPFA 2LXXA 4CBWG 1PD0A 4LSXC 3EGDA 3UL9A 3PMHG 5AWAA 4S10C 3ZYIA 3E3ZA 4U7LA 1OGQA 3EG9A 5AWDA 4GLPA 2W0IA 2HD7A 3EFOA 5A1MA 2OMWA 2FH1A 5CMPA 2VIKA 4PQ8A 4KT1A 4Q3GA 4FS7A 5KYYB 5IVUA 4IM6A 2BNHA 5DD2A 4H09A 3WN4A 1KCQA 3DAWB 1MDUA 4L3FA 4PKGG 1FO1A 2ELLA 5IYXC 4BEX1 3TU5B 2P1MB 5FAFA 2LJ8A 2V9TB 3WPCA 3O53A 3E2JA 3FG6A 1WWLA 2OMXA 3VQ2A 4P91A 1NM1G 1YRGA 4QC0A 1XEUA 4V2EA 1H1VG 2L72A 2Z7XB 5KYUB 4Z64C 1WNJA 4B8CD 4WP6A 4J0MA 5KYNA 3EFOB 1GWBA 4XSQA 2V9SA 1FS2A 4U06A 4LXSA 4Y61B 5B4PA 1SVRA 2OMTA 4QXEA 5KYWB 2Z62A 3G39A 3A5MS 3W3NA 1Q8XA 1KOOA 4P8SA 2CA6A 1SQ0B 1H6UA 2FH3A 1M2OA 4CILA 3EH1A 4R5CA 1XCDA 3A5NS 4PKIG 2OMVA 4OQTA 5LFNA 1G9UA 4R0AA 1QPVA 1M0ZA 1CFYA 3CIGA 2QTVA 4C2AB 3RIZA 3W3MA 2JE1A 2O6SA 4FHOA 2P1NB 1P8XA 3W3JA 5GQRK 3UN9A 4Z79A 2LLFA 1YVNG 3CJCG 4CC4A 3OGLB 1TMWA 2Z7XA 4LI1A 4PERA 1T2LA 1WFSA 1W8AA 4MN8B 1OTMA 2XFAA 2JE0A 5KYWA 4PEQB 3A5LS 1M2VB 3OJAA 5A5CA 5GS2B 1JHWA 4U08A 1T3YA 4C2BB 4GT6A 3DZEA 2MV2A 1DCEA 4WYKA 1XWDC 5GMHA 2MP4A 4ECNA 4RCAB 1A9NA 1O6TA 4KEFA 5AZ5A 4XOSA 3WPGA 3CI5G 2I2QA 1EQYS 2OMUA 4LSCA 3WPIA 3C6OB 1ESVS 3FFKA 2O6RA 2R9UA 3OGKB 3ZYOA 1CNUA 1M4JA 2OMZA 3RW6A 1H6TA 1COFA 1D0BA 2KVKA 4XGOA 4R58A 4U09A 3ZYNA 3Q2BA 2Y5QA 2WQXA 4RCWA 2RR6A 1HQZ1 2Z65A 2OMYA 2Z81A 4KXFB 5HZLB 4FMZA 3G3BA 4JD2H 2FH4A 3JB9j 1V6FA 1ZIWA 1C0FS 3UL8A 2UZYA 4R09A 1M2VA 3OJAB 5GS0A 1PD1A 4M7EC 4CNMA 4KEEA 4KNGA 1Z7XW 2O6QA 3ULVA 1T3XA 4LSXA 1DEJS 3A5OS 4I6JB 2A0ZA 4TZHA 4NZTM 3P72A 1Q8GA 3E6JA 1OTNA 3TSRE 3C6PB 1OZNA 1X67A 4FDWA 4QBZA 4AW4A 4FCGA 5CMNA 5AWCA 2RA8A 3BZ5A 2XOTA 3ZYJA 2ID5A 3FG7A 4V2DA 1OOKG 2XF1A 3CIYA 5HDHA 2D8BA 3EH2A 3WPEA 1O6VA 2XWTC 1RGIG 1YAGG 5HVKB 2Z82A 5B0NA 4M7EA 1U0ND 4BSSA 3M18A 4Z94G 3G06A 4Z61C 5GMFA 4BSRA 1PGVA 3RFJA 2P1OB 4LSAA 4ARNA 4L3AA 1D4XG 3DA7A 1A4YA 2NUPA 4LXRA 1QYYA 4RWTC 2Z66A 2Z64A 5D3IA 3WPDA 3G3AA 1J72A 5KYXB 2ASSB 4G8AA 5KYYA 2WQWA 3M19A 1P8TA 1K5DC 4ECOA 4PKHB 1JL5A 2JQDA 2BEXA 4V2CA 4CP6A 1VKKA 3RJ0A 1LTXA 1KOHA 2FGHA 1NLVG 3RW7A 1VFQA 1OTOA 3W3KA 4EZGA 4R6AA 1UDMA 4HQ1A 1SVYA 4BV4R 2MOTA 4UFRA 5IJBA 4R5DA 5IJCA 3O6NA 1NMDG 4R08A 3FXIA 5GMGA 3KJ4A 1C0GS 2ASTB 3W3GA 3UL7A 4NKHA 3RFEA 2NUTA 4FD0A 4ARRA 5AWBA 2P1QB 1M9SA 5HVKD 4Q3IA 2VILA 2NUPB 3VQ1A 1P8ZG 4CBUG 5FAEA 2FH2A 5KYXA 2Q4GW 5FTTB 1IO0A 4LIZA 4J4LA 2FF6G 4LI2A 2WQVA 3ULAA 3SB4A 3G04C 1T44G 1TVJA 1M9LA 3RGZA 1PCXA 2WFHA 4R6GA 1FQVA 4R6FA 3WPHA 4AY9X 4CBXG 1P9AG 5IJDA 4KEDA 4R07A 3CIPG 4R6JA 4BSUA 4Z8GA 3EGDB 2FT3A 1K5GC 2Z63A 3C6NB 4PSJA 3REZA 3W3LA 1AK6A 2V70A 4Q62A 4K17A 3L50A 3WPBA 1DFJI 5B0TA 3EGXB 1DS9A 1AK7A 2WQUA 3ULUA 2FF3A 2VACA 3RFSA 5L6WC 3A79B 1FT8A 1O6SA 1M10B 1P8VA 4MQWX 2NUTB 4CNCA 2UZXA 3FFNA 2P1PB 3OGMB 2IFGA 1NPHA 3E4GA 3CJBG 4NZRM 3EGXA 4NKGA 1WM4A 1D0NA 3GOZA 4YEBB
chains in the Genus database with same CATH topology
1XECA 5KYUA 3EG9B 3CVRA 3RGXA 4CC4C 1XKUA 1SVQA 1AHQA 1F7SA 3WPFA 2LXXA 4CBWG 1PD0A 4LSXC 3EGDA 3UL9A 3PMHG 5AWAA 4S10C 3ZYIA 3E3ZA 4U7LA 1OGQA 3EG9A 5AWDA 4GLPA 2W0IA 2HD7A 3EFOA 5A1MA 2OMWA 2FH1A 5CMPA 2VIKA 4PQ8A 4KT1A 4Q3GA 4FS7A 5KYYB 5IVUA 4IM6A 2BNHA 5DD2A 4H09A 3WN4A 1KCQA 3DAWB 1MDUA 4L3FA 4PKGG 1FO1A 2ELLA 5IYXC 4BEX1 3TU5B 2P1MB 5FAFA 2LJ8A 2V9TB 3WPCA 3O53A 3E2JA 3FG6A 1WWLA 2OMXA 3VQ2A 4P91A 1NM1G 1YRGA 4QC0A 1XEUA 4V2EA 1H1VG 2L72A 2Z7XB 5KYUB 4Z64C 1WNJA 4B8CD 4WP6A 4J0MA 5KYNA 3EFOB 1GWBA 4XSQA 2V9SA 1FS2A 4U06A 4LXSA 4Y61B 5B4PA 1SVRA 2OMTA 4QXEA 5KYWB 2Z62A 3G39A 3A5MS 3W3NA 1Q8XA 1KOOA 4P8SA 2CA6A 1SQ0B 1H6UA 2FH3A 1M2OA 4CILA 3EH1A 4R5CA 1XCDA 3A5NS 4PKIG 2OMVA 4OQTA 5LFNA 1G9UA 4R0AA 1QPVA 1M0ZA 1CFYA 3CIGA 2QTVA 4C2AB 3RIZA 3W3MA 2JE1A 2O6SA 4FHOA 2P1NB 1P8XA 3W3JA 5GQRK 3UN9A 4Z79A 2LLFA 1YVNG 3CJCG 4CC4A 3OGLB 1TMWA 2Z7XA 4LI1A 4PERA 1T2LA 1WFSA 1W8AA 4MN8B 1OTMA 2XFAA 2JE0A 5KYWA 4PEQB 3A5LS 1M2VB 3OJAA 5A5CA 5GS2B 1JHWA 4U08A 1T3YA 4C2BB 4GT6A 3DZEA 2MV2A 1DCEA 4WYKA 1XWDC 5GMHA 2MP4A 4ECNA 4RCAB 1A9NA 1O6TA 4KEFA 5AZ5A 4XOSA 3WPGA 3CI5G 2I2QA 1EQYS 2OMUA 4LSCA 3WPIA 3C6OB 1ESVS 3FFKA 2O6RA 2R9UA 3OGKB 3ZYOA 1CNUA 1M4JA 2OMZA 3RW6A 1H6TA 1COFA 1D0BA 2KVKA 4XGOA 4R58A 4U09A 3ZYNA 3Q2BA 2Y5QA 2WQXA 4RCWA 2RR6A 1HQZ1 2Z65A 2OMYA 2Z81A 4KXFB 5HZLB 4FMZA 3G3BA 4JD2H 2FH4A 3JB9j 1V6FA 1ZIWA 1C0FS 3UL8A 2UZYA 4R09A 1M2VA 3OJAB 5GS0A 1PD1A 4M7EC 4CNMA 4KEEA 4KNGA 1Z7XW 2O6QA 3ULVA 1T3XA 4LSXA 1DEJS 3A5OS 4I6JB 2A0ZA 4TZHA 3P72A 1Q8GA 3E6JA 1OTNA 3TSRE 3C6PB 1OZNA 1X67A 4FDWA 4QBZA 4AW4A 4FCGA 5CMNA 5AWCA 2RA8A 3BZ5A 2XOTA 3ZYJA 2ID5A 3FG7A 4V2DA 1OOKG 2XF1A 3CIYA 5HDHA 2D8BA 3EH2A 3WPEA 1O6VA 2XWTC 1RGIG 1YAGG 5HVKB 2Z82A 5B0NA 4M7EA 1U0ND 4BSSA 3M18A 4Z94G 3G06A 4Z61C 5GMFA 4BSRA 1PGVA 3RFJA 2P1OB 4LSAA 4ARNA 4L3AA 1D4XG 3DA7A 1A4YA 2NUPA 4LXRA 1QYYA 4RWTC 2Z66A 2Z64A 5D3IA 3WPDA 3G3AA 1J72A 5KYXB 2ASSB 4G8AA 5KYYA 2WQWA 3M19A 1P8TA 1K5DC 4ECOA 4PKHB 1JL5A 2JQDA 2BEXA 4V2CA 4CP6A 1VKKA 3RJ0A 1LTXA 1KOHA 2FGHA 1NLVG 3RW7A 1VFQA 1OTOA 3W3KA 4EZGA 4R6AA 1UDMA 4HQ1A 1SVYA 4BV4R 2MOTA 4UFRA 5IJBA 4R5DA 5IJCA 3O6NA 1NMDG 4R08A 3FXIA 5GMGA 3KJ4A 1C0GS 2ASTB 3W3GA 3UL7A 4NKHA 3RFEA 2NUTA 4FD0A 4ARRA 5AWBA 2P1QB 1M9SA 5HVKD 4Q3IA 2VILA 2NUPB 3VQ1A 1P8ZG 4CBUG 5FAEA 2FH2A 5KYXA 2Q4GW 5FTTB 1IO0A 4LIZA 4J4LA 2FF6G 4LI2A 2WQVA 3ULAA 3SB4A 3G04C 1T44G 1TVJA 1M9LA 3RGZA 1PCXA 2WFHA 4R6GA 1FQVA 4R6FA 3WPHA 4AY9X 4CBXG 1P9AG 5IJDA 4KEDA 4R07A 3CIPG 4R6JA 4BSUA 4Z8GA 3EGDB 2FT3A 1K5GC 2Z63A 3C6NB 4PSJA 3REZA 3W3LA 1AK6A 2V70A 4Q62A 4K17A 3L50A 3WPBA 1DFJI 5B0TA 3EGXB 1DS9A 1AK7A 2WQUA 3ULUA 2FF3A 2VACA 3RFSA 5L6WC 3A79B 1FT8A 1O6SA 1M10B 1P8VA 4MQWX 2NUTB 4CNCA 2UZXA 3FFNA 2P1PB 3OGMB 2IFGA 1NPHA 3E4GA 3CJBG 3EGXA 4NKGA 1WM4A 1D0NA 3GOZA 4YEBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XEC A;  5KYU A;  3EG9 B;  3CVR A;  3RGX A;  4CC4 C;  1XKU A;  1SVQ A;  1AHQ A;  1F7S A;  3WPF A;  2LXX A;  4CBW G;  1PD0 A;  4LSX C;  3EGD A;  3UL9 A;  3PMH G;  5AWA A;  4S10 C;  3ZYI A;  3E3Z A;  4U7L A;  1OGQ A;  3EG9 A;  5AWD A;  4GLP A;  2W0I A;  2HD7 A;  3EFO A;  5A1M A;  2OMW A;  2FH1 A;  5CMP A;  2VIK A;  4PQ8 A;  4KT1 A;  4Q3G A;  4FS7 A;  5KYY B;  5IVU A;  4IM6 A;  2BNH A;  5DD2 A;  4H09 A;  3WN4 A;  1KCQ A;  3DAW B;  1MDU A;  4L3F A;  4PKG G;  1FO1 A;  2ELL A;  5IYX C;  4BEX 1;  3TU5 B;  2P1M B;  5FAF A;  2LJ8 A;  2V9T B;  3WPC A;  3O53 A;  3E2J A;  3FG6 A;  1WWL A;  2OMX A;  3VQ2 A;  4P91 A;  1NM1 G;  1YRG A;  4QC0 A;  1XEU A;  4V2E A;  1H1V G;  2L72 A;  2Z7X B;  5KYU B;  4Z64 C;  1WNJ A;  4B8C D;  4WP6 A;  4J0M A;  5KYN A;  3EFO B;  1GWB A;  4XSQ A;  2V9S A;  1FS2 A;  4U06 A;  4LXS A;  4Y61 B;  5B4P A;  1SVR A;  2OMT A;  4QXE A;  5KYW B;  2Z62 A;  3G39 A;  3A5M S;  3W3N A;  1Q8X A;  1KOO A;  4P8S A;  2CA6 A;  1SQ0 B;  1H6U A;  2FH3 A;  1M2O A;  4CIL A;  3EH1 A;  4R5C A;  1XCD A;  3A5N S;  4PKI G;  2OMV A;  4OQT A;  5LFN A;  1G9U A;  4R0A A;  1QPV A;  1M0Z A;  1CFY A;  3CIG A;  2QTV A;  4C2A B;  3RIZ A;  3W3M A;  2JE1 A;  2O6S A;  4FHO A;  2P1N B;  1P8X A;  3W3J A;  5GQR K;  3UN9 A;  4Z79 A;  2LLF A;  1YVN G;  3CJC G;  4CC4 A;  3OGL B;  1TMW A;  2Z7X A;  4LI1 A;  4PER A;  1T2L A;  1WFS A;  1W8A A;  4MN8 B;  1OTM A;  2XFA A;  2JE0 A;  5KYW A;  4PEQ B;  3A5L S;  1M2V B;  3OJA A;  5A5C A;  5GS2 B;  1JHW A;  4U08 A;  1T3Y A;  4C2B B;  4GT6 A;  3DZE A;  2MV2 A;  1DCE A;  4WYK A;  1XWD C;  5GMH A;  2MP4 A;  4ECN A;  4RCA B;  1A9N A;  1O6T A;  4KEF A;  5AZ5 A;  4XOS A;  3WPG A;  3CI5 G;  2I2Q A;  1EQY S;  2OMU A;  4LSC A;  3WPI A;  3C6O B;  1ESV S;  3FFK A;  2O6R A;  2R9U A;  3OGK B;  3ZYO A;  1CNU A;  1M4J A;  2OMZ A;  3RW6 A;  1H6T A;  1COF A;  1D0B A;  2KVK A;  4XGO A;  4R58 A;  4U09 A;  3ZYN A;  3Q2B A;  2Y5Q A;  2WQX A;  4RCW A;  2RR6 A;  1HQZ 1;  2Z65 A;  2OMY A;  2Z81 A;  4KXF B;  5HZL B;  4FMZ A;  3G3B A;  4JD2 H;  2FH4 A;  3JB9 j;  1V6F A;  1ZIW A;  1C0F S;  3UL8 A;  2UZY A;  4R09 A;  1M2V A;  3OJA B;  5GS0 A;  1PD1 A;  4M7E C;  4CNM A;  4KEE A;  4KNG A;  1Z7X W;  2O6Q A;  3ULV A;  1T3X A;  4LSX A;  1DEJ S;  3A5O S;  4I6J B;  2A0Z A;  4TZH A;  3P72 A;  1Q8G A;  3E6J A;  1OTN A;  3TSR E;  3C6P B;  1OZN A;  1X67 A;  4FDW A;  4QBZ A;  4AW4 A;  4FCG A;  5CMN A;  5AWC A;  2RA8 A;  3BZ5 A;  2XOT A;  3ZYJ A;  2ID5 A;  3FG7 A;  4V2D A;  1OOK G;  2XF1 A;  3CIY A;  5HDH A;  2D8B A;  3EH2 A;  3WPE A;  1O6V A;  2XWT C;  1RGI G;  1YAG G;  5HVK B;  2Z82 A;  5B0N A;  4M7E A;  1U0N D;  4BSS A;  3M18 A;  4Z94 G;  3G06 A;  4Z61 C;  5GMF A;  4BSR A;  1PGV A;  3RFJ A;  2P1O B;  4LSA A;  4ARN A;  4L3A A;  1D4X G;  1A4Y A;  2NUP A;  4LXR A;  1QYY A;  4RWT C;  2Z66 A;  2Z64 A;  5D3I A;  3WPD A;  3G3A A;  1J72 A;  5KYX B;  2ASS B;  4G8A A;  5KYY A;  2WQW A;  3M19 A;  1P8T A;  1K5D C;  4ECO A;  4PKH B;  1JL5 A;  2JQD A;  2BEX A;  4V2C A;  4CP6 A;  1VKK A;  3RJ0 A;  1LTX A;  1KOH A;  2FGH A;  1NLV G;  3RW7 A;  1VFQ A;  1OTO A;  3W3K A;  4EZG A;  4R6A A;  1UDM A;  4HQ1 A;  1SVY A;  4BV4 R;  2MOT A;  4UFR A;  5IJB A;  4R5D A;  5IJC A;  3O6N A;  1NMD G;  4R08 A;  3FXI A;  5GMG A;  3KJ4 A;  1C0G S;  2AST B;  3W3G A;  3UL7 A;  4NKH A;  3RFE A;  2NUT A;  4FD0 A;  4ARR A;  5AWB A;  2P1Q B;  1M9S A;  5HVK D;  4Q3I A;  2VIL A;  2NUP B;  3VQ1 A;  1P8Z G;  4CBU G;  5FAE A;  2FH2 A;  5KYX A;  2Q4G W;  5FTT B;  1IO0 A;  4LIZ A;  4J4L A;  2FF6 G;  4LI2 A;  2WQV A;  3ULA A;  3SB4 A;  3G04 C;  1T44 G;  1TVJ A;  1M9L A;  3RGZ A;  1PCX A;  2WFH A;  4R6G A;  1FQV A;  4R6F A;  3WPH A;  4AY9 X;  4CBX G;  1P9A G;  5IJD A;  4KED A;  4R07 A;  3CIP G;  4R6J A;  4BSU A;  4Z8G A;  3EGD B;  2FT3 A;  1K5G C;  2Z63 A;  3C6N B;  4PSJ A;  3REZ A;  3W3L A;  1AK6 A;  2V70 A;  4Q62 A;  4K17 A;  3L50 A;  3WPB A;  1DFJ I;  5B0T A;  3EGX B;  1DS9 A;  1AK7 A;  2WQU A;  3ULU A;  2FF3 A;  2VAC A;  3RFS A;  5L6W C;  3A79 B;  1FT8 A;  1O6S A;  1M10 B;  1P8V A;  4MQW X;  2NUT B;  4CNC A;  2UZX A;  3FFN A;  2P1P B;  3OGM B;  2IFG A;  1NPH A;  3E4G A;  3CJB G;  3EGX A;  4NKG A;  1WM4 A;  1D0N A;  3GOZ A;  4YEB B; 
#chains in the Genus database with same CATH topology
 1XEC A;  5KYU A;  3EG9 B;  3CVR A;  3RGX A;  4CC4 C;  1XKU A;  1SVQ A;  1AHQ A;  1F7S A;  3WPF A;  2LXX A;  4CBW G;  1PD0 A;  4LSX C;  3EGD A;  3UL9 A;  3PMH G;  5AWA A;  4S10 C;  3ZYI A;  3E3Z A;  4U7L A;  1OGQ A;  3EG9 A;  5AWD A;  4GLP A;  2W0I A;  2HD7 A;  3EFO A;  5A1M A;  2OMW A;  2FH1 A;  5CMP A;  2VIK A;  4PQ8 A;  4KT1 A;  4Q3G A;  4FS7 A;  5KYY B;  5IVU A;  4IM6 A;  2BNH A;  5DD2 A;  4H09 A;  3WN4 A;  1KCQ A;  3DAW B;  1MDU A;  4L3F A;  4PKG G;  1FO1 A;  2ELL A;  5IYX C;  4BEX 1;  3TU5 B;  2P1M B;  5FAF A;  2LJ8 A;  2V9T B;  3WPC A;  3O53 A;  3E2J A;  3FG6 A;  1WWL A;  2OMX A;  3VQ2 A;  4P91 A;  1NM1 G;  1YRG A;  4QC0 A;  1XEU A;  4V2E A;  1H1V G;  2L72 A;  2Z7X B;  5KYU B;  4Z64 C;  1WNJ A;  4B8C D;  4WP6 A;  4J0M A;  5KYN A;  3EFO B;  1GWB A;  4XSQ A;  2V9S A;  1FS2 A;  4U06 A;  4LXS A;  4Y61 B;  5B4P A;  1SVR A;  2OMT A;  4QXE A;  5KYW B;  2Z62 A;  3G39 A;  3A5M S;  3W3N A;  1Q8X A;  1KOO A;  4P8S A;  2CA6 A;  1SQ0 B;  1H6U A;  2FH3 A;  1M2O A;  4CIL A;  3EH1 A;  4R5C A;  1XCD A;  3A5N S;  4PKI G;  2OMV A;  4OQT A;  5LFN A;  1G9U A;  4R0A A;  1QPV A;  1M0Z A;  1CFY A;  3CIG A;  2QTV A;  4C2A B;  3RIZ A;  3W3M A;  2JE1 A;  2O6S A;  4FHO A;  2P1N B;  1P8X A;  3W3J A;  5GQR K;  3UN9 A;  4Z79 A;  2LLF A;  1YVN G;  3CJC G;  4CC4 A;  3OGL B;  1TMW A;  2Z7X A;  4LI1 A;  4PER A;  1T2L A;  1WFS A;  1W8A A;  4MN8 B;  1OTM A;  2XFA A;  2JE0 A;  5KYW A;  4PEQ B;  3A5L S;  1M2V B;  3OJA A;  5A5C A;  5GS2 B;  1JHW A;  4U08 A;  1T3Y A;  4C2B B;  4GT6 A;  3DZE A;  2MV2 A;  1DCE A;  4WYK A;  1XWD C;  5GMH A;  2MP4 A;  4ECN A;  4RCA B;  1A9N A;  1O6T A;  4KEF A;  5AZ5 A;  4XOS A;  3WPG A;  3CI5 G;  2I2Q A;  1EQY S;  2OMU A;  4LSC A;  3WPI A;  3C6O B;  1ESV S;  3FFK A;  2O6R A;  2R9U A;  3OGK B;  3ZYO A;  1CNU A;  1M4J A;  2OMZ A;  3RW6 A;  1H6T A;  1COF A;  1D0B A;  2KVK A;  4XGO A;  4R58 A;  4U09 A;  3ZYN A;  3Q2B A;  2Y5Q A;  2WQX A;  4RCW A;  2RR6 A;  1HQZ 1;  2Z65 A;  2OMY A;  2Z81 A;  4KXF B;  5HZL B;  4FMZ A;  3G3B A;  4JD2 H;  2FH4 A;  3JB9 j;  1V6F A;  1ZIW A;  1C0F S;  3UL8 A;  2UZY A;  4R09 A;  1M2V A;  3OJA B;  5GS0 A;  1PD1 A;  4M7E C;  4CNM A;  4KEE A;  4KNG A;  1Z7X W;  2O6Q A;  3ULV A;  1T3X A;  4LSX A;  1DEJ S;  3A5O S;  4I6J B;  2A0Z A;  4TZH A;  4NZT M;  3P72 A;  1Q8G A;  3E6J A;  1OTN A;  3TSR E;  3C6P B;  1OZN A;  1X67 A;  4FDW A;  4QBZ A;  4AW4 A;  4FCG A;  5CMN A;  5AWC A;  2RA8 A;  3BZ5 A;  2XOT A;  3ZYJ A;  2ID5 A;  3FG7 A;  4V2D A;  1OOK G;  2XF1 A;  3CIY A;  5HDH A;  2D8B A;  3EH2 A;  3WPE A;  1O6V A;  2XWT C;  1RGI G;  1YAG G;  5HVK B;  2Z82 A;  5B0N A;  4M7E A;  1U0N D;  4BSS A;  3M18 A;  4Z94 G;  3G06 A;  4Z61 C;  5GMF A;  4BSR A;  1PGV A;  3RFJ A;  2P1O B;  4LSA A;  4ARN A;  4L3A A;  1D4X G;  3DA7 A;  1A4Y A;  2NUP A;  4LXR A;  1QYY A;  4RWT C;  2Z66 A;  2Z64 A;  5D3I A;  3WPD A;  3G3A A;  1J72 A;  5KYX B;  2ASS B;  4G8A A;  5KYY A;  2WQW A;  3M19 A;  1P8T A;  1K5D C;  4ECO A;  4PKH B;  1JL5 A;  2JQD A;  2BEX A;  4V2C A;  4CP6 A;  1VKK A;  3RJ0 A;  1LTX A;  1KOH A;  2FGH A;  1NLV G;  3RW7 A;  1VFQ A;  1OTO A;  3W3K A;  4EZG A;  4R6A A;  1UDM A;  4HQ1 A;  1SVY A;  4BV4 R;  2MOT A;  4UFR A;  5IJB A;  4R5D A;  5IJC A;  3O6N A;  1NMD G;  4R08 A;  3FXI A;  5GMG A;  3KJ4 A;  1C0G S;  2AST B;  3W3G A;  3UL7 A;  4NKH A;  3RFE A;  2NUT A;  4FD0 A;  4ARR A;  5AWB A;  2P1Q B;  1M9S A;  5HVK D;  4Q3I A;  2VIL A;  2NUP B;  3VQ1 A;  1P8Z G;  4CBU G;  5FAE A;  2FH2 A;  5KYX A;  2Q4G W;  5FTT B;  1IO0 A;  4LIZ A;  4J4L A;  2FF6 G;  4LI2 A;  2WQV A;  3ULA A;  3SB4 A;  3G04 C;  1T44 G;  1TVJ A;  1M9L A;  3RGZ A;  1PCX A;  2WFH A;  4R6G A;  1FQV A;  4R6F A;  3WPH A;  4AY9 X;  4CBX G;  1P9A G;  5IJD A;  4KED A;  4R07 A;  3CIP G;  4R6J A;  4BSU A;  4Z8G A;  3EGD B;  2FT3 A;  1K5G C;  2Z63 A;  3C6N B;  4PSJ A;  3REZ A;  3W3L A;  1AK6 A;  2V70 A;  4Q62 A;  4K17 A;  3L50 A;  3WPB A;  1DFJ I;  5B0T A;  3EGX B;  1DS9 A;  1AK7 A;  2WQU A;  3ULU A;  2FF3 A;  2VAC A;  3RFS A;  5L6W C;  3A79 B;  1FT8 A;  1O6S A;  1M10 B;  1P8V A;  4MQW X;  2NUT B;  4CNC A;  2UZX A;  3FFN A;  2P1P B;  3OGM B;  2IFG A;  1NPH A;  3E4G A;  3CJB G;  4NZR M;  3EGX A;  4NKG A;  1WM4 A;  1D0N A;  3GOZ A;  4YEB B; 
#chains in the Genus database with same CATH homology
 1XEC A;  5KYU A;  3EG9 B;  3CVR A;  3RGX A;  4CC4 C;  1XKU A;  1SVQ A;  1AHQ A;  1F7S A;  3WPF A;  2LXX A;  4CBW G;  1PD0 A;  4LSX C;  3EGD A;  3UL9 A;  3PMH G;  5AWA A;  4S10 C;  3ZYI A;  3E3Z A;  4U7L A;  1OGQ A;  3EG9 A;  5AWD A;  4GLP A;  2W0I A;  2HD7 A;  3EFO A;  5A1M A;  2OMW A;  2FH1 A;  5CMP A;  2VIK A;  4PQ8 A;  4KT1 A;  4Q3G A;  4FS7 A;  5KYY B;  5IVU A;  4IM6 A;  2BNH A;  5DD2 A;  4H09 A;  3WN4 A;  1KCQ A;  3DAW B;  1MDU A;  4L3F A;  4PKG G;  1FO1 A;  2ELL A;  5IYX C;  4BEX 1;  3TU5 B;  2P1M B;  5FAF A;  2LJ8 A;  2V9T B;  3WPC A;  3O53 A;  3E2J A;  3FG6 A;  1WWL A;  2OMX A;  3VQ2 A;  4P91 A;  1NM1 G;  1YRG A;  4QC0 A;  1XEU A;  4V2E A;  1H1V G;  2L72 A;  2Z7X B;  5KYU B;  4Z64 C;  1WNJ A;  4B8C D;  4WP6 A;  4J0M A;  5KYN A;  3EFO B;  1GWB A;  4XSQ A;  2V9S A;  1FS2 A;  4U06 A;  4LXS A;  4Y61 B;  5B4P A;  1SVR A;  2OMT A;  4QXE A;  5KYW B;  2Z62 A;  3G39 A;  3A5M S;  3W3N A;  1Q8X A;  1KOO A;  4P8S A;  2CA6 A;  1SQ0 B;  1H6U A;  2FH3 A;  1M2O A;  4CIL A;  3EH1 A;  4R5C A;  1XCD A;  3A5N S;  4PKI G;  2OMV A;  4OQT A;  5LFN A;  1G9U A;  4R0A A;  1QPV A;  1M0Z A;  1CFY A;  3CIG A;  2QTV A;  4C2A B;  3RIZ A;  3W3M A;  2JE1 A;  2O6S A;  4FHO A;  2P1N B;  1P8X A;  3W3J A;  5GQR K;  3UN9 A;  4Z79 A;  2LLF A;  1YVN G;  3CJC G;  4CC4 A;  3OGL B;  1TMW A;  2Z7X A;  4LI1 A;  4PER A;  1T2L A;  1WFS A;  1W8A A;  4MN8 B;  1OTM A;  2XFA A;  2JE0 A;  5KYW A;  4PEQ B;  3A5L S;  1M2V B;  3OJA A;  5A5C A;  5GS2 B;  1JHW A;  4U08 A;  1T3Y A;  4C2B B;  4GT6 A;  3DZE A;  2MV2 A;  1DCE A;  4WYK A;  1XWD C;  5GMH A;  2MP4 A;  4ECN A;  4RCA B;  1A9N A;  1O6T A;  4KEF A;  5AZ5 A;  4XOS A;  3WPG A;  3CI5 G;  2I2Q A;  1EQY S;  2OMU A;  4LSC A;  3WPI A;  3C6O B;  1ESV S;  3FFK A;  2O6R A;  2R9U A;  3OGK B;  3ZYO A;  1CNU A;  1M4J A;  2OMZ A;  3RW6 A;  1H6T A;  1COF A;  1D0B A;  2KVK A;  4XGO A;  4R58 A;  4U09 A;  3ZYN A;  3Q2B A;  2Y5Q A;  2WQX A;  4RCW A;  2RR6 A;  1HQZ 1;  2Z65 A;  2OMY A;  2Z81 A;  4KXF B;  5HZL B;  4FMZ A;  3G3B A;  4JD2 H;  2FH4 A;  3JB9 j;  1V6F A;  1ZIW A;  1C0F S;  3UL8 A;  2UZY A;  4R09 A;  1M2V A;  3OJA B;  5GS0 A;  1PD1 A;  4M7E C;  4CNM A;  4KEE A;  4KNG A;  1Z7X W;  2O6Q A;  3ULV A;  1T3X A;  4LSX A;  1DEJ S;  3A5O S;  4I6J B;  2A0Z A;  4TZH A;  3P72 A;  1Q8G A;  3E6J A;  1OTN A;  3TSR E;  3C6P B;  1OZN A;  1X67 A;  4FDW A;  4QBZ A;  4AW4 A;  4FCG A;  5CMN A;  5AWC A;  2RA8 A;  3BZ5 A;  2XOT A;  3ZYJ A;  2ID5 A;  3FG7 A;  4V2D A;  1OOK G;  2XF1 A;  3CIY A;  5HDH A;  2D8B A;  3EH2 A;  3WPE A;  1O6V A;  2XWT C;  1RGI G;  1YAG G;  5HVK B;  2Z82 A;  5B0N A;  4M7E A;  1U0N D;  4BSS A;  3M18 A;  4Z94 G;  3G06 A;  4Z61 C;  5GMF A;  4BSR A;  1PGV A;  3RFJ A;  2P1O B;  4LSA A;  4ARN A;  4L3A A;  1D4X G;  3DA7 A;  1A4Y A;  2NUP A;  4LXR A;  1QYY A;  4RWT C;  2Z66 A;  2Z64 A;  5D3I A;  3WPD A;  3G3A A;  1J72 A;  5KYX B;  2ASS B;  4G8A A;  5KYY A;  2WQW A;  3M19 A;  1P8T A;  1K5D C;  4ECO A;  4PKH B;  1JL5 A;  2JQD A;  2BEX A;  4V2C A;  4CP6 A;  1VKK A;  3RJ0 A;  1LTX A;  1KOH A;  2FGH A;  1NLV G;  3RW7 A;  1VFQ A;  1OTO A;  3W3K A;  4EZG A;  4R6A A;  1UDM A;  4HQ1 A;  1SVY A;  4BV4 R;  2MOT A;  4UFR A;  5IJB A;  4R5D A;  5IJC A;  3O6N A;  1NMD G;  4R08 A;  3FXI A;  5GMG A;  3KJ4 A;  1C0G S;  2AST B;  3W3G A;  3UL7 A;  4NKH A;  3RFE A;  2NUT A;  4FD0 A;  4ARR A;  5AWB A;  2P1Q B;  1M9S A;  5HVK D;  4Q3I A;  2VIL A;  2NUP B;  3VQ1 A;  1P8Z G;  4CBU G;  5FAE A;  2FH2 A;  5KYX A;  2Q4G W;  5FTT B;  1IO0 A;  4LIZ A;  4J4L A;  2FF6 G;  4LI2 A;  2WQV A;  3ULA A;  3SB4 A;  3G04 C;  1T44 G;  1TVJ A;  1M9L A;  3RGZ A;  1PCX A;  2WFH A;  4R6G A;  1FQV A;  4R6F A;  3WPH A;  4AY9 X;  4CBX G;  1P9A G;  5IJD A;  4KED A;  4R07 A;  3CIP G;  4R6J A;  4BSU A;  4Z8G A;  3EGD B;  2FT3 A;  1K5G C;  2Z63 A;  3C6N B;  4PSJ A;  3REZ A;  3W3L A;  1AK6 A;  2V70 A;  4Q62 A;  4K17 A;  3L50 A;  3WPB A;  1DFJ I;  5B0T A;  3EGX B;  1DS9 A;  1AK7 A;  2WQU A;  3ULU A;  2FF3 A;  2VAC A;  3RFS A;  5L6W C;  3A79 B;  1FT8 A;  1O6S A;  1M10 B;  1P8V A;  4MQW X;  2NUT B;  4CNC A;  2UZX A;  3FFN A;  2P1P B;  3OGM B;  2IFG A;  1NPH A;  3E4G A;  3CJB G;  3EGX A;  4NKG A;  1WM4 A;  1D0N A;  3GOZ A;  4YEB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...