1VKKA

Crystal structure of glia maturation factor-gamma (gmfg) from mus musculus at 1.50 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
137
structure length
137
Chain Sequence
VVCEVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQNISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTETWLKEKLAFFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Glia maturation factor-gamma (GMFG) from Mus musculus at 1.50 A resolution
rcsb
source organism Mus musculus
molecule tags Hormone/growth factor
molecule keywords Glia maturation factor gamma
total genus 42
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1vkkA00
4CBWG 1X67A 2FF3A 2FH3A 1PCXA 1PD1A 2I2QA 3CI5G 4CBUG 1D0NA 2HD7A 3TU5B 1H1VG 1VFQA 3FFNA 5KYXA 5KYXB 1RGIG 1P8ZG 1M2OA 5KYUB 2LLFA 2XF1A 1WNJA 1C0GS 4KEEA 1T44G 3FG6A 1UDMA 5KYYB 1P8XA 3EGDA 1MDUA 2FF6G 2D8BA 1AK6A 1TMWA 2VACA 1ESVS 1NM1G 1EQYS 1T3XA 1YAGG 3EH2A 1PD0A 4PKHB 1NMDG 3FFKA 1KCQA 5KYYA 1AHQA 1DEJS 3EG9A 2NUTA 1TVJA 1F7SA 1V6FA 1NPHA 4PKGG 1YVNG 1C0FS 4CBXG 3A5OS 2LJ8A 1CNUA 2KVKA 3EFOB 5A1MA 1J72A 3DAWB 3EG9B 1T2LA 1WFSA 2VIKA 1HQZ1 2L72A 1M2VB 1M2VA 1SVYA 3EGXA 1T3YA 3CIPG 4PKIG 3CJCG 2MP4A 4Z94G 1Q8XA 3L50A 5KYWA 5KYWB 5DD2A 3A5MS 3FG7A 3EH1A 1D4XG 2FH1A 1M4JA 5L6WC 5KYUA 4KEDA 2LXXA 1JHWA 4BEX1 2NUPB 2NUPA 3EGXB 1NLVG 2FGHA 3A5LS 3CJBG 3EFOA 3Q2BA 1AK7A 4LIZA 5FAEA 2NUTB 4JD2H 5HVKD 3A5NS 1COFA 5IVUA 2VILA 1QPVA 3EGDB 1CFYA 2MV2A 2FH2A 2FH4A 2QTVA 2XFAA 1SVQA 5FAFA 5KYNA 4S10C 1VKKA 5HVKB 4KEFA 1WM4A 2W0IA 1Q8GA 1SVRA 2MOTA
chains in the Genus database with same CATH superfamily
4CBWG 1X67A 2FF3A 2FH3A 1PCXA 1PD1A 2I2QA 3CI5G 4CBUG 1D0NA 2HD7A 3TU5B 1H1VG 1VFQA 3FFNA 5KYXA 5KYXB 1RGIG 1P8ZG 1M2OA 5KYUB 2LLFA 2XF1A 1WNJA 1C0GS 4KEEA 1T44G 3FG6A 1UDMA 5KYYB 1P8XA 3EGDA 1MDUA 2FF6G 2D8BA 1AK6A 1TMWA 2VACA 1ESVS 1NM1G 1EQYS 1T3XA 1YAGG 3EH2A 1PD0A 4PKHB 1NMDG 3FFKA 1KCQA 5KYYA 1AHQA 1DEJS 3EG9A 2NUTA 1TVJA 1F7SA 1V6FA 1NPHA 4PKGG 1YVNG 1C0FS 4CBXG 3A5OS 2LJ8A 1CNUA 3DA7A 2KVKA 3EFOB 5A1MA 1J72A 3DAWB 3EG9B 1T2LA 1WFSA 2VIKA 1HQZ1 2L72A 1M2VB 1M2VA 1SVYA 3EGXA 1T3YA 3CIPG 4PKIG 3CJCG 2MP4A 4Z94G 1Q8XA 3L50A 5KYWA 5KYWB 5DD2A 3A5MS 3FG7A 3EH1A 1D4XG 2FH1A 1M4JA 5L6WC 5KYUA 4KEDA 2LXXA 1JHWA 4BEX1 2NUPB 2NUPA 3EGXB 1NLVG 2FGHA 3A5LS 3CJBG 3EFOA 3Q2BA 1AK7A 4LIZA 5FAEA 2NUTB 4JD2H 5HVKD 3A5NS 1COFA 5IVUA 2VILA 1QPVA 3EGDB 1CFYA 2MV2A 2FH2A 2FH4A 2QTVA 2XFAA 1SVQA 5FAFA 5KYNA 4S10C 1VKKA 5HVKB 4KEFA 1WM4A 2W0IA 1Q8GA 1SVRA 2MOTA
chains in the Genus database with same CATH topology
4CBWG 1X67A 2FF3A 2FH3A 1PCXA 1PD1A 2I2QA 3CI5G 4CBUG 1D0NA 2HD7A 3TU5B 1H1VG 1VFQA 3FFNA 5KYXA 5KYXB 1RGIG 1P8ZG 1M2OA 5KYUB 2LLFA 2XF1A 1WNJA 1C0GS 4KEEA 1T44G 3FG6A 1UDMA 5KYYB 1P8XA 3EGDA 1MDUA 2FF6G 2D8BA 1AK6A 1TMWA 2VACA 1ESVS 1NM1G 1EQYS 1T3XA 1YAGG 3EH2A 1PD0A 4PKHB 1NMDG 3FFKA 1KCQA 5KYYA 1AHQA 1DEJS 3EG9A 2NUTA 1TVJA 1F7SA 1V6FA 1NPHA 4PKGG 1YVNG 1C0FS 4CBXG 3A5OS 2LJ8A 1CNUA 3DA7A 2KVKA 3EFOB 5A1MA 1J72A 3DAWB 3EG9B 1T2LA 1WFSA 2VIKA 1HQZ1 2L72A 1M2VB 1M2VA 1SVYA 3EGXA 1T3YA 3CIPG 4PKIG 3CJCG 2MP4A 4Z94G 1Q8XA 3L50A 5KYWA 5KYWB 5DD2A 3A5MS 3FG7A 3EH1A 1D4XG 2FH1A 1M4JA 5L6WC 5KYUA 4KEDA 2LXXA 1JHWA 4BEX1 2NUPB 2NUPA 3EGXB 1NLVG 2FGHA 3A5LS 3CJBG 3EFOA 3Q2BA 1AK7A 4LIZA 5FAEA 2NUTB 4JD2H 5HVKD 3A5NS 1COFA 5IVUA 2VILA 1QPVA 3EGDB 1CFYA 2MV2A 2FH2A 2FH4A 2QTVA 2XFAA 1SVQA 5FAFA 5KYNA 4S10C 1VKKA 5HVKB 4KEFA 1WM4A 2W0IA 1Q8GA 1SVRA 2MOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBW G;  1X67 A;  2FF3 A;  2FH3 A;  1PCX A;  1PD1 A;  2I2Q A;  3CI5 G;  4CBU G;  1D0N A;  2HD7 A;  3TU5 B;  1H1V G;  1VFQ A;  3FFN A;  5KYX A;  5KYX B;  1RGI G;  1P8Z G;  1M2O A;  5KYU B;  2LLF A;  2XF1 A;  1WNJ A;  1C0G S;  4KEE A;  1T44 G;  3FG6 A;  1UDM A;  5KYY B;  1P8X A;  3EGD A;  1MDU A;  2FF6 G;  2D8B A;  1AK6 A;  1TMW A;  2VAC A;  1ESV S;  1NM1 G;  1EQY S;  1T3X A;  1YAG G;  3EH2 A;  1PD0 A;  4PKH B;  1NMD G;  3FFK A;  1KCQ A;  5KYY A;  1AHQ A;  1DEJ S;  3EG9 A;  2NUT A;  1TVJ A;  1F7S A;  1V6F A;  1NPH A;  4PKG G;  1YVN G;  1C0F S;  4CBX G;  3A5O S;  2LJ8 A;  1CNU A;  2KVK A;  3EFO B;  5A1M A;  1J72 A;  3DAW B;  3EG9 B;  1T2L A;  1WFS A;  2VIK A;  1HQZ 1;  2L72 A;  1M2V B;  1M2V A;  1SVY A;  3EGX A;  1T3Y A;  3CIP G;  4PKI G;  3CJC G;  2MP4 A;  4Z94 G;  1Q8X A;  3L50 A;  5KYW A;  5KYW B;  5DD2 A;  3A5M S;  3FG7 A;  3EH1 A;  1D4X G;  2FH1 A;  1M4J A;  5L6W C;  5KYU A;  4KED A;  2LXX A;  1JHW A;  4BEX 1;  2NUP B;  2NUP A;  3EGX B;  1NLV G;  2FGH A;  3A5L S;  3CJB G;  3EFO A;  3Q2B A;  1AK7 A;  4LIZ A;  5FAE A;  2NUT B;  4JD2 H;  5HVK D;  3A5N S;  1COF A;  5IVU A;  2VIL A;  1QPV A;  3EGD B;  1CFY A;  2MV2 A;  2FH2 A;  2FH4 A;  2QTV A;  2XFA A;  1SVQ A;  5FAF A;  5KYN A;  4S10 C;  1VKK A;  5HVK B;  4KEF A;  1WM4 A;  2W0I A;  1Q8G A;  1SVR A;  2MOT A; 
#chains in the Genus database with same CATH topology
 4CBW G;  1X67 A;  2FF3 A;  2FH3 A;  1PCX A;  1PD1 A;  2I2Q A;  3CI5 G;  4CBU G;  1D0N A;  2HD7 A;  3TU5 B;  1H1V G;  1VFQ A;  3FFN A;  5KYX A;  5KYX B;  1RGI G;  1P8Z G;  1M2O A;  5KYU B;  2LLF A;  2XF1 A;  1WNJ A;  1C0G S;  4KEE A;  1T44 G;  3FG6 A;  1UDM A;  5KYY B;  1P8X A;  3EGD A;  1MDU A;  2FF6 G;  2D8B A;  1AK6 A;  1TMW A;  2VAC A;  1ESV S;  1NM1 G;  1EQY S;  1T3X A;  1YAG G;  3EH2 A;  1PD0 A;  4PKH B;  1NMD G;  3FFK A;  1KCQ A;  5KYY A;  1AHQ A;  1DEJ S;  3EG9 A;  2NUT A;  1TVJ A;  1F7S A;  1V6F A;  1NPH A;  4PKG G;  1YVN G;  1C0F S;  4CBX G;  3A5O S;  2LJ8 A;  1CNU A;  3DA7 A;  2KVK A;  3EFO B;  5A1M A;  1J72 A;  3DAW B;  3EG9 B;  1T2L A;  1WFS A;  2VIK A;  1HQZ 1;  2L72 A;  1M2V B;  1M2V A;  1SVY A;  3EGX A;  1T3Y A;  3CIP G;  4PKI G;  3CJC G;  2MP4 A;  4Z94 G;  1Q8X A;  3L50 A;  5KYW A;  5KYW B;  5DD2 A;  3A5M S;  3FG7 A;  3EH1 A;  1D4X G;  2FH1 A;  1M4J A;  5L6W C;  5KYU A;  4KED A;  2LXX A;  1JHW A;  4BEX 1;  2NUP B;  2NUP A;  3EGX B;  1NLV G;  2FGH A;  3A5L S;  3CJB G;  3EFO A;  3Q2B A;  1AK7 A;  4LIZ A;  5FAE A;  2NUT B;  4JD2 H;  5HVK D;  3A5N S;  1COF A;  5IVU A;  2VIL A;  1QPV A;  3EGD B;  1CFY A;  2MV2 A;  2FH2 A;  2FH4 A;  2QTV A;  2XFA A;  1SVQ A;  5FAF A;  5KYN A;  4S10 C;  1VKK A;  5HVK B;  4KEF A;  1WM4 A;  2W0I A;  1Q8G A;  1SVR A;  2MOT A; 
#chains in the Genus database with same CATH homology
 4CBW G;  1X67 A;  2FF3 A;  2FH3 A;  1PCX A;  1PD1 A;  2I2Q A;  3CI5 G;  4CBU G;  1D0N A;  2HD7 A;  3TU5 B;  1H1V G;  1VFQ A;  3FFN A;  5KYX A;  5KYX B;  1RGI G;  1P8Z G;  1M2O A;  5KYU B;  2LLF A;  2XF1 A;  1WNJ A;  1C0G S;  4KEE A;  1T44 G;  3FG6 A;  1UDM A;  5KYY B;  1P8X A;  3EGD A;  1MDU A;  2FF6 G;  2D8B A;  1AK6 A;  1TMW A;  2VAC A;  1ESV S;  1NM1 G;  1EQY S;  1T3X A;  1YAG G;  3EH2 A;  1PD0 A;  4PKH B;  1NMD G;  3FFK A;  1KCQ A;  5KYY A;  1AHQ A;  1DEJ S;  3EG9 A;  2NUT A;  1TVJ A;  1F7S A;  1V6F A;  1NPH A;  4PKG G;  1YVN G;  1C0F S;  4CBX G;  3A5O S;  2LJ8 A;  1CNU A;  3DA7 A;  2KVK A;  3EFO B;  5A1M A;  1J72 A;  3DAW B;  3EG9 B;  1T2L A;  1WFS A;  2VIK A;  1HQZ 1;  2L72 A;  1M2V B;  1M2V A;  1SVY A;  3EGX A;  1T3Y A;  3CIP G;  4PKI G;  3CJC G;  2MP4 A;  4Z94 G;  1Q8X A;  3L50 A;  5KYW A;  5KYW B;  5DD2 A;  3A5M S;  3FG7 A;  3EH1 A;  1D4X G;  2FH1 A;  1M4J A;  5L6W C;  5KYU A;  4KED A;  2LXX A;  1JHW A;  4BEX 1;  2NUP B;  2NUP A;  3EGX B;  1NLV G;  2FGH A;  3A5L S;  3CJB G;  3EFO A;  3Q2B A;  1AK7 A;  4LIZ A;  5FAE A;  2NUT B;  4JD2 H;  5HVK D;  3A5N S;  1COF A;  5IVU A;  2VIL A;  1QPV A;  3EGD B;  1CFY A;  2MV2 A;  2FH2 A;  2FH4 A;  2QTV A;  2XFA A;  1SVQ A;  5FAF A;  5KYN A;  4S10 C;  1VKK A;  5HVK B;  4KEF A;  1WM4 A;  2W0I A;  1Q8G A;  1SVR A;  2MOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...