2MP4A

Solution structure of adf like unc-60a protein of caenorhabditis elegans
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
165
Chain Sequence
MSSGVMVDPDVQTSFQKLSEGRKEYRYIIFKIDENKVIVEAAVTQDQLGITGDDYDDSSKAAFDKFVEDVKSRTDNLTDCRYAVFDFKFTCSRVGAGTSKMDKIIFLQICPDGASIKKKMVYASSAAAIKTSLGTGKILQFQVSDESEMSHKELLNKLGEKYGDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure and Backbone dynamics of ADF like UNC-60A protein from Caenorhabditis elegans: its divergence from conventional ADF/cofilin
rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
molecule keywords Actin-depolymerizing factor 1, isoforms a/b
total genus 44
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2mp4A00
1WFSA 5FAFA 1KCQA 2NUPA 1CFYA 1H1VG 1NLVG 1QPVA 1ESVS 5FAEA 1X67A 3L50A 2L72A 2FH2A 3CI5G 1YAGG 2VILA 2KVKA 2LJ8A 4BEX1 4Z94G 1F7SA 2LXXA 2I2QA 3A5LS 3DAWB 4LIZA 2XFAA 1V6FA 3TU5B 1D0NA 1M2VA 2MV2A 5HVKD 1D4XG 4CBWG 1M2OA 5KYXB 3FG6A 5KYXA 5L6WC 1M2VB 1PD0A 5KYWA 1C0GS 2XF1A 5KYYA 2NUTA 2NUTB 1EQYS 3EGDB 2FF3A 4PKHB 3EGDA 1VKKA 1J72A 1PD1A 3EH2A 1JHWA 4KEEA 5KYUB 2FGHA 2FH1A 1SVYA 5KYUA 1VFQA 5KYNA 4KEDA 1HQZ1 2LLFA 3EFOA 3CJCG 3FG7A 1AK6A 2VACA 1RGIG 3FFNA 3A5MS 2W0IA 4S10C 1PCXA 1T44G 5KYYB 1NPHA 1M4JA 3CJBG 4KEFA 4CBXG 5KYWB 5IVUA 1DEJS 3EG9B 5A1MA 2FH4A 3A5NS 1T2LA 1AK7A 3FFKA 2HD7A 1NM1G 2D8BA 1TVJA 1NMDG 2NUPB 3CIPG 3EGXB 4PKGG 5DD2A 3EH1A 1WNJA 1SVRA 1AHQA 4PKIG 1WM4A 1YVNG 3A5OS 2VIKA 3Q2BA 1MDUA 1P8XA 2FH3A 1UDMA 2MP4A 1CNUA 1COFA 3EFOB 2MOTA 5HVKB 3EG9A 1T3XA 4JD2H 1Q8GA 3EGXA 1C0FS 4CBUG 2QTVA 1SVQA 1P8ZG 2FF6G 1TMWA 1T3YA 1Q8XA
chains in the Genus database with same CATH superfamily
1WFSA 5FAFA 1KCQA 2NUPA 1CFYA 1H1VG 1NLVG 1QPVA 1ESVS 5FAEA 1X67A 3L50A 2L72A 2FH2A 3CI5G 1YAGG 2VILA 2KVKA 2LJ8A 4BEX1 4Z94G 1F7SA 2LXXA 2I2QA 3A5LS 3DAWB 4LIZA 2XFAA 1V6FA 3TU5B 1D0NA 1M2VA 2MV2A 5HVKD 1D4XG 4CBWG 1M2OA 5KYXB 3FG6A 5KYXA 5L6WC 1M2VB 1PD0A 5KYWA 1C0GS 2XF1A 5KYYA 2NUTA 2NUTB 1EQYS 3EGDB 2FF3A 4PKHB 3EGDA 1VKKA 1J72A 1PD1A 3EH2A 1JHWA 4KEEA 5KYUB 2FGHA 2FH1A 1SVYA 5KYUA 1VFQA 5KYNA 4KEDA 1HQZ1 2LLFA 3EFOA 3CJCG 3FG7A 1AK6A 2VACA 1RGIG 3FFNA 3A5MS 2W0IA 4S10C 1PCXA 1T44G 5KYYB 1NPHA 1M4JA 3CJBG 4KEFA 4CBXG 5KYWB 5IVUA 1DEJS 3EG9B 5A1MA 2FH4A 3A5NS 1T2LA 1AK7A 3FFKA 2HD7A 1NM1G 2D8BA 1TVJA 1NMDG 2NUPB 3CIPG 3EGXB 4PKGG 5DD2A 3EH1A 1WNJA 1SVRA 1AHQA 4PKIG 1WM4A 1YVNG 3A5OS 2VIKA 3Q2BA 1MDUA 1P8XA 2FH3A 1UDMA 2MP4A 1CNUA 1COFA 3EFOB 2MOTA 5HVKB 3EG9A 1T3XA 4JD2H 1Q8GA 3DA7A 3EGXA 1C0FS 4CBUG 2QTVA 1SVQA 1P8ZG 2FF6G 1TMWA 1T3YA 1Q8XA
chains in the Genus database with same CATH topology
1WFSA 5FAFA 1KCQA 2NUPA 1CFYA 1H1VG 1NLVG 1QPVA 1ESVS 5FAEA 1X67A 3L50A 2L72A 2FH2A 3CI5G 1YAGG 2VILA 2KVKA 2LJ8A 4BEX1 4Z94G 1F7SA 2LXXA 2I2QA 3A5LS 3DAWB 4LIZA 2XFAA 1V6FA 3TU5B 1D0NA 1M2VA 2MV2A 5HVKD 1D4XG 4CBWG 1M2OA 5KYXB 3FG6A 5KYXA 5L6WC 1M2VB 1PD0A 5KYWA 1C0GS 2XF1A 5KYYA 2NUTA 2NUTB 1EQYS 3EGDB 2FF3A 4PKHB 3EGDA 1VKKA 1J72A 1PD1A 3EH2A 1JHWA 4KEEA 5KYUB 2FGHA 2FH1A 1SVYA 5KYUA 1VFQA 5KYNA 4KEDA 1HQZ1 2LLFA 3EFOA 3CJCG 3FG7A 1AK6A 2VACA 1RGIG 3FFNA 3A5MS 2W0IA 4S10C 1PCXA 1T44G 5KYYB 1NPHA 1M4JA 3CJBG 4KEFA 4CBXG 5KYWB 5IVUA 1DEJS 3EG9B 5A1MA 2FH4A 3A5NS 1T2LA 1AK7A 3FFKA 2HD7A 1NM1G 2D8BA 1TVJA 1NMDG 2NUPB 3CIPG 3EGXB 4PKGG 5DD2A 3EH1A 1WNJA 1SVRA 1AHQA 4PKIG 1WM4A 1YVNG 3A5OS 2VIKA 3Q2BA 1MDUA 1P8XA 2FH3A 1UDMA 2MP4A 1CNUA 1COFA 3EFOB 2MOTA 5HVKB 3EG9A 1T3XA 4JD2H 1Q8GA 3DA7A 3EGXA 1C0FS 4CBUG 2QTVA 1SVQA 1P8ZG 2FF6G 1TMWA 1T3YA 1Q8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFS A;  5FAF A;  1KCQ A;  2NUP A;  1CFY A;  1H1V G;  1NLV G;  1QPV A;  1ESV S;  5FAE A;  1X67 A;  3L50 A;  2L72 A;  2FH2 A;  3CI5 G;  1YAG G;  2VIL A;  2KVK A;  2LJ8 A;  4BEX 1;  4Z94 G;  1F7S A;  2LXX A;  2I2Q A;  3A5L S;  3DAW B;  4LIZ A;  2XFA A;  1V6F A;  3TU5 B;  1D0N A;  1M2V A;  2MV2 A;  5HVK D;  1D4X G;  4CBW G;  1M2O A;  5KYX B;  3FG6 A;  5KYX A;  5L6W C;  1M2V B;  1PD0 A;  5KYW A;  1C0G S;  2XF1 A;  5KYY A;  2NUT A;  2NUT B;  1EQY S;  3EGD B;  2FF3 A;  4PKH B;  3EGD A;  1VKK A;  1J72 A;  1PD1 A;  3EH2 A;  1JHW A;  4KEE A;  5KYU B;  2FGH A;  2FH1 A;  1SVY A;  5KYU A;  1VFQ A;  5KYN A;  4KED A;  1HQZ 1;  2LLF A;  3EFO A;  3CJC G;  3FG7 A;  1AK6 A;  2VAC A;  1RGI G;  3FFN A;  3A5M S;  2W0I A;  4S10 C;  1PCX A;  1T44 G;  5KYY B;  1NPH A;  1M4J A;  3CJB G;  4KEF A;  4CBX G;  5KYW B;  5IVU A;  1DEJ S;  3EG9 B;  5A1M A;  2FH4 A;  3A5N S;  1T2L A;  1AK7 A;  3FFK A;  2HD7 A;  1NM1 G;  2D8B A;  1TVJ A;  1NMD G;  2NUP B;  3CIP G;  3EGX B;  4PKG G;  5DD2 A;  3EH1 A;  1WNJ A;  1SVR A;  1AHQ A;  4PKI G;  1WM4 A;  1YVN G;  3A5O S;  2VIK A;  3Q2B A;  1MDU A;  1P8X A;  2FH3 A;  1UDM A;  2MP4 A;  1CNU A;  1COF A;  3EFO B;  2MOT A;  5HVK B;  3EG9 A;  1T3X A;  4JD2 H;  1Q8G A;  3EGX A;  1C0F S;  4CBU G;  2QTV A;  1SVQ A;  1P8Z G;  2FF6 G;  1TMW A;  1T3Y A;  1Q8X A; 
#chains in the Genus database with same CATH topology
 1WFS A;  5FAF A;  1KCQ A;  2NUP A;  1CFY A;  1H1V G;  1NLV G;  1QPV A;  1ESV S;  5FAE A;  1X67 A;  3L50 A;  2L72 A;  2FH2 A;  3CI5 G;  1YAG G;  2VIL A;  2KVK A;  2LJ8 A;  4BEX 1;  4Z94 G;  1F7S A;  2LXX A;  2I2Q A;  3A5L S;  3DAW B;  4LIZ A;  2XFA A;  1V6F A;  3TU5 B;  1D0N A;  1M2V A;  2MV2 A;  5HVK D;  1D4X G;  4CBW G;  1M2O A;  5KYX B;  3FG6 A;  5KYX A;  5L6W C;  1M2V B;  1PD0 A;  5KYW A;  1C0G S;  2XF1 A;  5KYY A;  2NUT A;  2NUT B;  1EQY S;  3EGD B;  2FF3 A;  4PKH B;  3EGD A;  1VKK A;  1J72 A;  1PD1 A;  3EH2 A;  1JHW A;  4KEE A;  5KYU B;  2FGH A;  2FH1 A;  1SVY A;  5KYU A;  1VFQ A;  5KYN A;  4KED A;  1HQZ 1;  2LLF A;  3EFO A;  3CJC G;  3FG7 A;  1AK6 A;  2VAC A;  1RGI G;  3FFN A;  3A5M S;  2W0I A;  4S10 C;  1PCX A;  1T44 G;  5KYY B;  1NPH A;  1M4J A;  3CJB G;  4KEF A;  4CBX G;  5KYW B;  5IVU A;  1DEJ S;  3EG9 B;  5A1M A;  2FH4 A;  3A5N S;  1T2L A;  1AK7 A;  3FFK A;  2HD7 A;  1NM1 G;  2D8B A;  1TVJ A;  1NMD G;  2NUP B;  3CIP G;  3EGX B;  4PKG G;  5DD2 A;  3EH1 A;  1WNJ A;  1SVR A;  1AHQ A;  4PKI G;  1WM4 A;  1YVN G;  3A5O S;  2VIK A;  3Q2B A;  1MDU A;  1P8X A;  2FH3 A;  1UDM A;  2MP4 A;  1CNU A;  1COF A;  3EFO B;  2MOT A;  5HVK B;  3EG9 A;  1T3X A;  4JD2 H;  1Q8G A;  3DA7 A;  3EGX A;  1C0F S;  4CBU G;  2QTV A;  1SVQ A;  1P8Z G;  2FF6 G;  1TMW A;  1T3Y A;  1Q8X A; 
#chains in the Genus database with same CATH homology
 1WFS A;  5FAF A;  1KCQ A;  2NUP A;  1CFY A;  1H1V G;  1NLV G;  1QPV A;  1ESV S;  5FAE A;  1X67 A;  3L50 A;  2L72 A;  2FH2 A;  3CI5 G;  1YAG G;  2VIL A;  2KVK A;  2LJ8 A;  4BEX 1;  4Z94 G;  1F7S A;  2LXX A;  2I2Q A;  3A5L S;  3DAW B;  4LIZ A;  2XFA A;  1V6F A;  3TU5 B;  1D0N A;  1M2V A;  2MV2 A;  5HVK D;  1D4X G;  4CBW G;  1M2O A;  5KYX B;  3FG6 A;  5KYX A;  5L6W C;  1M2V B;  1PD0 A;  5KYW A;  1C0G S;  2XF1 A;  5KYY A;  2NUT A;  2NUT B;  1EQY S;  3EGD B;  2FF3 A;  4PKH B;  3EGD A;  1VKK A;  1J72 A;  1PD1 A;  3EH2 A;  1JHW A;  4KEE A;  5KYU B;  2FGH A;  2FH1 A;  1SVY A;  5KYU A;  1VFQ A;  5KYN A;  4KED A;  1HQZ 1;  2LLF A;  3EFO A;  3CJC G;  3FG7 A;  1AK6 A;  2VAC A;  1RGI G;  3FFN A;  3A5M S;  2W0I A;  4S10 C;  1PCX A;  1T44 G;  5KYY B;  1NPH A;  1M4J A;  3CJB G;  4KEF A;  4CBX G;  5KYW B;  5IVU A;  1DEJ S;  3EG9 B;  5A1M A;  2FH4 A;  3A5N S;  1T2L A;  1AK7 A;  3FFK A;  2HD7 A;  1NM1 G;  2D8B A;  1TVJ A;  1NMD G;  2NUP B;  3CIP G;  3EGX B;  4PKG G;  5DD2 A;  3EH1 A;  1WNJ A;  1SVR A;  1AHQ A;  4PKI G;  1WM4 A;  1YVN G;  3A5O S;  2VIK A;  3Q2B A;  1MDU A;  1P8X A;  2FH3 A;  1UDM A;  2MP4 A;  1CNU A;  1COF A;  3EFO B;  2MOT A;  5HVK B;  3EG9 A;  1T3X A;  4JD2 H;  1Q8G A;  3DA7 A;  3EGX A;  1C0F S;  4CBU G;  2QTV A;  1SVQ A;  1P8Z G;  2FF6 G;  1TMW A;  1T3Y A;  1Q8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...