4PKIG

Complex of atp-actin with the c-terminal actin-binding domain of tropomodulin
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
306
Chain Sequence
b'MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFGYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin, alpha skeletal muscle
publication title Actin cytoskeleton. Mechanism of actin filament pointed-end capping by tropomodulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein/actin-binding protein
total genus 103
structure length 306
sequence length 324
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4pkiG01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4pkiG02
2Q4GW 1OOKG 4KNGA 3WN4A 2ID5A 3UL7A 3RFSA 4J4LA 2RR6A 2OMVA 4CBXG 1ESVS 3RFJA 1WWLA 3OJAA 1VFQA 5HVKB 3PMHG 1A9NA 3E6JA 4LSXC 4OQTA 3G3BA 1YRGA 4XGOA 4UFRA 2Z7XB 2Z62A 5IYXC 2Z7XA 1OTNA 2HD7A 2UZXA 3CIPG 1NM1G 4LSCA 1T44G 3FG7A 2MOTA 1T3YA 3CI5G 3WPEA 2R9UA 2WQWA 3TU5B 4BEX1 1C0GS 4LI2A 5A1MA 4B8CD 3FFNA 4R58A 1H6TA 4AY9X 3CJCG 2W0IA 1J72A 1Z7XW 2FH4A 4V2DA 3A5MS 3ULUA 4R6GA 5IJBA 4R09A 1X67A 1CFYA 2Z65A 4WP6A 4NKHA 2FH3A 4FCGA 1G9UA 5KYNA 4FHOA 4CILA 3TSRE 1PD1A 3UL9A 4WYKA 1M9LA 4FS7A 1DCEA 4Z94G 1JHWA 2FGHA 2MV2A 5IVUA 2Z66A 4R0AA 4S10C 2RA8A 2FH2A 2JQDA 4R5DA 3G06A 1C0FS 3OGMB 4Q3IA 4C2BB 4TZHA 2BEXA 3A5LS 2P1QB 5FAFA 3RW6A 1XKUA 3Q2BA 1XWDC 4KEDA 2ELLA 5KYUB 1M2VB 1XEUA 2FF6G 5KYUA 1FQVA 3W3LA 4KT1A 4ARNA 5IJCA 1M9SA 3W3MA 2WFHA 1XECA 2OMUA 4Q62A 5L6WC 1M2OA 4QXEA 1NPHA 1GWBA 1DEJS 3G04C 2WQXA 2QTVA 5HZLB 4V2EA 2P1NB 4LIZA 3C6OB 3UL8A 4JD2H 1K5DC 3RIZA 2XFAA 4K17A 3SB4A 4L3FA 1AK6A 4ARRA 2FH1A 3FXIA 4U7LA 1ZIWA 4CC4C 4U09A 2VILA 1RGIG 4PKHB 4R6AA 2LXXA 4QBZA 1QYYA 1SVYA 4RCWA 4IM6A 2NUPB 1LTXA 3FFKA 3VQ1A 2UZYA 4LI1A 1SVRA 1FS2A 5CMNA 3RGXA 3W3NA 3CJBG 4CNCA 3FG6A 5AWCA 3WPIA 3L50A 5KYYB 4LXSA 1COFA 4BSSA 4EZGA 5B4PA 2BNHA 2Z82A 4Y61B 1HQZ1 5AWDA 4Z61C 4CBUG 3G3AA 3KJ4A 3WPBA 3WPHA 5A5CA 1P8XA 3WPDA 1NMDG 4RWTC 3W3KA 3CIYA 4FD0A 1PD0A 4ECNA 3WPCA 1M0ZA 2V9TB 2OMYA 2FT3A 4J0MA 2ASSB 3W3JA 1CNUA 2LJ8A 2NUTB 2JE1A 5B0NA 2CA6A 1AK7A 5HDHA 4RCAB 1V6FA 2NUTA 1TMWA 3EH1A 1YAGG 1P8VA 2O6SA 1WM4A 5AWAA 2P1PB 3C6PB 4R6FA 5FTTB 4Z8GA 3UN9A 4BV4R 3EFOB 1M2VA 4M7EC 5GMHA 3WPGA 1P8TA 3GOZA 4LSXA 4CC4A 4FMZA 1M4JA 2XF1A 1O6TA 4Z79A 3WPFA 4PKGG 1D0BA 1OGQA 1PCXA 4R08A 3A5OS 3O6NA 4G8AA 3RFEA 1D4XG 1O6VA 1U0ND 3E3ZA 4P8SA 2Y5QA 3ZYIA 3VQ2A 2OMZA 2Z64A 4I6JB 1KOHA 1NLVG 1QPVA 1DFJI 1PGVA 1SVQA 3G39A 4AW4A 3DZEA 1WNJA 3A5NS 4PSJA 2Z81A 4MN8B 3A79B 3DAWB 3W3GA 4U06A 1FT8A 2L72A 5GMGA 2V70A 2KVKA 2WQVA 1AHQA 2O6QA 3OJAB 2NUPA 5AWBA 3M19A 4MQWX 2V9SA 5AZ5A 4FDWA 3O53A 3EG9B 5HVKD 3EG9A 4XSQA 1D0NA 1IO0A 5FAEA 1T2LA 3EH2A 4Z64C 4PEQB 4QC0A 5KYWB 5KYXB 3OGKB 5KYYA 5LFNA 4KXFB 5KYWA 5KYXA 2O6RA 4YEBB 2Z63A 1WFSA 4R07A 1T3XA 2LLFA 3C6NB 2A0ZA 4Q3GA 2VIKA 3P72A 4CNMA 3EGDB 1OZNA 2D8BA 3EGDA 3M18A 4ECOA 2P1OB 4GLPA 2ASTB 4V2CA 4M7EA 4BSUA 1Q8XA 1O6SA 4H09A 1KOOA 4R6JA 2VACA 3E4GA 2MP4A 4PKIG 5CMPA 1TVJA 2JE0A 1FO1A 2P1MB 4KEEA 2XOTA 3JB9j 1EQYS 1YVNG 5GS0A 2IFGA 4KEFA 1DS9A 4LSAA 4PQ8A 4PERA 1H1VG 3ZYOA 4U08A 1MDUA 3CIGA 5DD2A 4XOSA 4P91A 4HQ1A 1VKKA 4CP6A 5B0TA 3EFOA 1Q8GA 3RW7A 3ZYJA 3BZ5A 5GQRK 3RJ0A 1H6UA 1SQ0B 1OTMA 4CBWG 2XWTC 3EGXB 4GT6A 1A4YA 2FF3A 3ULVA 3EGXA 3ZYNA 1K5GC 4R5CA 1M10B 2I2QA 2WQUA 1XCDA 4L3AA 1UDMA 1F7SA 4NKGA 4BSRA 3E2JA 1JL5A 3RGZA 1P8ZG 1OTOA 5GS2B 4C2AB 1P9AG 2OMTA 4LXRA 3ULAA 3REZA 5GMFA 1KCQA 5D3IA 5IJDA 2OMWA 3CVRA 3OGLB 2OMXA 1W8AA
chains in the Genus database with same CATH superfamily
2Q4GW 1OOKG 4KNGA 3WN4A 2ID5A 3UL7A 3RFSA 4J4LA 2RR6A 2OMVA 4CBXG 1ESVS 3RFJA 1WWLA 3OJAA 1VFQA 5HVKB 3PMHG 1A9NA 3E6JA 4LSXC 4OQTA 3G3BA 1YRGA 4XGOA 4UFRA 2Z7XB 2Z62A 5IYXC 2Z7XA 1OTNA 2HD7A 2UZXA 3CIPG 1NM1G 4LSCA 1T44G 3FG7A 2MOTA 1T3YA 3CI5G 3WPEA 2R9UA 2WQWA 3TU5B 4BEX1 1C0GS 4LI2A 5A1MA 4B8CD 3FFNA 4R58A 1H6TA 4AY9X 3CJCG 2W0IA 1J72A 1Z7XW 2FH4A 4V2DA 3A5MS 3ULUA 4R6GA 5IJBA 4R09A 3DA7A 1X67A 1CFYA 2Z65A 4WP6A 4NKHA 2FH3A 4FCGA 1G9UA 5KYNA 4FHOA 4CILA 3TSRE 1PD1A 3UL9A 4WYKA 1M9LA 4FS7A 1DCEA 4Z94G 1JHWA 2FGHA 2MV2A 5IVUA 2Z66A 4R0AA 4S10C 2RA8A 2FH2A 2JQDA 4R5DA 3G06A 1C0FS 3OGMB 4Q3IA 4C2BB 4TZHA 2BEXA 3A5LS 2P1QB 5FAFA 3RW6A 1XKUA 3Q2BA 1XWDC 4KEDA 2ELLA 5KYUB 1M2VB 1XEUA 2FF6G 5KYUA 1FQVA 3W3LA 4KT1A 4ARNA 5IJCA 1M9SA 3W3MA 2WFHA 1XECA 2OMUA 4Q62A 5L6WC 1M2OA 4QXEA 1NPHA 1GWBA 1DEJS 3G04C 2WQXA 2QTVA 5HZLB 4V2EA 2P1NB 4LIZA 3C6OB 3UL8A 4JD2H 1K5DC 3RIZA 2XFAA 4K17A 3SB4A 4L3FA 1AK6A 4ARRA 2FH1A 4NZTM 3FXIA 4U7LA 1ZIWA 4CC4C 4U09A 2VILA 1RGIG 4PKHB 4R6AA 2LXXA 4QBZA 1QYYA 1SVYA 4RCWA 4IM6A 2NUPB 1LTXA 3FFKA 3VQ1A 2UZYA 4LI1A 1SVRA 1FS2A 5CMNA 3RGXA 3W3NA 3CJBG 4CNCA 3FG6A 5AWCA 3WPIA 3L50A 5KYYB 4LXSA 1COFA 4BSSA 4EZGA 5B4PA 2BNHA 2Z82A 4Y61B 1HQZ1 5AWDA 4Z61C 4CBUG 3G3AA 3KJ4A 3WPBA 3WPHA 5A5CA 1P8XA 3WPDA 1NMDG 4RWTC 3W3KA 3CIYA 4FD0A 1PD0A 4ECNA 3WPCA 1M0ZA 2V9TB 2OMYA 2FT3A 4J0MA 2ASSB 3W3JA 1CNUA 2LJ8A 2NUTB 2JE1A 5B0NA 2CA6A 1AK7A 5HDHA 4RCAB 1V6FA 2NUTA 1TMWA 3EH1A 1YAGG 1P8VA 2O6SA 1WM4A 5AWAA 2P1PB 3C6PB 4R6FA 5FTTB 4Z8GA 3UN9A 4BV4R 3EFOB 1M2VA 4M7EC 5GMHA 3WPGA 4NZRM 1P8TA 3GOZA 4LSXA 4CC4A 4FMZA 1M4JA 2XF1A 1O6TA 4Z79A 3WPFA 4PKGG 1D0BA 1OGQA 1PCXA 4R08A 3A5OS 3O6NA 4G8AA 3RFEA 1D4XG 1O6VA 1U0ND 3E3ZA 4P8SA 2Y5QA 3ZYIA 3VQ2A 2OMZA 2Z64A 4I6JB 1KOHA 1NLVG 1QPVA 1DFJI 1PGVA 1SVQA 3G39A 4AW4A 3DZEA 1WNJA 3A5NS 4PSJA 2Z81A 4MN8B 3A79B 3DAWB 3W3GA 4U06A 1FT8A 2L72A 5GMGA 2V70A 2KVKA 2WQVA 1AHQA 2O6QA 3OJAB 2NUPA 5AWBA 3M19A 4MQWX 2V9SA 5AZ5A 4FDWA 3O53A 3EG9B 5HVKD 3EG9A 4XSQA 1D0NA 1IO0A 5FAEA 1T2LA 3EH2A 4Z64C 4PEQB 4QC0A 5KYWB 5KYXB 3OGKB 5KYYA 5LFNA 4KXFB 5KYWA 5KYXA 2O6RA 4YEBB 2Z63A 1WFSA 4R07A 1T3XA 2LLFA 3C6NB 2A0ZA 4Q3GA 2VIKA 3P72A 4CNMA 3EGDB 1OZNA 2D8BA 3EGDA 3M18A 4ECOA 2P1OB 4GLPA 2ASTB 4V2CA 4M7EA 4BSUA 1Q8XA 1O6SA 4H09A 1KOOA 4R6JA 2VACA 3E4GA 2MP4A 4PKIG 5CMPA 1TVJA 2JE0A 1FO1A 2P1MB 4KEEA 2XOTA 3JB9j 1EQYS 1YVNG 5GS0A 2IFGA 4KEFA 1DS9A 4LSAA 4PQ8A 4PERA 1H1VG 3ZYOA 4U08A 1MDUA 3CIGA 5DD2A 4XOSA 4P91A 4HQ1A 1VKKA 4CP6A 5B0TA 3EFOA 1Q8GA 3RW7A 3ZYJA 3BZ5A 5GQRK 3RJ0A 1H6UA 1SQ0B 1OTMA 4CBWG 2XWTC 3EGXB 4GT6A 1A4YA 2FF3A 3ULVA 3EGXA 3ZYNA 1K5GC 4R5CA 1M10B 2I2QA 2WQUA 1XCDA 4L3AA 1UDMA 1F7SA 4NKGA 4BSRA 3E2JA 1JL5A 3RGZA 1P8ZG 1OTOA 5GS2B 4C2AB 1P9AG 2OMTA 4LXRA 3ULAA 3REZA 5GMFA 1KCQA 5D3IA 5IJDA 2OMWA 3CVRA 3OGLB 2OMXA 1W8AA
chains in the Genus database with same CATH topology
2Q4GW 1OOKG 4KNGA 3WN4A 2ID5A 3UL7A 3RFSA 4J4LA 2RR6A 2OMVA 4CBXG 1ESVS 3RFJA 1WWLA 3OJAA 1VFQA 5HVKB 3PMHG 1A9NA 3E6JA 4LSXC 4OQTA 3G3BA 1YRGA 4XGOA 4UFRA 2Z7XB 2Z62A 5IYXC 2Z7XA 1OTNA 2HD7A 2UZXA 3CIPG 1NM1G 4LSCA 1T44G 3FG7A 2MOTA 1T3YA 3CI5G 3WPEA 2R9UA 2WQWA 3TU5B 4BEX1 1C0GS 4LI2A 5A1MA 4B8CD 3FFNA 4R58A 1H6TA 4AY9X 3CJCG 2W0IA 1J72A 1Z7XW 2FH4A 4V2DA 3A5MS 3ULUA 4R6GA 5IJBA 4R09A 3DA7A 1X67A 1CFYA 2Z65A 4WP6A 4NKHA 2FH3A 4FCGA 1G9UA 5KYNA 4FHOA 4CILA 3TSRE 1PD1A 3UL9A 4WYKA 1M9LA 4FS7A 1DCEA 4Z94G 1JHWA 2FGHA 2MV2A 5IVUA 2Z66A 4R0AA 4S10C 2RA8A 2FH2A 2JQDA 4R5DA 3G06A 1C0FS 3OGMB 4Q3IA 4C2BB 4TZHA 2BEXA 3A5LS 2P1QB 5FAFA 3RW6A 1XKUA 3Q2BA 1XWDC 4KEDA 2ELLA 5KYUB 1M2VB 1XEUA 2FF6G 5KYUA 1FQVA 3W3LA 4KT1A 4ARNA 5IJCA 1M9SA 3W3MA 2WFHA 1XECA 2OMUA 4Q62A 5L6WC 1M2OA 4QXEA 1NPHA 1GWBA 1DEJS 3G04C 2WQXA 2QTVA 5HZLB 4V2EA 2P1NB 4LIZA 3C6OB 3UL8A 4JD2H 1K5DC 3RIZA 2XFAA 4K17A 3SB4A 4L3FA 1AK6A 4ARRA 2FH1A 3FXIA 4U7LA 1ZIWA 4CC4C 4U09A 2VILA 1RGIG 4PKHB 4R6AA 2LXXA 4QBZA 1QYYA 1SVYA 4RCWA 4IM6A 2NUPB 1LTXA 3FFKA 3VQ1A 2UZYA 4LI1A 1SVRA 1FS2A 5CMNA 3RGXA 3W3NA 3CJBG 4CNCA 3FG6A 5AWCA 3WPIA 3L50A 5KYYB 4LXSA 1COFA 4BSSA 4EZGA 5B4PA 2BNHA 2Z82A 4Y61B 1HQZ1 5AWDA 4Z61C 4CBUG 3G3AA 3KJ4A 3WPBA 3WPHA 5A5CA 1P8XA 3WPDA 1NMDG 4RWTC 3W3KA 3CIYA 4FD0A 1PD0A 4ECNA 3WPCA 1M0ZA 2V9TB 2OMYA 2FT3A 4J0MA 2ASSB 3W3JA 1CNUA 2LJ8A 2NUTB 2JE1A 5B0NA 2CA6A 1AK7A 5HDHA 4RCAB 1V6FA 2NUTA 1TMWA 3EH1A 1YAGG 1P8VA 2O6SA 1WM4A 5AWAA 2P1PB 3C6PB 4R6FA 5FTTB 4Z8GA 3UN9A 4BV4R 3EFOB 1M2VA 4M7EC 5GMHA 3WPGA 1P8TA 3GOZA 4LSXA 4CC4A 4FMZA 1M4JA 2XF1A 1O6TA 4Z79A 3WPFA 4PKGG 1D0BA 1OGQA 1PCXA 4R08A 3A5OS 3O6NA 4G8AA 3RFEA 1D4XG 1O6VA 1U0ND 3E3ZA 4P8SA 2Y5QA 3ZYIA 3VQ2A 2OMZA 2Z64A 4I6JB 1KOHA 1NLVG 1QPVA 1DFJI 1PGVA 1SVQA 3G39A 4AW4A 3DZEA 1WNJA 3A5NS 4PSJA 2Z81A 4MN8B 3A79B 3DAWB 3W3GA 4U06A 1FT8A 2L72A 5GMGA 2V70A 2KVKA 2WQVA 1AHQA 2O6QA 3OJAB 2NUPA 5AWBA 3M19A 4MQWX 2V9SA 5AZ5A 4FDWA 3O53A 3EG9B 5HVKD 3EG9A 4XSQA 1D0NA 1IO0A 5FAEA 1T2LA 3EH2A 4Z64C 4PEQB 4QC0A 5KYWB 5KYXB 3OGKB 5KYYA 5LFNA 4KXFB 5KYWA 5KYXA 2O6RA 4YEBB 2Z63A 1WFSA 4R07A 1T3XA 2LLFA 3C6NB 2A0ZA 4Q3GA 2VIKA 3P72A 4CNMA 3EGDB 1OZNA 2D8BA 3EGDA 3M18A 4ECOA 2P1OB 4GLPA 2ASTB 4V2CA 4M7EA 4BSUA 1Q8XA 1O6SA 4H09A 1KOOA 4R6JA 2VACA 3E4GA 2MP4A 4PKIG 5CMPA 1TVJA 2JE0A 1FO1A 2P1MB 4KEEA 2XOTA 3JB9j 1EQYS 1YVNG 5GS0A 2IFGA 4KEFA 1DS9A 4LSAA 4PQ8A 4PERA 1H1VG 3ZYOA 4U08A 1MDUA 3CIGA 5DD2A 4XOSA 4P91A 4HQ1A 1VKKA 4CP6A 5B0TA 3EFOA 1Q8GA 3RW7A 3ZYJA 3BZ5A 5GQRK 3RJ0A 1H6UA 1SQ0B 1OTMA 4CBWG 2XWTC 3EGXB 4GT6A 1A4YA 2FF3A 3ULVA 3EGXA 3ZYNA 1K5GC 4R5CA 1M10B 2I2QA 2WQUA 1XCDA 4L3AA 1UDMA 1F7SA 4NKGA 4BSRA 3E2JA 1JL5A 3RGZA 1P8ZG 1OTOA 5GS2B 4C2AB 1P9AG 2OMTA 4LXRA 3ULAA 3REZA 5GMFA 1KCQA 5D3IA 5IJDA 2OMWA 3CVRA 3OGLB 2OMXA 1W8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4G W;  1OOK G;  4KNG A;  3WN4 A;  2ID5 A;  3UL7 A;  3RFS A;  4J4L A;  2RR6 A;  2OMV A;  4CBX G;  1ESV S;  3RFJ A;  1WWL A;  3OJA A;  1VFQ A;  5HVK B;  3PMH G;  1A9N A;  3E6J A;  4LSX C;  4OQT A;  3G3B A;  1YRG A;  4XGO A;  4UFR A;  2Z7X B;  2Z62 A;  5IYX C;  2Z7X A;  1OTN A;  2HD7 A;  2UZX A;  3CIP G;  1NM1 G;  4LSC A;  1T44 G;  3FG7 A;  2MOT A;  1T3Y A;  3CI5 G;  3WPE A;  2R9U A;  2WQW A;  3TU5 B;  4BEX 1;  1C0G S;  4LI2 A;  5A1M A;  4B8C D;  3FFN A;  4R58 A;  1H6T A;  4AY9 X;  3CJC G;  2W0I A;  1J72 A;  1Z7X W;  2FH4 A;  4V2D A;  3A5M S;  3ULU A;  4R6G A;  5IJB A;  4R09 A;  1X67 A;  1CFY A;  2Z65 A;  4WP6 A;  4NKH A;  2FH3 A;  4FCG A;  1G9U A;  5KYN A;  4FHO A;  4CIL A;  3TSR E;  1PD1 A;  3UL9 A;  4WYK A;  1M9L A;  4FS7 A;  1DCE A;  4Z94 G;  1JHW A;  2FGH A;  2MV2 A;  5IVU A;  2Z66 A;  4R0A A;  4S10 C;  2RA8 A;  2FH2 A;  2JQD A;  4R5D A;  3G06 A;  1C0F S;  3OGM B;  4Q3I A;  4C2B B;  4TZH A;  2BEX A;  3A5L S;  2P1Q B;  5FAF A;  3RW6 A;  1XKU A;  3Q2B A;  1XWD C;  4KED A;  2ELL A;  5KYU B;  1M2V B;  1XEU A;  2FF6 G;  5KYU A;  1FQV A;  3W3L A;  4KT1 A;  4ARN A;  5IJC A;  1M9S A;  3W3M A;  2WFH A;  1XEC A;  2OMU A;  4Q62 A;  5L6W C;  1M2O A;  4QXE A;  1NPH A;  1GWB A;  1DEJ S;  3G04 C;  2WQX A;  2QTV A;  5HZL B;  4V2E A;  2P1N B;  4LIZ A;  3C6O B;  3UL8 A;  4JD2 H;  1K5D C;  3RIZ A;  2XFA A;  4K17 A;  3SB4 A;  4L3F A;  1AK6 A;  4ARR A;  2FH1 A;  3FXI A;  4U7L A;  1ZIW A;  4CC4 C;  4U09 A;  2VIL A;  1RGI G;  4PKH B;  4R6A A;  2LXX A;  4QBZ A;  1QYY A;  1SVY A;  4RCW A;  4IM6 A;  2NUP B;  1LTX A;  3FFK A;  3VQ1 A;  2UZY A;  4LI1 A;  1SVR A;  1FS2 A;  5CMN A;  3RGX A;  3W3N A;  3CJB G;  4CNC A;  3FG6 A;  5AWC A;  3WPI A;  3L50 A;  5KYY B;  4LXS A;  1COF A;  4BSS A;  4EZG A;  5B4P A;  2BNH A;  2Z82 A;  4Y61 B;  1HQZ 1;  5AWD A;  4Z61 C;  4CBU G;  3G3A A;  3KJ4 A;  3WPB A;  3WPH A;  5A5C A;  1P8X A;  3WPD A;  1NMD G;  4RWT C;  3W3K A;  3CIY A;  4FD0 A;  1PD0 A;  4ECN A;  3WPC A;  1M0Z A;  2V9T B;  2OMY A;  2FT3 A;  4J0M A;  2ASS B;  3W3J A;  1CNU A;  2LJ8 A;  2NUT B;  2JE1 A;  5B0N A;  2CA6 A;  1AK7 A;  5HDH A;  4RCA B;  1V6F A;  2NUT A;  1TMW A;  3EH1 A;  1YAG G;  1P8V A;  2O6S A;  1WM4 A;  5AWA A;  2P1P B;  3C6P B;  4R6F A;  5FTT B;  4Z8G A;  3UN9 A;  4BV4 R;  3EFO B;  1M2V A;  4M7E C;  5GMH A;  3WPG A;  1P8T A;  3GOZ A;  4LSX A;  4CC4 A;  4FMZ A;  1M4J A;  2XF1 A;  1O6T A;  4Z79 A;  3WPF A;  4PKG G;  1D0B A;  1OGQ A;  1PCX A;  4R08 A;  3A5O S;  3O6N A;  4G8A A;  3RFE A;  1D4X G;  1O6V A;  1U0N D;  3E3Z A;  4P8S A;  2Y5Q A;  3ZYI A;  3VQ2 A;  2OMZ A;  2Z64 A;  4I6J B;  1KOH A;  1NLV G;  1QPV A;  1DFJ I;  1PGV A;  1SVQ A;  3G39 A;  4AW4 A;  3DZE A;  1WNJ A;  3A5N S;  4PSJ A;  2Z81 A;  4MN8 B;  3A79 B;  3DAW B;  3W3G A;  4U06 A;  1FT8 A;  2L72 A;  5GMG A;  2V70 A;  2KVK A;  2WQV A;  1AHQ A;  2O6Q A;  3OJA B;  2NUP A;  5AWB A;  3M19 A;  4MQW X;  2V9S A;  5AZ5 A;  4FDW A;  3O53 A;  3EG9 B;  5HVK D;  3EG9 A;  4XSQ A;  1D0N A;  1IO0 A;  5FAE A;  1T2L A;  3EH2 A;  4Z64 C;  4PEQ B;  4QC0 A;  5KYW B;  5KYX B;  3OGK B;  5KYY A;  5LFN A;  4KXF B;  5KYW A;  5KYX A;  2O6R A;  4YEB B;  2Z63 A;  1WFS A;  4R07 A;  1T3X A;  2LLF A;  3C6N B;  2A0Z A;  4Q3G A;  2VIK A;  3P72 A;  4CNM A;  3EGD B;  1OZN A;  2D8B A;  3EGD A;  3M18 A;  4ECO A;  2P1O B;  4GLP A;  2AST B;  4V2C A;  4M7E A;  4BSU A;  1Q8X A;  1O6S A;  4H09 A;  1KOO A;  4R6J A;  2VAC A;  3E4G A;  2MP4 A;  4PKI G;  5CMP A;  1TVJ A;  2JE0 A;  1FO1 A;  2P1M B;  4KEE A;  2XOT A;  3JB9 j;  1EQY S;  1YVN G;  5GS0 A;  2IFG A;  4KEF A;  1DS9 A;  4LSA A;  4PQ8 A;  4PER A;  1H1V G;  3ZYO A;  4U08 A;  1MDU A;  3CIG A;  5DD2 A;  4XOS A;  4P91 A;  4HQ1 A;  1VKK A;  4CP6 A;  5B0T A;  3EFO A;  1Q8G A;  3RW7 A;  3ZYJ A;  3BZ5 A;  5GQR K;  3RJ0 A;  1H6U A;  1SQ0 B;  1OTM A;  4CBW G;  2XWT C;  3EGX B;  4GT6 A;  1A4Y A;  2FF3 A;  3ULV A;  3EGX A;  3ZYN A;  1K5G C;  4R5C A;  1M10 B;  2I2Q A;  2WQU A;  1XCD A;  4L3A A;  1UDM A;  1F7S A;  4NKG A;  4BSR A;  3E2J A;  1JL5 A;  3RGZ A;  1P8Z G;  1OTO A;  5GS2 B;  4C2A B;  1P9A G;  2OMT A;  4LXR A;  3ULA A;  3REZ A;  5GMF A;  1KCQ A;  5D3I A;  5IJD A;  2OMW A;  3CVR A;  3OGL B;  2OMX A;  1W8A A; 
#chains in the Genus database with same CATH topology
 2Q4G W;  1OOK G;  4KNG A;  3WN4 A;  2ID5 A;  3UL7 A;  3RFS A;  4J4L A;  2RR6 A;  2OMV A;  4CBX G;  1ESV S;  3RFJ A;  1WWL A;  3OJA A;  1VFQ A;  5HVK B;  3PMH G;  1A9N A;  3E6J A;  4LSX C;  4OQT A;  3G3B A;  1YRG A;  4XGO A;  4UFR A;  2Z7X B;  2Z62 A;  5IYX C;  2Z7X A;  1OTN A;  2HD7 A;  2UZX A;  3CIP G;  1NM1 G;  4LSC A;  1T44 G;  3FG7 A;  2MOT A;  1T3Y A;  3CI5 G;  3WPE A;  2R9U A;  2WQW A;  3TU5 B;  4BEX 1;  1C0G S;  4LI2 A;  5A1M A;  4B8C D;  3FFN A;  4R58 A;  1H6T A;  4AY9 X;  3CJC G;  2W0I A;  1J72 A;  1Z7X W;  2FH4 A;  4V2D A;  3A5M S;  3ULU A;  4R6G A;  5IJB A;  4R09 A;  3DA7 A;  1X67 A;  1CFY A;  2Z65 A;  4WP6 A;  4NKH A;  2FH3 A;  4FCG A;  1G9U A;  5KYN A;  4FHO A;  4CIL A;  3TSR E;  1PD1 A;  3UL9 A;  4WYK A;  1M9L A;  4FS7 A;  1DCE A;  4Z94 G;  1JHW A;  2FGH A;  2MV2 A;  5IVU A;  2Z66 A;  4R0A A;  4S10 C;  2RA8 A;  2FH2 A;  2JQD A;  4R5D A;  3G06 A;  1C0F S;  3OGM B;  4Q3I A;  4C2B B;  4TZH A;  2BEX A;  3A5L S;  2P1Q B;  5FAF A;  3RW6 A;  1XKU A;  3Q2B A;  1XWD C;  4KED A;  2ELL A;  5KYU B;  1M2V B;  1XEU A;  2FF6 G;  5KYU A;  1FQV A;  3W3L A;  4KT1 A;  4ARN A;  5IJC A;  1M9S A;  3W3M A;  2WFH A;  1XEC A;  2OMU A;  4Q62 A;  5L6W C;  1M2O A;  4QXE A;  1NPH A;  1GWB A;  1DEJ S;  3G04 C;  2WQX A;  2QTV A;  5HZL B;  4V2E A;  2P1N B;  4LIZ A;  3C6O B;  3UL8 A;  4JD2 H;  1K5D C;  3RIZ A;  2XFA A;  4K17 A;  3SB4 A;  4L3F A;  1AK6 A;  4ARR A;  2FH1 A;  4NZT M;  3FXI A;  4U7L A;  1ZIW A;  4CC4 C;  4U09 A;  2VIL A;  1RGI G;  4PKH B;  4R6A A;  2LXX A;  4QBZ A;  1QYY A;  1SVY A;  4RCW A;  4IM6 A;  2NUP B;  1LTX A;  3FFK A;  3VQ1 A;  2UZY A;  4LI1 A;  1SVR A;  1FS2 A;  5CMN A;  3RGX A;  3W3N A;  3CJB G;  4CNC A;  3FG6 A;  5AWC A;  3WPI A;  3L50 A;  5KYY B;  4LXS A;  1COF A;  4BSS A;  4EZG A;  5B4P A;  2BNH A;  2Z82 A;  4Y61 B;  1HQZ 1;  5AWD A;  4Z61 C;  4CBU G;  3G3A A;  3KJ4 A;  3WPB A;  3WPH A;  5A5C A;  1P8X A;  3WPD A;  1NMD G;  4RWT C;  3W3K A;  3CIY A;  4FD0 A;  1PD0 A;  4ECN A;  3WPC A;  1M0Z A;  2V9T B;  2OMY A;  2FT3 A;  4J0M A;  2ASS B;  3W3J A;  1CNU A;  2LJ8 A;  2NUT B;  2JE1 A;  5B0N A;  2CA6 A;  1AK7 A;  5HDH A;  4RCA B;  1V6F A;  2NUT A;  1TMW A;  3EH1 A;  1YAG G;  1P8V A;  2O6S A;  1WM4 A;  5AWA A;  2P1P B;  3C6P B;  4R6F A;  5FTT B;  4Z8G A;  3UN9 A;  4BV4 R;  3EFO B;  1M2V A;  4M7E C;  5GMH A;  3WPG A;  4NZR M;  1P8T A;  3GOZ A;  4LSX A;  4CC4 A;  4FMZ A;  1M4J A;  2XF1 A;  1O6T A;  4Z79 A;  3WPF A;  4PKG G;  1D0B A;  1OGQ A;  1PCX A;  4R08 A;  3A5O S;  3O6N A;  4G8A A;  3RFE A;  1D4X G;  1O6V A;  1U0N D;  3E3Z A;  4P8S A;  2Y5Q A;  3ZYI A;  3VQ2 A;  2OMZ A;  2Z64 A;  4I6J B;  1KOH A;  1NLV G;  1QPV A;  1DFJ I;  1PGV A;  1SVQ A;  3G39 A;  4AW4 A;  3DZE A;  1WNJ A;  3A5N S;  4PSJ A;  2Z81 A;  4MN8 B;  3A79 B;  3DAW B;  3W3G A;  4U06 A;  1FT8 A;  2L72 A;  5GMG A;  2V70 A;  2KVK A;  2WQV A;  1AHQ A;  2O6Q A;  3OJA B;  2NUP A;  5AWB A;  3M19 A;  4MQW X;  2V9S A;  5AZ5 A;  4FDW A;  3O53 A;  3EG9 B;  5HVK D;  3EG9 A;  4XSQ A;  1D0N A;  1IO0 A;  5FAE A;  1T2L A;  3EH2 A;  4Z64 C;  4PEQ B;  4QC0 A;  5KYW B;  5KYX B;  3OGK B;  5KYY A;  5LFN A;  4KXF B;  5KYW A;  5KYX A;  2O6R A;  4YEB B;  2Z63 A;  1WFS A;  4R07 A;  1T3X A;  2LLF A;  3C6N B;  2A0Z A;  4Q3G A;  2VIK A;  3P72 A;  4CNM A;  3EGD B;  1OZN A;  2D8B A;  3EGD A;  3M18 A;  4ECO A;  2P1O B;  4GLP A;  2AST B;  4V2C A;  4M7E A;  4BSU A;  1Q8X A;  1O6S A;  4H09 A;  1KOO A;  4R6J A;  2VAC A;  3E4G A;  2MP4 A;  4PKI G;  5CMP A;  1TVJ A;  2JE0 A;  1FO1 A;  2P1M B;  4KEE A;  2XOT A;  3JB9 j;  1EQY S;  1YVN G;  5GS0 A;  2IFG A;  4KEF A;  1DS9 A;  4LSA A;  4PQ8 A;  4PER A;  1H1V G;  3ZYO A;  4U08 A;  1MDU A;  3CIG A;  5DD2 A;  4XOS A;  4P91 A;  4HQ1 A;  1VKK A;  4CP6 A;  5B0T A;  3EFO A;  1Q8G A;  3RW7 A;  3ZYJ A;  3BZ5 A;  5GQR K;  3RJ0 A;  1H6U A;  1SQ0 B;  1OTM A;  4CBW G;  2XWT C;  3EGX B;  4GT6 A;  1A4Y A;  2FF3 A;  3ULV A;  3EGX A;  3ZYN A;  1K5G C;  4R5C A;  1M10 B;  2I2Q A;  2WQU A;  1XCD A;  4L3A A;  1UDM A;  1F7S A;  4NKG A;  4BSR A;  3E2J A;  1JL5 A;  3RGZ A;  1P8Z G;  1OTO A;  5GS2 B;  4C2A B;  1P9A G;  2OMT A;  4LXR A;  3ULA A;  3REZ A;  5GMF A;  1KCQ A;  5D3I A;  5IJD A;  2OMW A;  3CVR A;  3OGL B;  2OMX A;  1W8A A; 
#chains in the Genus database with same CATH homology
 2Q4G W;  1OOK G;  4KNG A;  3WN4 A;  2ID5 A;  3UL7 A;  3RFS A;  4J4L A;  2RR6 A;  2OMV A;  4CBX G;  1ESV S;  3RFJ A;  1WWL A;  3OJA A;  1VFQ A;  5HVK B;  3PMH G;  1A9N A;  3E6J A;  4LSX C;  4OQT A;  3G3B A;  1YRG A;  4XGO A;  4UFR A;  2Z7X B;  2Z62 A;  5IYX C;  2Z7X A;  1OTN A;  2HD7 A;  2UZX A;  3CIP G;  1NM1 G;  4LSC A;  1T44 G;  3FG7 A;  2MOT A;  1T3Y A;  3CI5 G;  3WPE A;  2R9U A;  2WQW A;  3TU5 B;  4BEX 1;  1C0G S;  4LI2 A;  5A1M A;  4B8C D;  3FFN A;  4R58 A;  1H6T A;  4AY9 X;  3CJC G;  2W0I A;  1J72 A;  1Z7X W;  2FH4 A;  4V2D A;  3A5M S;  3ULU A;  4R6G A;  5IJB A;  4R09 A;  3DA7 A;  1X67 A;  1CFY A;  2Z65 A;  4WP6 A;  4NKH A;  2FH3 A;  4FCG A;  1G9U A;  5KYN A;  4FHO A;  4CIL A;  3TSR E;  1PD1 A;  3UL9 A;  4WYK A;  1M9L A;  4FS7 A;  1DCE A;  4Z94 G;  1JHW A;  2FGH A;  2MV2 A;  5IVU A;  2Z66 A;  4R0A A;  4S10 C;  2RA8 A;  2FH2 A;  2JQD A;  4R5D A;  3G06 A;  1C0F S;  3OGM B;  4Q3I A;  4C2B B;  4TZH A;  2BEX A;  3A5L S;  2P1Q B;  5FAF A;  3RW6 A;  1XKU A;  3Q2B A;  1XWD C;  4KED A;  2ELL A;  5KYU B;  1M2V B;  1XEU A;  2FF6 G;  5KYU A;  1FQV A;  3W3L A;  4KT1 A;  4ARN A;  5IJC A;  1M9S A;  3W3M A;  2WFH A;  1XEC A;  2OMU A;  4Q62 A;  5L6W C;  1M2O A;  4QXE A;  1NPH A;  1GWB A;  1DEJ S;  3G04 C;  2WQX A;  2QTV A;  5HZL B;  4V2E A;  2P1N B;  4LIZ A;  3C6O B;  3UL8 A;  4JD2 H;  1K5D C;  3RIZ A;  2XFA A;  4K17 A;  3SB4 A;  4L3F A;  1AK6 A;  4ARR A;  2FH1 A;  3FXI A;  4U7L A;  1ZIW A;  4CC4 C;  4U09 A;  2VIL A;  1RGI G;  4PKH B;  4R6A A;  2LXX A;  4QBZ A;  1QYY A;  1SVY A;  4RCW A;  4IM6 A;  2NUP B;  1LTX A;  3FFK A;  3VQ1 A;  2UZY A;  4LI1 A;  1SVR A;  1FS2 A;  5CMN A;  3RGX A;  3W3N A;  3CJB G;  4CNC A;  3FG6 A;  5AWC A;  3WPI A;  3L50 A;  5KYY B;  4LXS A;  1COF A;  4BSS A;  4EZG A;  5B4P A;  2BNH A;  2Z82 A;  4Y61 B;  1HQZ 1;  5AWD A;  4Z61 C;  4CBU G;  3G3A A;  3KJ4 A;  3WPB A;  3WPH A;  5A5C A;  1P8X A;  3WPD A;  1NMD G;  4RWT C;  3W3K A;  3CIY A;  4FD0 A;  1PD0 A;  4ECN A;  3WPC A;  1M0Z A;  2V9T B;  2OMY A;  2FT3 A;  4J0M A;  2ASS B;  3W3J A;  1CNU A;  2LJ8 A;  2NUT B;  2JE1 A;  5B0N A;  2CA6 A;  1AK7 A;  5HDH A;  4RCA B;  1V6F A;  2NUT A;  1TMW A;  3EH1 A;  1YAG G;  1P8V A;  2O6S A;  1WM4 A;  5AWA A;  2P1P B;  3C6P B;  4R6F A;  5FTT B;  4Z8G A;  3UN9 A;  4BV4 R;  3EFO B;  1M2V A;  4M7E C;  5GMH A;  3WPG A;  1P8T A;  3GOZ A;  4LSX A;  4CC4 A;  4FMZ A;  1M4J A;  2XF1 A;  1O6T A;  4Z79 A;  3WPF A;  4PKG G;  1D0B A;  1OGQ A;  1PCX A;  4R08 A;  3A5O S;  3O6N A;  4G8A A;  3RFE A;  1D4X G;  1O6V A;  1U0N D;  3E3Z A;  4P8S A;  2Y5Q A;  3ZYI A;  3VQ2 A;  2OMZ A;  2Z64 A;  4I6J B;  1KOH A;  1NLV G;  1QPV A;  1DFJ I;  1PGV A;  1SVQ A;  3G39 A;  4AW4 A;  3DZE A;  1WNJ A;  3A5N S;  4PSJ A;  2Z81 A;  4MN8 B;  3A79 B;  3DAW B;  3W3G A;  4U06 A;  1FT8 A;  2L72 A;  5GMG A;  2V70 A;  2KVK A;  2WQV A;  1AHQ A;  2O6Q A;  3OJA B;  2NUP A;  5AWB A;  3M19 A;  4MQW X;  2V9S A;  5AZ5 A;  4FDW A;  3O53 A;  3EG9 B;  5HVK D;  3EG9 A;  4XSQ A;  1D0N A;  1IO0 A;  5FAE A;  1T2L A;  3EH2 A;  4Z64 C;  4PEQ B;  4QC0 A;  5KYW B;  5KYX B;  3OGK B;  5KYY A;  5LFN A;  4KXF B;  5KYW A;  5KYX A;  2O6R A;  4YEB B;  2Z63 A;  1WFS A;  4R07 A;  1T3X A;  2LLF A;  3C6N B;  2A0Z A;  4Q3G A;  2VIK A;  3P72 A;  4CNM A;  3EGD B;  1OZN A;  2D8B A;  3EGD A;  3M18 A;  4ECO A;  2P1O B;  4GLP A;  2AST B;  4V2C A;  4M7E A;  4BSU A;  1Q8X A;  1O6S A;  4H09 A;  1KOO A;  4R6J A;  2VAC A;  3E4G A;  2MP4 A;  4PKI G;  5CMP A;  1TVJ A;  2JE0 A;  1FO1 A;  2P1M B;  4KEE A;  2XOT A;  3JB9 j;  1EQY S;  1YVN G;  5GS0 A;  2IFG A;  4KEF A;  1DS9 A;  4LSA A;  4PQ8 A;  4PER A;  1H1V G;  3ZYO A;  4U08 A;  1MDU A;  3CIG A;  5DD2 A;  4XOS A;  4P91 A;  4HQ1 A;  1VKK A;  4CP6 A;  5B0T A;  3EFO A;  1Q8G A;  3RW7 A;  3ZYJ A;  3BZ5 A;  5GQR K;  3RJ0 A;  1H6U A;  1SQ0 B;  1OTM A;  4CBW G;  2XWT C;  3EGX B;  4GT6 A;  1A4Y A;  2FF3 A;  3ULV A;  3EGX A;  3ZYN A;  1K5G C;  4R5C A;  1M10 B;  2I2Q A;  2WQU A;  1XCD A;  4L3A A;  1UDM A;  1F7S A;  4NKG A;  4BSR A;  3E2J A;  1JL5 A;  3RGZ A;  1P8Z G;  1OTO A;  5GS2 B;  4C2A B;  1P9A G;  2OMT A;  4LXR A;  3ULA A;  3REZ A;  5GMF A;  1KCQ A;  5D3I A;  5IJD A;  2OMW A;  3CVR A;  3OGL B;  2OMX A;  1W8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...