4PKIG

Complex of atp-actin with the c-terminal actin-binding domain of tropomodulin
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
306
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFGYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein/actin-binding protein
molecule keywords Actin, alpha skeletal muscle
publication title Actin cytoskeleton. Mechanism of actin filament pointed-end capping by tropomodulin.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 306
sequence length 324
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4pkiG01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4pkiG02
5KYUA 4G8AA 3M19A 4LI2A 4U09A 5GS0A 5KYNA 2OMZA 3EFOB 3VQ1A 2CA6A 4PSJA 4FS7A 3OGKB 1XWDC 3CIPG 3FFNA 4U06A 1CFYA 5KYWB 3C6NB 5FAFA 3G04C 1D0BA 3E4GA 2Z81A 1MDUA 4R6FA 3W3LA 4LSAA 4R6AA 2V9SA 3RFEA 1C0FS 1NMDG 4XGOA 2LXXA 3A5MS 5IYXC 3EH1A 4KT1A 4PQ8A 4Y61B 3EGXA 4R6JA 4PERA 4GLPA 4AY9X 4XOSA 1PD0A 1OZNA 2R9UA 5IJCA 3RIZA 2LJ8A 4J4LA 3W3MA 4WYKA 3ZYNA 1M2OA 5HZLB 2Z62A 3CJCG 3REZA 3EGXB 3DAWB 4WP6A 4LXSA 3SB4A 4QC0A 3FG7A 1M4JA 1FS2A 2BEXA 3UL9A 4CP6A 3GOZA 5LFNA 3WN4A 4MQWX 3CIYA 1CNUA 1X67A 4KEFA 5CMNA 3RJ0A 5IJBA 1QPVA 4XSQA 2FF3A 1SVQA 1RGIG 2FH4A 3ZYIA 4LXRA 4OQTA 4Q62A 3ULVA 4R08A 4Z61C 2IFGA 4R07A 3WPCA 3M18A 5HDHA 3OGLB 2Z82A 3E2JA 2WQVA 4FD0A 3A79B 2OMUA 1D0NA 4B8CD 1O6SA 2Z64A 1DEJS 2BNHA 4ARRA 5FAEA 4EZGA 5AWCA 4Z79A 4BV4R 4ARNA 5GS2B 3TSRE 3ZYOA 1F7SA 2KVKA 3L50A 5B0TA 2V70A 5KYXA 2L72A 3WPDA 3RFJA 4V2EA 4QXEA 1P9AG 3UL7A 3C6OB 4K17A 1AK7A 1KCQA 2RA8A 3WPFA 1H6UA 1W8AA 1NM1G 4KNGA 4H09A 1AK6A 1GWBA 4C2AB 3G3BA 3RFSA 4KEEA 5KYUB 3ULAA 4U08A 3ZYJA 2WFHA 1U0ND 1XCDA 2ELLA 1T3XA 4Q3IA 2Z7XA 4M7EA 1WM4A 4R0AA 4P91A 2JE1A 5IJDA 3KJ4A 3CIGA 2NUPA 1G9UA 1QYYA 4BSSA 4JD2H 3OGMB 4MN8B 3TU5B 4J0MA 4LI1A 1JHWA 1SVYA 2Z65A 1P8ZG 1O6VA 2OMWA 4CC4A 4RWTC 4CNMA 1WWLA 1M2VA 1Q8GA 1T3YA 1M9SA 3P72A 4BSRA 2VILA 2OMTA 1PD1A 3E3ZA 1T2LA 2P1NB 4CBUG 3WPEA 1Z7XW 3A5NS 3EGDA 2XF1A 4GT6A 2P1QB 1EQYS 2ID5A 4YEBB 1FT8A 5KYYA 4CILA 2XWTC 3JB9j 4KEDA 3O53A 3WPIA 3A5OS 3W3KA 1TMWA 2FH3A 3FG6A 5GMFA 4R09A 1T44G 2O6QA 3RGZA 2O6RA 1YVNG 5FTTB 4QBZA 4L3FA 1PGVA 1M9LA 4C2BB 1PCXA 4NKGA 1WFSA 2UZYA 1ZIWA 5HVKB 3W3JA 5GQRK 4P8SA 2XOTA 4M7EC 3RW7A 3DZEA 2JE0A 5D3IA 1LTXA 3RGXA 2Z63A 4IM6A 3EG9A 3G06A 2VIKA 2OMVA 4BEX1 1IO0A 4KXFB 5L6WC 3UN9A 4RCWA 4CC4C 2FH1A 1DS9A 1C0GS 2NUTA 4V2CA 4CBWG 4UFRA 1Q8XA 3VQ2A 2HD7A 5AWBA 2Y5QA 1H6TA 3PMHG 2FF6G 3UL8A 4BSUA 2OMYA 4R6GA 1VKKA 1NPHA 1NLVG 1WNJA 1VFQA 5KYXB 4I6JB 1DFJI 2FH2A 1DCEA 1JL5A 1HQZ1 3EH2A 3EFOA 5DD2A 1H1VG 4Z64C 2Q4GW 2P1PB 5KYWA 1K5GC 3ULUA 3O6NA 4LSXA 4ECNA 4Q3GA 2FGHA 1A9NA 4LIZA 4CNCA 2Z66A 4R58A 2Z7XB 1D4XG 2A0ZA 4U7LA 4V2DA 3WPHA 5GMHA 3G3AA 1AHQA 2NUPB 2QTVA 4NKHA 4Z94G 1P8VA 1FQVA 1M2VB 3CVRA 1KOOA 4ECOA 1O6TA 2P1OB 1XKUA 5HVKD 1OGQA 1OTNA 4HQ1A 2JQDA 3E6JA 2WQXA 2W0IA 5AZ5A 4FMZA 4FHOA 1SQ0B 1ESVS 2D8BA 3EGDB 4AW4A 2XFAA 3FFKA 2V9TB 3WPGA 2MOTA 3W3NA 5KYYB 4LSCA 1OOKG 4FCGA 1V6FA 3CJBG 1OTMA 2ASSB 2RR6A 5B4PA 3RW6A 1J72A 4R5DA 1UDMA 2WQWA 2O6SA 1P8XA 1A4YA 5GMGA 3A5LS 2WQUA 5A5CA 1FO1A 4S10C 2MV2A 2UZXA 1K5DC 1COFA 1YAGG 4LSXC 5A1MA 5AWAA 3Q2BA 5B0NA 5AWDA 1SVRA 3OJAA 4TZHA 2OMXA 4RCAB 4PKHB 4Z8GA 3CI5G 3EG9B 4CBXG 1XECA 2FT3A 1M0ZA 1OTOA 1M10B 2VACA 3OJAB 2I2QA 4L3AA 5IVUA 3WPBA 2ASTB 3FXIA 3G39A 4PKIG 2MP4A 2NUTB 4PEQB 4R5CA 1KOHA 3BZ5A 3C6PB 4FDWA 4PKGG 3W3GA 1XEUA 1TVJA 5CMPA 2LLFA 1YRGA 2P1MB 1P8TA
chains in the Genus database with same CATH superfamily
5KYUA 4G8AA 3M19A 4LI2A 4U09A 5GS0A 5KYNA 2OMZA 3EFOB 3VQ1A 2CA6A 4PSJA 4FS7A 3OGKB 1XWDC 3CIPG 3FFNA 4U06A 1CFYA 5KYWB 3C6NB 5FAFA 3G04C 1D0BA 3E4GA 2Z81A 1MDUA 4R6FA 3W3LA 4LSAA 4R6AA 2V9SA 3RFEA 1C0FS 1NMDG 4XGOA 2LXXA 3A5MS 5IYXC 3EH1A 4KT1A 4PQ8A 4Y61B 3EGXA 4R6JA 4PERA 4GLPA 4AY9X 4XOSA 1PD0A 1OZNA 2R9UA 5IJCA 3RIZA 2LJ8A 4J4LA 3W3MA 4WYKA 3ZYNA 1M2OA 5HZLB 2Z62A 3CJCG 3REZA 3EGXB 3DAWB 4WP6A 4LXSA 4NZTM 3SB4A 4QC0A 3FG7A 1M4JA 1FS2A 2BEXA 3UL9A 4CP6A 3GOZA 5LFNA 3WN4A 4MQWX 3CIYA 1CNUA 1X67A 4KEFA 5CMNA 3RJ0A 5IJBA 1QPVA 4XSQA 2FF3A 1SVQA 1RGIG 2FH4A 3ZYIA 4LXRA 4OQTA 4Q62A 3ULVA 4R08A 4Z61C 2IFGA 4R07A 3WPCA 3M18A 5HDHA 3OGLB 2Z82A 3E2JA 2WQVA 4FD0A 3A79B 2OMUA 1D0NA 4B8CD 1O6SA 2Z64A 1DEJS 2BNHA 4ARRA 5FAEA 4EZGA 5AWCA 4Z79A 4BV4R 4ARNA 5GS2B 3TSRE 3ZYOA 1F7SA 2KVKA 3L50A 5B0TA 2V70A 5KYXA 2L72A 3WPDA 3RFJA 4V2EA 4QXEA 1P9AG 3UL7A 3C6OB 4K17A 1AK7A 1KCQA 2RA8A 3WPFA 1H6UA 1W8AA 1NM1G 4KNGA 4H09A 1AK6A 1GWBA 4C2AB 3G3BA 3RFSA 4KEEA 5KYUB 3ULAA 4U08A 3ZYJA 2WFHA 1U0ND 1XCDA 2ELLA 1T3XA 4Q3IA 2Z7XA 4M7EA 1WM4A 4R0AA 4P91A 2JE1A 5IJDA 3KJ4A 3CIGA 2NUPA 1G9UA 1QYYA 4BSSA 4JD2H 3OGMB 4MN8B 3TU5B 4J0MA 4LI1A 1JHWA 1SVYA 2Z65A 1P8ZG 1O6VA 2OMWA 4CC4A 4RWTC 4CNMA 1WWLA 1M2VA 1Q8GA 1T3YA 1M9SA 3P72A 4BSRA 2VILA 2OMTA 1PD1A 3E3ZA 1T2LA 2P1NB 4CBUG 3WPEA 1Z7XW 3A5NS 3EGDA 2XF1A 4GT6A 2P1QB 1EQYS 2ID5A 4YEBB 1FT8A 5KYYA 4CILA 2XWTC 3JB9j 4KEDA 3O53A 3WPIA 3A5OS 3W3KA 1TMWA 2FH3A 3FG6A 5GMFA 4R09A 1T44G 2O6QA 3RGZA 2O6RA 1YVNG 5FTTB 4QBZA 4L3FA 1PGVA 1M9LA 4C2BB 1PCXA 4NKGA 1WFSA 2UZYA 1ZIWA 5HVKB 3W3JA 5GQRK 4P8SA 2XOTA 4M7EC 3RW7A 3DZEA 2JE0A 5D3IA 1LTXA 3RGXA 2Z63A 4IM6A 3EG9A 3G06A 2VIKA 2OMVA 4BEX1 1IO0A 4KXFB 5L6WC 3UN9A 4RCWA 4CC4C 2FH1A 1DS9A 1C0GS 2NUTA 4V2CA 4CBWG 4UFRA 1Q8XA 3VQ2A 2HD7A 5AWBA 2Y5QA 1H6TA 3PMHG 2FF6G 3UL8A 4BSUA 2OMYA 4R6GA 1VKKA 1NPHA 1NLVG 1WNJA 1VFQA 5KYXB 4I6JB 1DFJI 2FH2A 1DCEA 1JL5A 1HQZ1 3EH2A 3EFOA 5DD2A 1H1VG 4Z64C 2Q4GW 2P1PB 5KYWA 1K5GC 3ULUA 3O6NA 4LSXA 4ECNA 4Q3GA 2FGHA 1A9NA 4LIZA 4CNCA 2Z66A 4R58A 2Z7XB 1D4XG 2A0ZA 4U7LA 4V2DA 3WPHA 5GMHA 3G3AA 1AHQA 2NUPB 2QTVA 4NKHA 4Z94G 1P8VA 1FQVA 1M2VB 3CVRA 1KOOA 4ECOA 1O6TA 2P1OB 1XKUA 5HVKD 1OGQA 1OTNA 4HQ1A 2JQDA 3E6JA 2WQXA 2W0IA 5AZ5A 4FMZA 4FHOA 1SQ0B 1ESVS 2D8BA 3EGDB 4AW4A 2XFAA 3FFKA 2V9TB 3WPGA 2MOTA 3W3NA 5KYYB 4LSCA 1OOKG 4FCGA 1V6FA 3CJBG 1OTMA 2ASSB 2RR6A 5B4PA 3RW6A 1J72A 4R5DA 3DA7A 1UDMA 2WQWA 2O6SA 1P8XA 1A4YA 5GMGA 3A5LS 2WQUA 5A5CA 1FO1A 4S10C 2MV2A 2UZXA 1K5DC 1COFA 1YAGG 4NZRM 4LSXC 5A1MA 5AWAA 3Q2BA 5B0NA 5AWDA 1SVRA 3OJAA 4TZHA 2OMXA 4RCAB 4PKHB 4Z8GA 3CI5G 3EG9B 4CBXG 1XECA 2FT3A 1M0ZA 1OTOA 1M10B 2VACA 3OJAB 2I2QA 4L3AA 5IVUA 3WPBA 2ASTB 3FXIA 3G39A 4PKIG 2MP4A 2NUTB 4PEQB 4R5CA 1KOHA 3BZ5A 3C6PB 4FDWA 4PKGG 3W3GA 1XEUA 1TVJA 5CMPA 2LLFA 1YRGA 2P1MB 1P8TA
chains in the Genus database with same CATH topology
5KYUA 4G8AA 3M19A 4LI2A 4U09A 5GS0A 5KYNA 2OMZA 3EFOB 3VQ1A 2CA6A 4PSJA 4FS7A 3OGKB 1XWDC 3CIPG 3FFNA 4U06A 1CFYA 5KYWB 3C6NB 5FAFA 3G04C 1D0BA 3E4GA 2Z81A 1MDUA 4R6FA 3W3LA 4LSAA 4R6AA 2V9SA 3RFEA 1C0FS 1NMDG 4XGOA 2LXXA 3A5MS 5IYXC 3EH1A 4KT1A 4PQ8A 4Y61B 3EGXA 4R6JA 4PERA 4GLPA 4AY9X 4XOSA 1PD0A 1OZNA 2R9UA 5IJCA 3RIZA 2LJ8A 4J4LA 3W3MA 4WYKA 3ZYNA 1M2OA 5HZLB 2Z62A 3CJCG 3REZA 3EGXB 3DAWB 4WP6A 4LXSA 3SB4A 4QC0A 3FG7A 1M4JA 1FS2A 2BEXA 3UL9A 4CP6A 3GOZA 5LFNA 3WN4A 4MQWX 3CIYA 1CNUA 1X67A 4KEFA 5CMNA 3RJ0A 5IJBA 1QPVA 4XSQA 2FF3A 1SVQA 1RGIG 2FH4A 3ZYIA 4LXRA 4OQTA 4Q62A 3ULVA 4R08A 4Z61C 2IFGA 4R07A 3WPCA 3M18A 5HDHA 3OGLB 2Z82A 3E2JA 2WQVA 4FD0A 3A79B 2OMUA 1D0NA 4B8CD 1O6SA 2Z64A 1DEJS 2BNHA 4ARRA 5FAEA 4EZGA 5AWCA 4Z79A 4BV4R 4ARNA 5GS2B 3TSRE 3ZYOA 1F7SA 2KVKA 3L50A 5B0TA 2V70A 5KYXA 2L72A 3WPDA 3RFJA 4V2EA 4QXEA 1P9AG 3UL7A 3C6OB 4K17A 1AK7A 1KCQA 2RA8A 3WPFA 1H6UA 1W8AA 1NM1G 4KNGA 4H09A 1AK6A 1GWBA 4C2AB 3G3BA 3RFSA 4KEEA 5KYUB 3ULAA 4U08A 3ZYJA 2WFHA 1U0ND 1XCDA 2ELLA 1T3XA 4Q3IA 2Z7XA 4M7EA 1WM4A 4R0AA 4P91A 2JE1A 5IJDA 3KJ4A 3CIGA 2NUPA 1G9UA 1QYYA 4BSSA 4JD2H 3OGMB 4MN8B 3TU5B 4J0MA 4LI1A 1JHWA 1SVYA 2Z65A 1P8ZG 1O6VA 2OMWA 4CC4A 4RWTC 4CNMA 1WWLA 1M2VA 1Q8GA 1T3YA 1M9SA 3P72A 4BSRA 2VILA 2OMTA 1PD1A 3E3ZA 1T2LA 2P1NB 4CBUG 3WPEA 1Z7XW 3A5NS 3EGDA 2XF1A 4GT6A 2P1QB 1EQYS 2ID5A 4YEBB 1FT8A 5KYYA 4CILA 2XWTC 3JB9j 4KEDA 3O53A 3WPIA 3A5OS 3W3KA 1TMWA 2FH3A 3FG6A 5GMFA 4R09A 1T44G 2O6QA 3RGZA 2O6RA 1YVNG 5FTTB 4QBZA 4L3FA 1PGVA 1M9LA 4C2BB 1PCXA 4NKGA 1WFSA 2UZYA 1ZIWA 5HVKB 3W3JA 5GQRK 4P8SA 2XOTA 4M7EC 3RW7A 3DZEA 2JE0A 5D3IA 1LTXA 3RGXA 2Z63A 4IM6A 3EG9A 3G06A 2VIKA 2OMVA 4BEX1 1IO0A 4KXFB 5L6WC 3UN9A 4RCWA 4CC4C 2FH1A 1DS9A 1C0GS 2NUTA 4V2CA 4CBWG 4UFRA 1Q8XA 3VQ2A 2HD7A 5AWBA 2Y5QA 1H6TA 3PMHG 2FF6G 3UL8A 4BSUA 2OMYA 4R6GA 1VKKA 1NPHA 1NLVG 1WNJA 1VFQA 5KYXB 4I6JB 1DFJI 2FH2A 1DCEA 1JL5A 1HQZ1 3EH2A 3EFOA 5DD2A 1H1VG 4Z64C 2Q4GW 2P1PB 5KYWA 1K5GC 3ULUA 3O6NA 4LSXA 4ECNA 4Q3GA 2FGHA 1A9NA 4LIZA 4CNCA 2Z66A 4R58A 2Z7XB 1D4XG 2A0ZA 4U7LA 4V2DA 3WPHA 5GMHA 3G3AA 1AHQA 2NUPB 2QTVA 4NKHA 4Z94G 1P8VA 1FQVA 1M2VB 3CVRA 1KOOA 4ECOA 1O6TA 2P1OB 1XKUA 5HVKD 1OGQA 1OTNA 4HQ1A 2JQDA 3E6JA 2WQXA 2W0IA 5AZ5A 4FMZA 4FHOA 1SQ0B 1ESVS 2D8BA 3EGDB 4AW4A 2XFAA 3FFKA 2V9TB 3WPGA 2MOTA 3W3NA 5KYYB 4LSCA 1OOKG 4FCGA 1V6FA 3CJBG 1OTMA 2ASSB 2RR6A 5B4PA 3RW6A 1J72A 4R5DA 3DA7A 1UDMA 2WQWA 2O6SA 1P8XA 1A4YA 5GMGA 3A5LS 2WQUA 5A5CA 1FO1A 4S10C 2MV2A 2UZXA 1K5DC 1COFA 1YAGG 4LSXC 5A1MA 5AWAA 3Q2BA 5B0NA 5AWDA 1SVRA 3OJAA 4TZHA 2OMXA 4RCAB 4PKHB 4Z8GA 3CI5G 3EG9B 4CBXG 1XECA 2FT3A 1M0ZA 1OTOA 1M10B 2VACA 3OJAB 2I2QA 4L3AA 5IVUA 3WPBA 2ASTB 3FXIA 3G39A 4PKIG 2MP4A 2NUTB 4PEQB 4R5CA 1KOHA 3BZ5A 3C6PB 4FDWA 4PKGG 3W3GA 1XEUA 1TVJA 5CMPA 2LLFA 1YRGA 2P1MB 1P8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KYU A;  4G8A A;  3M19 A;  4LI2 A;  4U09 A;  5GS0 A;  5KYN A;  2OMZ A;  3EFO B;  3VQ1 A;  2CA6 A;  4PSJ A;  4FS7 A;  3OGK B;  1XWD C;  3CIP G;  3FFN A;  4U06 A;  1CFY A;  5KYW B;  3C6N B;  5FAF A;  3G04 C;  1D0B A;  3E4G A;  2Z81 A;  1MDU A;  4R6F A;  3W3L A;  4LSA A;  4R6A A;  2V9S A;  3RFE A;  1C0F S;  1NMD G;  4XGO A;  2LXX A;  3A5M S;  5IYX C;  3EH1 A;  4KT1 A;  4PQ8 A;  4Y61 B;  3EGX A;  4R6J A;  4PER A;  4GLP A;  4AY9 X;  4XOS A;  1PD0 A;  1OZN A;  2R9U A;  5IJC A;  3RIZ A;  2LJ8 A;  4J4L A;  3W3M A;  4WYK A;  3ZYN A;  1M2O A;  5HZL B;  2Z62 A;  3CJC G;  3REZ A;  3EGX B;  3DAW B;  4WP6 A;  4LXS A;  3SB4 A;  4QC0 A;  3FG7 A;  1M4J A;  1FS2 A;  2BEX A;  3UL9 A;  4CP6 A;  3GOZ A;  5LFN A;  3WN4 A;  4MQW X;  3CIY A;  1CNU A;  1X67 A;  4KEF A;  5CMN A;  3RJ0 A;  5IJB A;  1QPV A;  4XSQ A;  2FF3 A;  1SVQ A;  1RGI G;  2FH4 A;  3ZYI A;  4LXR A;  4OQT A;  4Q62 A;  3ULV A;  4R08 A;  4Z61 C;  2IFG A;  4R07 A;  3WPC A;  3M18 A;  5HDH A;  3OGL B;  2Z82 A;  3E2J A;  2WQV A;  4FD0 A;  3A79 B;  2OMU A;  1D0N A;  4B8C D;  1O6S A;  2Z64 A;  1DEJ S;  2BNH A;  4ARR A;  5FAE A;  4EZG A;  5AWC A;  4Z79 A;  4BV4 R;  4ARN A;  5GS2 B;  3TSR E;  3ZYO A;  1F7S A;  2KVK A;  3L50 A;  5B0T A;  2V70 A;  5KYX A;  2L72 A;  3WPD A;  3RFJ A;  4V2E A;  4QXE A;  1P9A G;  3UL7 A;  3C6O B;  4K17 A;  1AK7 A;  1KCQ A;  2RA8 A;  3WPF A;  1H6U A;  1W8A A;  1NM1 G;  4KNG A;  4H09 A;  1AK6 A;  1GWB A;  4C2A B;  3G3B A;  3RFS A;  4KEE A;  5KYU B;  3ULA A;  4U08 A;  3ZYJ A;  2WFH A;  1U0N D;  1XCD A;  2ELL A;  1T3X A;  4Q3I A;  2Z7X A;  4M7E A;  1WM4 A;  4R0A A;  4P91 A;  2JE1 A;  5IJD A;  3KJ4 A;  3CIG A;  2NUP A;  1G9U A;  1QYY A;  4BSS A;  4JD2 H;  3OGM B;  4MN8 B;  3TU5 B;  4J0M A;  4LI1 A;  1JHW A;  1SVY A;  2Z65 A;  1P8Z G;  1O6V A;  2OMW A;  4CC4 A;  4RWT C;  4CNM A;  1WWL A;  1M2V A;  1Q8G A;  1T3Y A;  1M9S A;  3P72 A;  4BSR A;  2VIL A;  2OMT A;  1PD1 A;  3E3Z A;  1T2L A;  2P1N B;  4CBU G;  3WPE A;  1Z7X W;  3A5N S;  3EGD A;  2XF1 A;  4GT6 A;  2P1Q B;  1EQY S;  2ID5 A;  4YEB B;  1FT8 A;  5KYY A;  4CIL A;  2XWT C;  3JB9 j;  4KED A;  3O53 A;  3WPI A;  3A5O S;  3W3K A;  1TMW A;  2FH3 A;  3FG6 A;  5GMF A;  4R09 A;  1T44 G;  2O6Q A;  3RGZ A;  2O6R A;  1YVN G;  5FTT B;  4QBZ A;  4L3F A;  1PGV A;  1M9L A;  4C2B B;  1PCX A;  4NKG A;  1WFS A;  2UZY A;  1ZIW A;  5HVK B;  3W3J A;  5GQR K;  4P8S A;  2XOT A;  4M7E C;  3RW7 A;  3DZE A;  2JE0 A;  5D3I A;  1LTX A;  3RGX A;  2Z63 A;  4IM6 A;  3EG9 A;  3G06 A;  2VIK A;  2OMV A;  4BEX 1;  1IO0 A;  4KXF B;  5L6W C;  3UN9 A;  4RCW A;  4CC4 C;  2FH1 A;  1DS9 A;  1C0G S;  2NUT A;  4V2C A;  4CBW G;  4UFR A;  1Q8X A;  3VQ2 A;  2HD7 A;  5AWB A;  2Y5Q A;  1H6T A;  3PMH G;  2FF6 G;  3UL8 A;  4BSU A;  2OMY A;  4R6G A;  1VKK A;  1NPH A;  1NLV G;  1WNJ A;  1VFQ A;  5KYX B;  4I6J B;  1DFJ I;  2FH2 A;  1DCE A;  1JL5 A;  1HQZ 1;  3EH2 A;  3EFO A;  5DD2 A;  1H1V G;  4Z64 C;  2Q4G W;  2P1P B;  5KYW A;  1K5G C;  3ULU A;  3O6N A;  4LSX A;  4ECN A;  4Q3G A;  2FGH A;  1A9N A;  4LIZ A;  4CNC A;  2Z66 A;  4R58 A;  2Z7X B;  1D4X G;  2A0Z A;  4U7L A;  4V2D A;  3WPH A;  5GMH A;  3G3A A;  1AHQ A;  2NUP B;  2QTV A;  4NKH A;  4Z94 G;  1P8V A;  1FQV A;  1M2V B;  3CVR A;  1KOO A;  4ECO A;  1O6T A;  2P1O B;  1XKU A;  5HVK D;  1OGQ A;  1OTN A;  4HQ1 A;  2JQD A;  3E6J A;  2WQX A;  2W0I A;  5AZ5 A;  4FMZ A;  4FHO A;  1SQ0 B;  1ESV S;  2D8B A;  3EGD B;  4AW4 A;  2XFA A;  3FFK A;  2V9T B;  3WPG A;  2MOT A;  3W3N A;  5KYY B;  4LSC A;  1OOK G;  4FCG A;  1V6F A;  3CJB G;  1OTM A;  2ASS B;  2RR6 A;  5B4P A;  3RW6 A;  1J72 A;  4R5D A;  1UDM A;  2WQW A;  2O6S A;  1P8X A;  1A4Y A;  5GMG A;  3A5L S;  2WQU A;  5A5C A;  1FO1 A;  4S10 C;  2MV2 A;  2UZX A;  1K5D C;  1COF A;  1YAG G;  4LSX C;  5A1M A;  5AWA A;  3Q2B A;  5B0N A;  5AWD A;  1SVR A;  3OJA A;  4TZH A;  2OMX A;  4RCA B;  4PKH B;  4Z8G A;  3CI5 G;  3EG9 B;  4CBX G;  1XEC A;  2FT3 A;  1M0Z A;  1OTO A;  1M10 B;  2VAC A;  3OJA B;  2I2Q A;  4L3A A;  5IVU A;  3WPB A;  2AST B;  3FXI A;  3G39 A;  4PKI G;  2MP4 A;  2NUT B;  4PEQ B;  4R5C A;  1KOH A;  3BZ5 A;  3C6P B;  4FDW A;  4PKG G;  3W3G A;  1XEU A;  1TVJ A;  5CMP A;  2LLF A;  1YRG A;  2P1M B;  1P8T A; 
#chains in the Genus database with same CATH topology
 5KYU A;  4G8A A;  3M19 A;  4LI2 A;  4U09 A;  5GS0 A;  5KYN A;  2OMZ A;  3EFO B;  3VQ1 A;  2CA6 A;  4PSJ A;  4FS7 A;  3OGK B;  1XWD C;  3CIP G;  3FFN A;  4U06 A;  1CFY A;  5KYW B;  3C6N B;  5FAF A;  3G04 C;  1D0B A;  3E4G A;  2Z81 A;  1MDU A;  4R6F A;  3W3L A;  4LSA A;  4R6A A;  2V9S A;  3RFE A;  1C0F S;  1NMD G;  4XGO A;  2LXX A;  3A5M S;  5IYX C;  3EH1 A;  4KT1 A;  4PQ8 A;  4Y61 B;  3EGX A;  4R6J A;  4PER A;  4GLP A;  4AY9 X;  4XOS A;  1PD0 A;  1OZN A;  2R9U A;  5IJC A;  3RIZ A;  2LJ8 A;  4J4L A;  3W3M A;  4WYK A;  3ZYN A;  1M2O A;  5HZL B;  2Z62 A;  3CJC G;  3REZ A;  3EGX B;  3DAW B;  4WP6 A;  4LXS A;  4NZT M;  3SB4 A;  4QC0 A;  3FG7 A;  1M4J A;  1FS2 A;  2BEX A;  3UL9 A;  4CP6 A;  3GOZ A;  5LFN A;  3WN4 A;  4MQW X;  3CIY A;  1CNU A;  1X67 A;  4KEF A;  5CMN A;  3RJ0 A;  5IJB A;  1QPV A;  4XSQ A;  2FF3 A;  1SVQ A;  1RGI G;  2FH4 A;  3ZYI A;  4LXR A;  4OQT A;  4Q62 A;  3ULV A;  4R08 A;  4Z61 C;  2IFG A;  4R07 A;  3WPC A;  3M18 A;  5HDH A;  3OGL B;  2Z82 A;  3E2J A;  2WQV A;  4FD0 A;  3A79 B;  2OMU A;  1D0N A;  4B8C D;  1O6S A;  2Z64 A;  1DEJ S;  2BNH A;  4ARR A;  5FAE A;  4EZG A;  5AWC A;  4Z79 A;  4BV4 R;  4ARN A;  5GS2 B;  3TSR E;  3ZYO A;  1F7S A;  2KVK A;  3L50 A;  5B0T A;  2V70 A;  5KYX A;  2L72 A;  3WPD A;  3RFJ A;  4V2E A;  4QXE A;  1P9A G;  3UL7 A;  3C6O B;  4K17 A;  1AK7 A;  1KCQ A;  2RA8 A;  3WPF A;  1H6U A;  1W8A A;  1NM1 G;  4KNG A;  4H09 A;  1AK6 A;  1GWB A;  4C2A B;  3G3B A;  3RFS A;  4KEE A;  5KYU B;  3ULA A;  4U08 A;  3ZYJ A;  2WFH A;  1U0N D;  1XCD A;  2ELL A;  1T3X A;  4Q3I A;  2Z7X A;  4M7E A;  1WM4 A;  4R0A A;  4P91 A;  2JE1 A;  5IJD A;  3KJ4 A;  3CIG A;  2NUP A;  1G9U A;  1QYY A;  4BSS A;  4JD2 H;  3OGM B;  4MN8 B;  3TU5 B;  4J0M A;  4LI1 A;  1JHW A;  1SVY A;  2Z65 A;  1P8Z G;  1O6V A;  2OMW A;  4CC4 A;  4RWT C;  4CNM A;  1WWL A;  1M2V A;  1Q8G A;  1T3Y A;  1M9S A;  3P72 A;  4BSR A;  2VIL A;  2OMT A;  1PD1 A;  3E3Z A;  1T2L A;  2P1N B;  4CBU G;  3WPE A;  1Z7X W;  3A5N S;  3EGD A;  2XF1 A;  4GT6 A;  2P1Q B;  1EQY S;  2ID5 A;  4YEB B;  1FT8 A;  5KYY A;  4CIL A;  2XWT C;  3JB9 j;  4KED A;  3O53 A;  3WPI A;  3A5O S;  3W3K A;  1TMW A;  2FH3 A;  3FG6 A;  5GMF A;  4R09 A;  1T44 G;  2O6Q A;  3RGZ A;  2O6R A;  1YVN G;  5FTT B;  4QBZ A;  4L3F A;  1PGV A;  1M9L A;  4C2B B;  1PCX A;  4NKG A;  1WFS A;  2UZY A;  1ZIW A;  5HVK B;  3W3J A;  5GQR K;  4P8S A;  2XOT A;  4M7E C;  3RW7 A;  3DZE A;  2JE0 A;  5D3I A;  1LTX A;  3RGX A;  2Z63 A;  4IM6 A;  3EG9 A;  3G06 A;  2VIK A;  2OMV A;  4BEX 1;  1IO0 A;  4KXF B;  5L6W C;  3UN9 A;  4RCW A;  4CC4 C;  2FH1 A;  1DS9 A;  1C0G S;  2NUT A;  4V2C A;  4CBW G;  4UFR A;  1Q8X A;  3VQ2 A;  2HD7 A;  5AWB A;  2Y5Q A;  1H6T A;  3PMH G;  2FF6 G;  3UL8 A;  4BSU A;  2OMY A;  4R6G A;  1VKK A;  1NPH A;  1NLV G;  1WNJ A;  1VFQ A;  5KYX B;  4I6J B;  1DFJ I;  2FH2 A;  1DCE A;  1JL5 A;  1HQZ 1;  3EH2 A;  3EFO A;  5DD2 A;  1H1V G;  4Z64 C;  2Q4G W;  2P1P B;  5KYW A;  1K5G C;  3ULU A;  3O6N A;  4LSX A;  4ECN A;  4Q3G A;  2FGH A;  1A9N A;  4LIZ A;  4CNC A;  2Z66 A;  4R58 A;  2Z7X B;  1D4X G;  2A0Z A;  4U7L A;  4V2D A;  3WPH A;  5GMH A;  3G3A A;  1AHQ A;  2NUP B;  2QTV A;  4NKH A;  4Z94 G;  1P8V A;  1FQV A;  1M2V B;  3CVR A;  1KOO A;  4ECO A;  1O6T A;  2P1O B;  1XKU A;  5HVK D;  1OGQ A;  1OTN A;  4HQ1 A;  2JQD A;  3E6J A;  2WQX A;  2W0I A;  5AZ5 A;  4FMZ A;  4FHO A;  1SQ0 B;  1ESV S;  2D8B A;  3EGD B;  4AW4 A;  2XFA A;  3FFK A;  2V9T B;  3WPG A;  2MOT A;  3W3N A;  5KYY B;  4LSC A;  1OOK G;  4FCG A;  1V6F A;  3CJB G;  1OTM A;  2ASS B;  2RR6 A;  5B4P A;  3RW6 A;  1J72 A;  4R5D A;  3DA7 A;  1UDM A;  2WQW A;  2O6S A;  1P8X A;  1A4Y A;  5GMG A;  3A5L S;  2WQU A;  5A5C A;  1FO1 A;  4S10 C;  2MV2 A;  2UZX A;  1K5D C;  1COF A;  1YAG G;  4NZR M;  4LSX C;  5A1M A;  5AWA A;  3Q2B A;  5B0N A;  5AWD A;  1SVR A;  3OJA A;  4TZH A;  2OMX A;  4RCA B;  4PKH B;  4Z8G A;  3CI5 G;  3EG9 B;  4CBX G;  1XEC A;  2FT3 A;  1M0Z A;  1OTO A;  1M10 B;  2VAC A;  3OJA B;  2I2Q A;  4L3A A;  5IVU A;  3WPB A;  2AST B;  3FXI A;  3G39 A;  4PKI G;  2MP4 A;  2NUT B;  4PEQ B;  4R5C A;  1KOH A;  3BZ5 A;  3C6P B;  4FDW A;  4PKG G;  3W3G A;  1XEU A;  1TVJ A;  5CMP A;  2LLF A;  1YRG A;  2P1M B;  1P8T A; 
#chains in the Genus database with same CATH homology
 5KYU A;  4G8A A;  3M19 A;  4LI2 A;  4U09 A;  5GS0 A;  5KYN A;  2OMZ A;  3EFO B;  3VQ1 A;  2CA6 A;  4PSJ A;  4FS7 A;  3OGK B;  1XWD C;  3CIP G;  3FFN A;  4U06 A;  1CFY A;  5KYW B;  3C6N B;  5FAF A;  3G04 C;  1D0B A;  3E4G A;  2Z81 A;  1MDU A;  4R6F A;  3W3L A;  4LSA A;  4R6A A;  2V9S A;  3RFE A;  1C0F S;  1NMD G;  4XGO A;  2LXX A;  3A5M S;  5IYX C;  3EH1 A;  4KT1 A;  4PQ8 A;  4Y61 B;  3EGX A;  4R6J A;  4PER A;  4GLP A;  4AY9 X;  4XOS A;  1PD0 A;  1OZN A;  2R9U A;  5IJC A;  3RIZ A;  2LJ8 A;  4J4L A;  3W3M A;  4WYK A;  3ZYN A;  1M2O A;  5HZL B;  2Z62 A;  3CJC G;  3REZ A;  3EGX B;  3DAW B;  4WP6 A;  4LXS A;  3SB4 A;  4QC0 A;  3FG7 A;  1M4J A;  1FS2 A;  2BEX A;  3UL9 A;  4CP6 A;  3GOZ A;  5LFN A;  3WN4 A;  4MQW X;  3CIY A;  1CNU A;  1X67 A;  4KEF A;  5CMN A;  3RJ0 A;  5IJB A;  1QPV A;  4XSQ A;  2FF3 A;  1SVQ A;  1RGI G;  2FH4 A;  3ZYI A;  4LXR A;  4OQT A;  4Q62 A;  3ULV A;  4R08 A;  4Z61 C;  2IFG A;  4R07 A;  3WPC A;  3M18 A;  5HDH A;  3OGL B;  2Z82 A;  3E2J A;  2WQV A;  4FD0 A;  3A79 B;  2OMU A;  1D0N A;  4B8C D;  1O6S A;  2Z64 A;  1DEJ S;  2BNH A;  4ARR A;  5FAE A;  4EZG A;  5AWC A;  4Z79 A;  4BV4 R;  4ARN A;  5GS2 B;  3TSR E;  3ZYO A;  1F7S A;  2KVK A;  3L50 A;  5B0T A;  2V70 A;  5KYX A;  2L72 A;  3WPD A;  3RFJ A;  4V2E A;  4QXE A;  1P9A G;  3UL7 A;  3C6O B;  4K17 A;  1AK7 A;  1KCQ A;  2RA8 A;  3WPF A;  1H6U A;  1W8A A;  1NM1 G;  4KNG A;  4H09 A;  1AK6 A;  1GWB A;  4C2A B;  3G3B A;  3RFS A;  4KEE A;  5KYU B;  3ULA A;  4U08 A;  3ZYJ A;  2WFH A;  1U0N D;  1XCD A;  2ELL A;  1T3X A;  4Q3I A;  2Z7X A;  4M7E A;  1WM4 A;  4R0A A;  4P91 A;  2JE1 A;  5IJD A;  3KJ4 A;  3CIG A;  2NUP A;  1G9U A;  1QYY A;  4BSS A;  4JD2 H;  3OGM B;  4MN8 B;  3TU5 B;  4J0M A;  4LI1 A;  1JHW A;  1SVY A;  2Z65 A;  1P8Z G;  1O6V A;  2OMW A;  4CC4 A;  4RWT C;  4CNM A;  1WWL A;  1M2V A;  1Q8G A;  1T3Y A;  1M9S A;  3P72 A;  4BSR A;  2VIL A;  2OMT A;  1PD1 A;  3E3Z A;  1T2L A;  2P1N B;  4CBU G;  3WPE A;  1Z7X W;  3A5N S;  3EGD A;  2XF1 A;  4GT6 A;  2P1Q B;  1EQY S;  2ID5 A;  4YEB B;  1FT8 A;  5KYY A;  4CIL A;  2XWT C;  3JB9 j;  4KED A;  3O53 A;  3WPI A;  3A5O S;  3W3K A;  1TMW A;  2FH3 A;  3FG6 A;  5GMF A;  4R09 A;  1T44 G;  2O6Q A;  3RGZ A;  2O6R A;  1YVN G;  5FTT B;  4QBZ A;  4L3F A;  1PGV A;  1M9L A;  4C2B B;  1PCX A;  4NKG A;  1WFS A;  2UZY A;  1ZIW A;  5HVK B;  3W3J A;  5GQR K;  4P8S A;  2XOT A;  4M7E C;  3RW7 A;  3DZE A;  2JE0 A;  5D3I A;  1LTX A;  3RGX A;  2Z63 A;  4IM6 A;  3EG9 A;  3G06 A;  2VIK A;  2OMV A;  4BEX 1;  1IO0 A;  4KXF B;  5L6W C;  3UN9 A;  4RCW A;  4CC4 C;  2FH1 A;  1DS9 A;  1C0G S;  2NUT A;  4V2C A;  4CBW G;  4UFR A;  1Q8X A;  3VQ2 A;  2HD7 A;  5AWB A;  2Y5Q A;  1H6T A;  3PMH G;  2FF6 G;  3UL8 A;  4BSU A;  2OMY A;  4R6G A;  1VKK A;  1NPH A;  1NLV G;  1WNJ A;  1VFQ A;  5KYX B;  4I6J B;  1DFJ I;  2FH2 A;  1DCE A;  1JL5 A;  1HQZ 1;  3EH2 A;  3EFO A;  5DD2 A;  1H1V G;  4Z64 C;  2Q4G W;  2P1P B;  5KYW A;  1K5G C;  3ULU A;  3O6N A;  4LSX A;  4ECN A;  4Q3G A;  2FGH A;  1A9N A;  4LIZ A;  4CNC A;  2Z66 A;  4R58 A;  2Z7X B;  1D4X G;  2A0Z A;  4U7L A;  4V2D A;  3WPH A;  5GMH A;  3G3A A;  1AHQ A;  2NUP B;  2QTV A;  4NKH A;  4Z94 G;  1P8V A;  1FQV A;  1M2V B;  3CVR A;  1KOO A;  4ECO A;  1O6T A;  2P1O B;  1XKU A;  5HVK D;  1OGQ A;  1OTN A;  4HQ1 A;  2JQD A;  3E6J A;  2WQX A;  2W0I A;  5AZ5 A;  4FMZ A;  4FHO A;  1SQ0 B;  1ESV S;  2D8B A;  3EGD B;  4AW4 A;  2XFA A;  3FFK A;  2V9T B;  3WPG A;  2MOT A;  3W3N A;  5KYY B;  4LSC A;  1OOK G;  4FCG A;  1V6F A;  3CJB G;  1OTM A;  2ASS B;  2RR6 A;  5B4P A;  3RW6 A;  1J72 A;  4R5D A;  3DA7 A;  1UDM A;  2WQW A;  2O6S A;  1P8X A;  1A4Y A;  5GMG A;  3A5L S;  2WQU A;  5A5C A;  1FO1 A;  4S10 C;  2MV2 A;  2UZX A;  1K5D C;  1COF A;  1YAG G;  4LSX C;  5A1M A;  5AWA A;  3Q2B A;  5B0N A;  5AWD A;  1SVR A;  3OJA A;  4TZH A;  2OMX A;  4RCA B;  4PKH B;  4Z8G A;  3CI5 G;  3EG9 B;  4CBX G;  1XEC A;  2FT3 A;  1M0Z A;  1OTO A;  1M10 B;  2VAC A;  3OJA B;  2I2Q A;  4L3A A;  5IVU A;  3WPB A;  2AST B;  3FXI A;  3G39 A;  4PKI G;  2MP4 A;  2NUT B;  4PEQ B;  4R5C A;  1KOH A;  3BZ5 A;  3C6P B;  4FDW A;  4PKG G;  3W3G A;  1XEU A;  1TVJ A;  5CMP A;  2LLF A;  1YRG A;  2P1M B;  1P8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...