4CBWG

Crystal structure of plasmodium berghei actin i with d-loop from muscle actin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
123
Chain Sequence
VEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Differences Explain Diverse Functions of Plasmodium Actins.
pubmed doi rcsb
source organism Plasmodium berghei
molecule tags Motor protein
molecule keywords ACTIN, ALPHA SKELETAL MUSCLE, ACTIN
total genus 38
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4cbwG00
1P8ZG 4LIZA 1WM4A 5A1MA 3EFOB 5KYUA 2VIKA 3CJCG 1RGIG 5FAFA 1T3XA 1X67A 4KEEA 1WNJA 5HVKD 1SVQA 1COFA 1YAGG 2I2QA 4CBUG 1EQYS 3CI5G 4JD2H 3FFKA 4PKGG 3L50A 4CBWG 2W0IA 1M2VB 1CNUA 3EGDA 2LXXA 1UDMA 5KYWA 1NM1G 2LJ8A 3CJBG 1Q8XA 1VKKA 1M4JA 5KYXA 2XF1A 1WFSA 2NUPB 2FGHA 2FF3A 1PD1A 2HD7A 1SVRA 4Z94G 1C0FS 2MV2A 1NPHA 1J72A 3Q2BA 4KEFA 1M2VA 1HQZ1 1F7SA 2L72A 5KYUB 4S10C 2VACA 1T44G 1AK7A 2NUTB 1YVNG 2FH3A 5KYXB 2FH2A 4BEX1 2MOTA 3EG9B 3FFNA 2FF6G 2FH4A 2FH1A 2LLFA 3EGDB 1NMDG 3FG6A 1Q8GA 1C0GS 3A5MS 1QPVA 1P8XA 5IVUA 1T2LA 1D4XG 1SVYA 5KYWB 1PD0A 1ESVS 2KVKA 3DAWB 3A5OS 4PKIG 1PCXA 5KYNA 3A5LS 1AK6A 1M2OA 3TU5B 5KYYB 2VILA 3EG9A 3EH2A 2D8BA 2QTVA 3EGXA 1MDUA 3EH1A 1AHQA 4PKHB 1VFQA 5DD2A 3A5NS 1D0NA 2NUTA 4CBXG 3CIPG 5L6WC 1JHWA 4KEDA 2XFAA 1T3YA 1DEJS 5FAEA 3EFOA 1CFYA 2MP4A 1TVJA 5KYYA 3FG7A 1NLVG 2NUPA 5HVKB 3EGXB 1KCQA 1H1VG 1V6FA 1TMWA
chains in the Genus database with same CATH superfamily
1P8ZG 4LIZA 1WM4A 5A1MA 3EFOB 5KYUA 2VIKA 3CJCG 1RGIG 5FAFA 1T3XA 1X67A 4KEEA 1WNJA 5HVKD 1SVQA 1COFA 1YAGG 2I2QA 4CBUG 1EQYS 3DA7A 3CI5G 4JD2H 3FFKA 4PKGG 3L50A 4CBWG 2W0IA 1M2VB 1CNUA 3EGDA 2LXXA 1UDMA 5KYWA 1NM1G 2LJ8A 3CJBG 1Q8XA 1VKKA 1M4JA 5KYXA 2XF1A 1WFSA 2NUPB 2FGHA 2FF3A 1PD1A 2HD7A 1SVRA 4Z94G 1C0FS 2MV2A 1NPHA 1J72A 3Q2BA 4KEFA 1M2VA 1HQZ1 1F7SA 2L72A 5KYUB 4S10C 2VACA 1T44G 1AK7A 2NUTB 1YVNG 2FH3A 5KYXB 2FH2A 4BEX1 2MOTA 3EG9B 3FFNA 2FF6G 2FH4A 2FH1A 2LLFA 3EGDB 1NMDG 3FG6A 1Q8GA 1C0GS 3A5MS 1QPVA 1P8XA 5IVUA 1T2LA 1D4XG 1SVYA 5KYWB 1PD0A 1ESVS 2KVKA 3DAWB 3A5OS 4PKIG 1PCXA 5KYNA 3A5LS 1AK6A 1M2OA 3TU5B 5KYYB 2VILA 3EG9A 3EH2A 2D8BA 2QTVA 3EGXA 1MDUA 3EH1A 1AHQA 4PKHB 1VFQA 5DD2A 3A5NS 1D0NA 2NUTA 4CBXG 3CIPG 5L6WC 1JHWA 4KEDA 2XFAA 1T3YA 1DEJS 5FAEA 3EFOA 1CFYA 2MP4A 1TVJA 5KYYA 3FG7A 1NLVG 2NUPA 5HVKB 3EGXB 1KCQA 1H1VG 1V6FA 1TMWA
chains in the Genus database with same CATH topology
1P8ZG 4LIZA 1WM4A 5A1MA 3EFOB 5KYUA 2VIKA 3CJCG 1RGIG 5FAFA 1T3XA 1X67A 4KEEA 1WNJA 5HVKD 1SVQA 1COFA 1YAGG 2I2QA 4CBUG 1EQYS 3DA7A 3CI5G 4JD2H 3FFKA 4PKGG 3L50A 4CBWG 2W0IA 1M2VB 1CNUA 3EGDA 2LXXA 1UDMA 5KYWA 1NM1G 2LJ8A 3CJBG 1Q8XA 1VKKA 1M4JA 5KYXA 2XF1A 1WFSA 2NUPB 2FGHA 2FF3A 1PD1A 2HD7A 1SVRA 4Z94G 1C0FS 2MV2A 1NPHA 1J72A 3Q2BA 4KEFA 1M2VA 1HQZ1 1F7SA 2L72A 5KYUB 4S10C 2VACA 1T44G 1AK7A 2NUTB 1YVNG 2FH3A 5KYXB 2FH2A 4BEX1 2MOTA 3EG9B 3FFNA 2FF6G 2FH4A 2FH1A 2LLFA 3EGDB 1NMDG 3FG6A 1Q8GA 1C0GS 3A5MS 1QPVA 1P8XA 5IVUA 1T2LA 1D4XG 1SVYA 5KYWB 1PD0A 1ESVS 2KVKA 3DAWB 3A5OS 4PKIG 1PCXA 5KYNA 3A5LS 1AK6A 1M2OA 3TU5B 5KYYB 2VILA 3EG9A 3EH2A 2D8BA 2QTVA 3EGXA 1MDUA 3EH1A 1AHQA 4PKHB 1VFQA 5DD2A 3A5NS 1D0NA 2NUTA 4CBXG 3CIPG 5L6WC 1JHWA 4KEDA 2XFAA 1T3YA 1DEJS 5FAEA 3EFOA 1CFYA 2MP4A 1TVJA 5KYYA 3FG7A 1NLVG 2NUPA 5HVKB 3EGXB 1KCQA 1H1VG 1V6FA 1TMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8Z G;  4LIZ A;  1WM4 A;  5A1M A;  3EFO B;  5KYU A;  2VIK A;  3CJC G;  1RGI G;  5FAF A;  1T3X A;  1X67 A;  4KEE A;  1WNJ A;  5HVK D;  1SVQ A;  1COF A;  1YAG G;  2I2Q A;  4CBU G;  1EQY S;  3CI5 G;  4JD2 H;  3FFK A;  4PKG G;  3L50 A;  4CBW G;  2W0I A;  1M2V B;  1CNU A;  3EGD A;  2LXX A;  1UDM A;  5KYW A;  1NM1 G;  2LJ8 A;  3CJB G;  1Q8X A;  1VKK A;  1M4J A;  5KYX A;  2XF1 A;  1WFS A;  2NUP B;  2FGH A;  2FF3 A;  1PD1 A;  2HD7 A;  1SVR A;  4Z94 G;  1C0F S;  2MV2 A;  1NPH A;  1J72 A;  3Q2B A;  4KEF A;  1M2V A;  1HQZ 1;  1F7S A;  2L72 A;  5KYU B;  4S10 C;  2VAC A;  1T44 G;  1AK7 A;  2NUT B;  1YVN G;  2FH3 A;  5KYX B;  2FH2 A;  4BEX 1;  2MOT A;  3EG9 B;  3FFN A;  2FF6 G;  2FH4 A;  2FH1 A;  2LLF A;  3EGD B;  1NMD G;  3FG6 A;  1Q8G A;  1C0G S;  3A5M S;  1QPV A;  1P8X A;  5IVU A;  1T2L A;  1D4X G;  1SVY A;  5KYW B;  1PD0 A;  1ESV S;  2KVK A;  3DAW B;  3A5O S;  4PKI G;  1PCX A;  5KYN A;  3A5L S;  1AK6 A;  1M2O A;  3TU5 B;  5KYY B;  2VIL A;  3EG9 A;  3EH2 A;  2D8B A;  2QTV A;  3EGX A;  1MDU A;  3EH1 A;  1AHQ A;  4PKH B;  1VFQ A;  5DD2 A;  3A5N S;  1D0N A;  2NUT A;  4CBX G;  3CIP G;  5L6W C;  1JHW A;  4KED A;  2XFA A;  1T3Y A;  1DEJ S;  5FAE A;  3EFO A;  1CFY A;  2MP4 A;  1TVJ A;  5KYY A;  3FG7 A;  1NLV G;  2NUP A;  5HVK B;  3EGX B;  1KCQ A;  1H1V G;  1V6F A;  1TMW A; 
#chains in the Genus database with same CATH topology
 1P8Z G;  4LIZ A;  1WM4 A;  5A1M A;  3EFO B;  5KYU A;  2VIK A;  3CJC G;  1RGI G;  5FAF A;  1T3X A;  1X67 A;  4KEE A;  1WNJ A;  5HVK D;  1SVQ A;  1COF A;  1YAG G;  2I2Q A;  4CBU G;  1EQY S;  3DA7 A;  3CI5 G;  4JD2 H;  3FFK A;  4PKG G;  3L50 A;  4CBW G;  2W0I A;  1M2V B;  1CNU A;  3EGD A;  2LXX A;  1UDM A;  5KYW A;  1NM1 G;  2LJ8 A;  3CJB G;  1Q8X A;  1VKK A;  1M4J A;  5KYX A;  2XF1 A;  1WFS A;  2NUP B;  2FGH A;  2FF3 A;  1PD1 A;  2HD7 A;  1SVR A;  4Z94 G;  1C0F S;  2MV2 A;  1NPH A;  1J72 A;  3Q2B A;  4KEF A;  1M2V A;  1HQZ 1;  1F7S A;  2L72 A;  5KYU B;  4S10 C;  2VAC A;  1T44 G;  1AK7 A;  2NUT B;  1YVN G;  2FH3 A;  5KYX B;  2FH2 A;  4BEX 1;  2MOT A;  3EG9 B;  3FFN A;  2FF6 G;  2FH4 A;  2FH1 A;  2LLF A;  3EGD B;  1NMD G;  3FG6 A;  1Q8G A;  1C0G S;  3A5M S;  1QPV A;  1P8X A;  5IVU A;  1T2L A;  1D4X G;  1SVY A;  5KYW B;  1PD0 A;  1ESV S;  2KVK A;  3DAW B;  3A5O S;  4PKI G;  1PCX A;  5KYN A;  3A5L S;  1AK6 A;  1M2O A;  3TU5 B;  5KYY B;  2VIL A;  3EG9 A;  3EH2 A;  2D8B A;  2QTV A;  3EGX A;  1MDU A;  3EH1 A;  1AHQ A;  4PKH B;  1VFQ A;  5DD2 A;  3A5N S;  1D0N A;  2NUT A;  4CBX G;  3CIP G;  5L6W C;  1JHW A;  4KED A;  2XFA A;  1T3Y A;  1DEJ S;  5FAE A;  3EFO A;  1CFY A;  2MP4 A;  1TVJ A;  5KYY A;  3FG7 A;  1NLV G;  2NUP A;  5HVK B;  3EGX B;  1KCQ A;  1H1V G;  1V6F A;  1TMW A; 
#chains in the Genus database with same CATH homology
 1P8Z G;  4LIZ A;  1WM4 A;  5A1M A;  3EFO B;  5KYU A;  2VIK A;  3CJC G;  1RGI G;  5FAF A;  1T3X A;  1X67 A;  4KEE A;  1WNJ A;  5HVK D;  1SVQ A;  1COF A;  1YAG G;  2I2Q A;  4CBU G;  1EQY S;  3DA7 A;  3CI5 G;  4JD2 H;  3FFK A;  4PKG G;  3L50 A;  4CBW G;  2W0I A;  1M2V B;  1CNU A;  3EGD A;  2LXX A;  1UDM A;  5KYW A;  1NM1 G;  2LJ8 A;  3CJB G;  1Q8X A;  1VKK A;  1M4J A;  5KYX A;  2XF1 A;  1WFS A;  2NUP B;  2FGH A;  2FF3 A;  1PD1 A;  2HD7 A;  1SVR A;  4Z94 G;  1C0F S;  2MV2 A;  1NPH A;  1J72 A;  3Q2B A;  4KEF A;  1M2V A;  1HQZ 1;  1F7S A;  2L72 A;  5KYU B;  4S10 C;  2VAC A;  1T44 G;  1AK7 A;  2NUT B;  1YVN G;  2FH3 A;  5KYX B;  2FH2 A;  4BEX 1;  2MOT A;  3EG9 B;  3FFN A;  2FF6 G;  2FH4 A;  2FH1 A;  2LLF A;  3EGD B;  1NMD G;  3FG6 A;  1Q8G A;  1C0G S;  3A5M S;  1QPV A;  1P8X A;  5IVU A;  1T2L A;  1D4X G;  1SVY A;  5KYW B;  1PD0 A;  1ESV S;  2KVK A;  3DAW B;  3A5O S;  4PKI G;  1PCX A;  5KYN A;  3A5L S;  1AK6 A;  1M2O A;  3TU5 B;  5KYY B;  2VIL A;  3EG9 A;  3EH2 A;  2D8B A;  2QTV A;  3EGX A;  1MDU A;  3EH1 A;  1AHQ A;  4PKH B;  1VFQ A;  5DD2 A;  3A5N S;  1D0N A;  2NUT A;  4CBX G;  3CIP G;  5L6W C;  1JHW A;  4KED A;  2XFA A;  1T3Y A;  1DEJ S;  5FAE A;  3EFO A;  1CFY A;  2MP4 A;  1TVJ A;  5KYY A;  3FG7 A;  1NLV G;  2NUP A;  5HVK B;  3EGX B;  1KCQ A;  1H1V G;  1V6F A;  1TMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...