2LJ8A

Solution structure of adf/cofilin from trypanosoma brucei
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
136
structure length
136
Chain Sequence
MAMSGVSVADECVTALNDLRHKKSRYVIMHIVDQKSIAVKTIGERGANFDQFIEAIDKNVPCYAAFDFEYTTNDGPRDKLILISWNPDSGAPRTKMLYSSSRDALVPLTQGFQGIQANDASGLDFEEISRKVKSNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H and 15N Assigned Chemical Shifts for ADF/Cofilin from Trypanosoma brucei
rcsb
source organism Trypanosoma brucei
molecule tags Protein binding
molecule keywords Cofilin/actin depolymerizing factor, putative
total genus 25
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2lj8A00
4CBUG 2KVKA 1V6FA 3CIPG 2XFAA 1QPVA 2MP4A 1AK6A 1F7SA 2MOTA 1M2VA 5HVKB 3FFNA 5IVUA 1ESVS 3TU5B 1C0FS 4KEFA 5KYYA 3CJCG 1CFYA 2NUPB 1D4XG 2LLFA 3CI5G 5KYNA 1WFSA 2XF1A 1NPHA 3DAWB 3A5LS 3A5MS 1D0NA 1T2LA 4KEDA 1C0GS 3A5OS 3EH1A 2LJ8A 3A5NS 3FFKA 5A1MA 1CNUA 1MDUA 1VFQA 3EFOA 3FG7A 1P8ZG 2VACA 1X67A 1NLVG 1VKKA 4CBWG 1DEJS 1SVRA 1Q8XA 5FAFA 3CJBG 3L50A 4CBXG 5KYWB 2NUPA 1PD0A 5KYUB 2FH2A 1AK7A 1SVQA 2QTVA 5KYYB 2I2QA 2VIKA 2W0IA 2FGHA 3EH2A 3EGXA 2FH4A 1YVNG 2HD7A 1NM1G 1T44G 5KYXA 2VILA 3EGDA 2FH3A 5HVKD 2L72A 2FF6G 3EFOB 2NUTB 4PKIG 1WM4A 4BEX1 4PKHB 1H1VG 5KYXB 1M4JA 1YAGG 5KYWA 1COFA 2FH1A 5KYUA 1T3XA 2LXXA 1T3YA 1PCXA 1RGIG 1M2OA 4Z94G 1AHQA 1Q8GA 1TMWA 4KEEA 1TVJA 3Q2BA 3EGXB 2NUTA 2MV2A 3FG6A 3EGDB 1JHWA 1J72A 1EQYS 1M2VB 2D8BA 2FF3A 5L6WC 4S10C 1KCQA 4LIZA 4PKGG 1HQZ1 3EG9A 1WNJA 3EG9B 5DD2A 1SVYA 1UDMA 1NMDG 5FAEA 1P8XA 1PD1A 4JD2H
chains in the Genus database with same CATH superfamily
4CBUG 2KVKA 1V6FA 3CIPG 2XFAA 1QPVA 2MP4A 1AK6A 1F7SA 2MOTA 1M2VA 5HVKB 3FFNA 5IVUA 1ESVS 3TU5B 1C0FS 4KEFA 5KYYA 3CJCG 1CFYA 2NUPB 1D4XG 2LLFA 3CI5G 5KYNA 1WFSA 2XF1A 1NPHA 3DAWB 3A5LS 3A5MS 1D0NA 1T2LA 4KEDA 1C0GS 3A5OS 3EH1A 2LJ8A 3A5NS 3FFKA 5A1MA 1CNUA 1MDUA 1VFQA 3EFOA 3FG7A 1P8ZG 2VACA 1X67A 1NLVG 1VKKA 4CBWG 1DEJS 1SVRA 1Q8XA 5FAFA 3DA7A 3CJBG 3L50A 4CBXG 5KYWB 2NUPA 1PD0A 5KYUB 2FH2A 1AK7A 1SVQA 2QTVA 5KYYB 2I2QA 2VIKA 2W0IA 2FGHA 3EH2A 3EGXA 2FH4A 1YVNG 2HD7A 1NM1G 1T44G 5KYXA 2VILA 3EGDA 2FH3A 5HVKD 2L72A 2FF6G 3EFOB 2NUTB 4PKIG 1WM4A 4BEX1 4PKHB 1H1VG 5KYXB 1M4JA 1YAGG 5KYWA 1COFA 2FH1A 5KYUA 1T3XA 2LXXA 1T3YA 1PCXA 1RGIG 1M2OA 4Z94G 1AHQA 1Q8GA 1TMWA 4KEEA 1TVJA 3Q2BA 3EGXB 2NUTA 2MV2A 3FG6A 3EGDB 1JHWA 1J72A 1EQYS 1M2VB 2D8BA 2FF3A 5L6WC 4S10C 1KCQA 4LIZA 4PKGG 1HQZ1 3EG9A 1WNJA 3EG9B 5DD2A 1SVYA 1UDMA 1NMDG 5FAEA 1P8XA 1PD1A 4JD2H
chains in the Genus database with same CATH topology
4CBUG 2KVKA 1V6FA 3CIPG 2XFAA 1QPVA 2MP4A 1AK6A 1F7SA 2MOTA 1M2VA 5HVKB 3FFNA 5IVUA 1ESVS 3TU5B 1C0FS 4KEFA 5KYYA 3CJCG 1CFYA 2NUPB 1D4XG 2LLFA 3CI5G 5KYNA 1WFSA 2XF1A 1NPHA 3DAWB 3A5LS 3A5MS 1D0NA 1T2LA 4KEDA 1C0GS 3A5OS 3EH1A 2LJ8A 3A5NS 3FFKA 5A1MA 1CNUA 1MDUA 1VFQA 3EFOA 3FG7A 1P8ZG 2VACA 1X67A 1NLVG 1VKKA 4CBWG 1DEJS 1SVRA 1Q8XA 5FAFA 3DA7A 3CJBG 3L50A 4CBXG 5KYWB 2NUPA 1PD0A 5KYUB 2FH2A 1AK7A 1SVQA 2QTVA 5KYYB 2I2QA 2VIKA 2W0IA 2FGHA 3EH2A 3EGXA 2FH4A 1YVNG 2HD7A 1NM1G 1T44G 5KYXA 2VILA 3EGDA 2FH3A 5HVKD 2L72A 2FF6G 3EFOB 2NUTB 4PKIG 1WM4A 4BEX1 4PKHB 1H1VG 5KYXB 1M4JA 1YAGG 5KYWA 1COFA 2FH1A 5KYUA 1T3XA 2LXXA 1T3YA 1PCXA 1RGIG 1M2OA 4Z94G 1AHQA 1Q8GA 1TMWA 4KEEA 1TVJA 3Q2BA 3EGXB 2NUTA 2MV2A 3FG6A 3EGDB 1JHWA 1J72A 1EQYS 1M2VB 2D8BA 2FF3A 5L6WC 4S10C 1KCQA 4LIZA 4PKGG 1HQZ1 3EG9A 1WNJA 3EG9B 5DD2A 1SVYA 1UDMA 1NMDG 5FAEA 1P8XA 1PD1A 4JD2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CBU G;  2KVK A;  1V6F A;  3CIP G;  2XFA A;  1QPV A;  2MP4 A;  1AK6 A;  1F7S A;  2MOT A;  1M2V A;  5HVK B;  3FFN A;  5IVU A;  1ESV S;  3TU5 B;  1C0F S;  4KEF A;  5KYY A;  3CJC G;  1CFY A;  2NUP B;  1D4X G;  2LLF A;  3CI5 G;  5KYN A;  1WFS A;  2XF1 A;  1NPH A;  3DAW B;  3A5L S;  3A5M S;  1D0N A;  1T2L A;  4KED A;  1C0G S;  3A5O S;  3EH1 A;  2LJ8 A;  3A5N S;  3FFK A;  5A1M A;  1CNU A;  1MDU A;  1VFQ A;  3EFO A;  3FG7 A;  1P8Z G;  2VAC A;  1X67 A;  1NLV G;  1VKK A;  4CBW G;  1DEJ S;  1SVR A;  1Q8X A;  5FAF A;  3CJB G;  3L50 A;  4CBX G;  5KYW B;  2NUP A;  1PD0 A;  5KYU B;  2FH2 A;  1AK7 A;  1SVQ A;  2QTV A;  5KYY B;  2I2Q A;  2VIK A;  2W0I A;  2FGH A;  3EH2 A;  3EGX A;  2FH4 A;  1YVN G;  2HD7 A;  1NM1 G;  1T44 G;  5KYX A;  2VIL A;  3EGD A;  2FH3 A;  5HVK D;  2L72 A;  2FF6 G;  3EFO B;  2NUT B;  4PKI G;  1WM4 A;  4BEX 1;  4PKH B;  1H1V G;  5KYX B;  1M4J A;  1YAG G;  5KYW A;  1COF A;  2FH1 A;  5KYU A;  1T3X A;  2LXX A;  1T3Y A;  1PCX A;  1RGI G;  1M2O A;  4Z94 G;  1AHQ A;  1Q8G A;  1TMW A;  4KEE A;  1TVJ A;  3Q2B A;  3EGX B;  2NUT A;  2MV2 A;  3FG6 A;  3EGD B;  1JHW A;  1J72 A;  1EQY S;  1M2V B;  2D8B A;  2FF3 A;  5L6W C;  4S10 C;  1KCQ A;  4LIZ A;  4PKG G;  1HQZ 1;  3EG9 A;  1WNJ A;  3EG9 B;  5DD2 A;  1SVY A;  1UDM A;  1NMD G;  5FAE A;  1P8X A;  1PD1 A;  4JD2 H; 
#chains in the Genus database with same CATH topology
 4CBU G;  2KVK A;  1V6F A;  3CIP G;  2XFA A;  1QPV A;  2MP4 A;  1AK6 A;  1F7S A;  2MOT A;  1M2V A;  5HVK B;  3FFN A;  5IVU A;  1ESV S;  3TU5 B;  1C0F S;  4KEF A;  5KYY A;  3CJC G;  1CFY A;  2NUP B;  1D4X G;  2LLF A;  3CI5 G;  5KYN A;  1WFS A;  2XF1 A;  1NPH A;  3DAW B;  3A5L S;  3A5M S;  1D0N A;  1T2L A;  4KED A;  1C0G S;  3A5O S;  3EH1 A;  2LJ8 A;  3A5N S;  3FFK A;  5A1M A;  1CNU A;  1MDU A;  1VFQ A;  3EFO A;  3FG7 A;  1P8Z G;  2VAC A;  1X67 A;  1NLV G;  1VKK A;  4CBW G;  1DEJ S;  1SVR A;  1Q8X A;  5FAF A;  3DA7 A;  3CJB G;  3L50 A;  4CBX G;  5KYW B;  2NUP A;  1PD0 A;  5KYU B;  2FH2 A;  1AK7 A;  1SVQ A;  2QTV A;  5KYY B;  2I2Q A;  2VIK A;  2W0I A;  2FGH A;  3EH2 A;  3EGX A;  2FH4 A;  1YVN G;  2HD7 A;  1NM1 G;  1T44 G;  5KYX A;  2VIL A;  3EGD A;  2FH3 A;  5HVK D;  2L72 A;  2FF6 G;  3EFO B;  2NUT B;  4PKI G;  1WM4 A;  4BEX 1;  4PKH B;  1H1V G;  5KYX B;  1M4J A;  1YAG G;  5KYW A;  1COF A;  2FH1 A;  5KYU A;  1T3X A;  2LXX A;  1T3Y A;  1PCX A;  1RGI G;  1M2O A;  4Z94 G;  1AHQ A;  1Q8G A;  1TMW A;  4KEE A;  1TVJ A;  3Q2B A;  3EGX B;  2NUT A;  2MV2 A;  3FG6 A;  3EGD B;  1JHW A;  1J72 A;  1EQY S;  1M2V B;  2D8B A;  2FF3 A;  5L6W C;  4S10 C;  1KCQ A;  4LIZ A;  4PKG G;  1HQZ 1;  3EG9 A;  1WNJ A;  3EG9 B;  5DD2 A;  1SVY A;  1UDM A;  1NMD G;  5FAE A;  1P8X A;  1PD1 A;  4JD2 H; 
#chains in the Genus database with same CATH homology
 4CBU G;  2KVK A;  1V6F A;  3CIP G;  2XFA A;  1QPV A;  2MP4 A;  1AK6 A;  1F7S A;  2MOT A;  1M2V A;  5HVK B;  3FFN A;  5IVU A;  1ESV S;  3TU5 B;  1C0F S;  4KEF A;  5KYY A;  3CJC G;  1CFY A;  2NUP B;  1D4X G;  2LLF A;  3CI5 G;  5KYN A;  1WFS A;  2XF1 A;  1NPH A;  3DAW B;  3A5L S;  3A5M S;  1D0N A;  1T2L A;  4KED A;  1C0G S;  3A5O S;  3EH1 A;  2LJ8 A;  3A5N S;  3FFK A;  5A1M A;  1CNU A;  1MDU A;  1VFQ A;  3EFO A;  3FG7 A;  1P8Z G;  2VAC A;  1X67 A;  1NLV G;  1VKK A;  4CBW G;  1DEJ S;  1SVR A;  1Q8X A;  5FAF A;  3DA7 A;  3CJB G;  3L50 A;  4CBX G;  5KYW B;  2NUP A;  1PD0 A;  5KYU B;  2FH2 A;  1AK7 A;  1SVQ A;  2QTV A;  5KYY B;  2I2Q A;  2VIK A;  2W0I A;  2FGH A;  3EH2 A;  3EGX A;  2FH4 A;  1YVN G;  2HD7 A;  1NM1 G;  1T44 G;  5KYX A;  2VIL A;  3EGD A;  2FH3 A;  5HVK D;  2L72 A;  2FF6 G;  3EFO B;  2NUT B;  4PKI G;  1WM4 A;  4BEX 1;  4PKH B;  1H1V G;  5KYX B;  1M4J A;  1YAG G;  5KYW A;  1COF A;  2FH1 A;  5KYU A;  1T3X A;  2LXX A;  1T3Y A;  1PCX A;  1RGI G;  1M2O A;  4Z94 G;  1AHQ A;  1Q8G A;  1TMW A;  4KEE A;  1TVJ A;  3Q2B A;  3EGX B;  2NUT A;  2MV2 A;  3FG6 A;  3EGD B;  1JHW A;  1J72 A;  1EQY S;  1M2V B;  2D8B A;  2FF3 A;  5L6W C;  4S10 C;  1KCQ A;  4LIZ A;  4PKG G;  1HQZ 1;  3EG9 A;  1WNJ A;  3EG9 B;  5DD2 A;  1SVY A;  1UDM A;  1NMD G;  5FAE A;  1P8X A;  1PD1 A;  4JD2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...