2LJ8A

Solution structure of adf/cofilin from trypanosoma brucei
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
136
structure length
136
Chain Sequence
MAMSGVSVADECVTALNDLRHKKSRYVIMHIVDQKSIAVKTIGERGANFDQFIEAIDKNVPCYAAFDFEYTTNDGPRDKLILISWNPDSGAPRTKMLYSSSRDALVPLTQGFQGIQANDASGLDFEEISRKVKSNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cofilin/actin depolymerizing factor, putative
publication title 1H and 15N Assigned Chemical Shifts for ADF/Cofilin from Trypanosoma brucei
rcsb
source organism Trypanosoma brucei
molecule tags Protein binding
total genus 25
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2lj8A00
1CFYA 5KYYB 2KVKA 1VFQA 3A5MS 5KYUA 1H1VG 1WNJA 1T2LA 5FAEA 1MDUA 1M2VA 1P8XA 2LLFA 3CJCG 1COFA 2FF3A 4PKHB 3A5OS 1KCQA 3FG6A 1AK7A 1T3YA 1SVQA 1JHWA 3TU5B 1X67A 2LJ8A 2FF6G 3A5NS 1F7SA 1M2VB 1VKKA 3DAWB 4S10C 2FH2A 2FH4A 1YAGG 1D4XG 4CBUG 1NLVG 3EFOA 1YVNG 3FFNA 3CJBG 3EH2A 1PCXA 3EGXA 4PKGG 1Q8GA 2VACA 5FAFA 1WM4A 5L6WC 2HD7A 2I2QA 2XF1A 1T44G 1CNUA 5KYXB 3EFOB 2D8BA 3EGDA 1RGIG 2MP4A 2W0IA 3EGXB 1D0NA 3A5LS 1J72A 1AHQA 4CBXG 1TMWA 1AK6A 1V6FA 3L50A 4KEDA 4BEX1 5IVUA 2XFAA 2FH3A 3EGDB 1UDMA 5HVKD 5KYXA 1NM1G 1NPHA 2MOTA 1WFSA 5HVKB 2NUPA 1QPVA 4KEFA 5KYNA 1T3XA 1C0FS 5DD2A 1HQZ1 1PD0A 4LIZA 2NUPB 1P8ZG 3EG9A 4JD2H 3EH1A 1TVJA 1ESVS 1SVRA 1DEJS 2NUTB 4CBWG 5KYWB 2VIKA 3CIPG 3EG9B 3FFKA 1Q8XA 2FGHA 5KYUB 1C0GS 2LXXA 1SVYA 2VILA 2L72A 5KYYA 2QTVA 1NMDG 3CI5G 2FH1A 1M2OA 5A1MA 3FG7A 2MV2A 2NUTA 1EQYS 5KYWA 4KEEA 1M4JA 3Q2BA 1PD1A 4PKIG 4Z94G
chains in the Genus database with same CATH superfamily
1CFYA 5KYYB 2KVKA 1VFQA 3A5MS 5KYUA 1H1VG 1WNJA 1T2LA 5FAEA 1MDUA 1M2VA 1P8XA 2LLFA 3CJCG 1COFA 2FF3A 4PKHB 3A5OS 1KCQA 3FG6A 1AK7A 1T3YA 1SVQA 1JHWA 3TU5B 1X67A 2LJ8A 2FF6G 3A5NS 1F7SA 1M2VB 1VKKA 3DAWB 4S10C 2FH2A 2FH4A 1YAGG 1D4XG 4CBUG 1NLVG 3EFOA 1YVNG 3FFNA 3CJBG 3EH2A 1PCXA 3EGXA 4PKGG 1Q8GA 2VACA 5FAFA 1WM4A 5L6WC 2HD7A 2I2QA 2XF1A 1T44G 1CNUA 5KYXB 3EFOB 2D8BA 3EGDA 1RGIG 2MP4A 2W0IA 3EGXB 1D0NA 3A5LS 1J72A 1AHQA 4CBXG 1TMWA 1AK6A 1V6FA 3L50A 4KEDA 4BEX1 5IVUA 2XFAA 2FH3A 3EGDB 1UDMA 5HVKD 5KYXA 1NM1G 1NPHA 2MOTA 1WFSA 5HVKB 2NUPA 1QPVA 4KEFA 5KYNA 1T3XA 1C0FS 5DD2A 1HQZ1 1PD0A 4LIZA 2NUPB 1P8ZG 3EG9A 4JD2H 3EH1A 1TVJA 1ESVS 1SVRA 1DEJS 2NUTB 4CBWG 5KYWB 2VIKA 3CIPG 3EG9B 3FFKA 1Q8XA 2FGHA 5KYUB 1C0GS 2LXXA 1SVYA 2VILA 2L72A 5KYYA 2QTVA 1NMDG 3CI5G 2FH1A 1M2OA 5A1MA 3FG7A 2MV2A 3DA7A 2NUTA 1EQYS 5KYWA 4KEEA 1M4JA 3Q2BA 1PD1A 4PKIG 4Z94G
chains in the Genus database with same CATH topology
1CFYA 5KYYB 2KVKA 1VFQA 3A5MS 5KYUA 1H1VG 1WNJA 1T2LA 5FAEA 1MDUA 1M2VA 1P8XA 2LLFA 3CJCG 1COFA 2FF3A 4PKHB 3A5OS 1KCQA 3FG6A 1AK7A 1T3YA 1SVQA 1JHWA 3TU5B 1X67A 2LJ8A 2FF6G 3A5NS 1F7SA 1M2VB 1VKKA 3DAWB 4S10C 2FH2A 2FH4A 1YAGG 1D4XG 4CBUG 1NLVG 3EFOA 1YVNG 3FFNA 3CJBG 3EH2A 1PCXA 3EGXA 4PKGG 1Q8GA 2VACA 5FAFA 1WM4A 5L6WC 2HD7A 2I2QA 2XF1A 1T44G 1CNUA 5KYXB 3EFOB 2D8BA 3EGDA 1RGIG 2MP4A 2W0IA 3EGXB 1D0NA 3A5LS 1J72A 1AHQA 4CBXG 1TMWA 1AK6A 1V6FA 3L50A 4KEDA 4BEX1 5IVUA 2XFAA 2FH3A 3EGDB 1UDMA 5HVKD 5KYXA 1NM1G 1NPHA 2MOTA 1WFSA 5HVKB 2NUPA 1QPVA 4KEFA 5KYNA 1T3XA 1C0FS 5DD2A 1HQZ1 1PD0A 4LIZA 2NUPB 1P8ZG 3EG9A 4JD2H 3EH1A 1TVJA 1ESVS 1SVRA 1DEJS 2NUTB 4CBWG 5KYWB 2VIKA 3CIPG 3EG9B 3FFKA 1Q8XA 2FGHA 5KYUB 1C0GS 2LXXA 1SVYA 2VILA 2L72A 5KYYA 2QTVA 1NMDG 3CI5G 2FH1A 1M2OA 5A1MA 3FG7A 2MV2A 3DA7A 2NUTA 1EQYS 5KYWA 4KEEA 1M4JA 3Q2BA 1PD1A 4PKIG 4Z94G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CFY A;  5KYY B;  2KVK A;  1VFQ A;  3A5M S;  5KYU A;  1H1V G;  1WNJ A;  1T2L A;  5FAE A;  1MDU A;  1M2V A;  1P8X A;  2LLF A;  3CJC G;  1COF A;  2FF3 A;  4PKH B;  3A5O S;  1KCQ A;  3FG6 A;  1AK7 A;  1T3Y A;  1SVQ A;  1JHW A;  3TU5 B;  1X67 A;  2LJ8 A;  2FF6 G;  3A5N S;  1F7S A;  1M2V B;  1VKK A;  3DAW B;  4S10 C;  2FH2 A;  2FH4 A;  1YAG G;  1D4X G;  4CBU G;  1NLV G;  3EFO A;  1YVN G;  3FFN A;  3CJB G;  3EH2 A;  1PCX A;  3EGX A;  4PKG G;  1Q8G A;  2VAC A;  5FAF A;  1WM4 A;  5L6W C;  2HD7 A;  2I2Q A;  2XF1 A;  1T44 G;  1CNU A;  5KYX B;  3EFO B;  2D8B A;  3EGD A;  1RGI G;  2MP4 A;  2W0I A;  3EGX B;  1D0N A;  3A5L S;  1J72 A;  1AHQ A;  4CBX G;  1TMW A;  1AK6 A;  1V6F A;  3L50 A;  4KED A;  4BEX 1;  5IVU A;  2XFA A;  2FH3 A;  3EGD B;  1UDM A;  5HVK D;  5KYX A;  1NM1 G;  1NPH A;  2MOT A;  1WFS A;  5HVK B;  2NUP A;  1QPV A;  4KEF A;  5KYN A;  1T3X A;  1C0F S;  5DD2 A;  1HQZ 1;  1PD0 A;  4LIZ A;  2NUP B;  1P8Z G;  3EG9 A;  4JD2 H;  3EH1 A;  1TVJ A;  1ESV S;  1SVR A;  1DEJ S;  2NUT B;  4CBW G;  5KYW B;  2VIK A;  3CIP G;  3EG9 B;  3FFK A;  1Q8X A;  2FGH A;  5KYU B;  1C0G S;  2LXX A;  1SVY A;  2VIL A;  2L72 A;  5KYY A;  2QTV A;  1NMD G;  3CI5 G;  2FH1 A;  1M2O A;  5A1M A;  3FG7 A;  2MV2 A;  2NUT A;  1EQY S;  5KYW A;  4KEE A;  1M4J A;  3Q2B A;  1PD1 A;  4PKI G;  4Z94 G; 
#chains in the Genus database with same CATH topology
 1CFY A;  5KYY B;  2KVK A;  1VFQ A;  3A5M S;  5KYU A;  1H1V G;  1WNJ A;  1T2L A;  5FAE A;  1MDU A;  1M2V A;  1P8X A;  2LLF A;  3CJC G;  1COF A;  2FF3 A;  4PKH B;  3A5O S;  1KCQ A;  3FG6 A;  1AK7 A;  1T3Y A;  1SVQ A;  1JHW A;  3TU5 B;  1X67 A;  2LJ8 A;  2FF6 G;  3A5N S;  1F7S A;  1M2V B;  1VKK A;  3DAW B;  4S10 C;  2FH2 A;  2FH4 A;  1YAG G;  1D4X G;  4CBU G;  1NLV G;  3EFO A;  1YVN G;  3FFN A;  3CJB G;  3EH2 A;  1PCX A;  3EGX A;  4PKG G;  1Q8G A;  2VAC A;  5FAF A;  1WM4 A;  5L6W C;  2HD7 A;  2I2Q A;  2XF1 A;  1T44 G;  1CNU A;  5KYX B;  3EFO B;  2D8B A;  3EGD A;  1RGI G;  2MP4 A;  2W0I A;  3EGX B;  1D0N A;  3A5L S;  1J72 A;  1AHQ A;  4CBX G;  1TMW A;  1AK6 A;  1V6F A;  3L50 A;  4KED A;  4BEX 1;  5IVU A;  2XFA A;  2FH3 A;  3EGD B;  1UDM A;  5HVK D;  5KYX A;  1NM1 G;  1NPH A;  2MOT A;  1WFS A;  5HVK B;  2NUP A;  1QPV A;  4KEF A;  5KYN A;  1T3X A;  1C0F S;  5DD2 A;  1HQZ 1;  1PD0 A;  4LIZ A;  2NUP B;  1P8Z G;  3EG9 A;  4JD2 H;  3EH1 A;  1TVJ A;  1ESV S;  1SVR A;  1DEJ S;  2NUT B;  4CBW G;  5KYW B;  2VIK A;  3CIP G;  3EG9 B;  3FFK A;  1Q8X A;  2FGH A;  5KYU B;  1C0G S;  2LXX A;  1SVY A;  2VIL A;  2L72 A;  5KYY A;  2QTV A;  1NMD G;  3CI5 G;  2FH1 A;  1M2O A;  5A1M A;  3FG7 A;  2MV2 A;  3DA7 A;  2NUT A;  1EQY S;  5KYW A;  4KEE A;  1M4J A;  3Q2B A;  1PD1 A;  4PKI G;  4Z94 G; 
#chains in the Genus database with same CATH homology
 1CFY A;  5KYY B;  2KVK A;  1VFQ A;  3A5M S;  5KYU A;  1H1V G;  1WNJ A;  1T2L A;  5FAE A;  1MDU A;  1M2V A;  1P8X A;  2LLF A;  3CJC G;  1COF A;  2FF3 A;  4PKH B;  3A5O S;  1KCQ A;  3FG6 A;  1AK7 A;  1T3Y A;  1SVQ A;  1JHW A;  3TU5 B;  1X67 A;  2LJ8 A;  2FF6 G;  3A5N S;  1F7S A;  1M2V B;  1VKK A;  3DAW B;  4S10 C;  2FH2 A;  2FH4 A;  1YAG G;  1D4X G;  4CBU G;  1NLV G;  3EFO A;  1YVN G;  3FFN A;  3CJB G;  3EH2 A;  1PCX A;  3EGX A;  4PKG G;  1Q8G A;  2VAC A;  5FAF A;  1WM4 A;  5L6W C;  2HD7 A;  2I2Q A;  2XF1 A;  1T44 G;  1CNU A;  5KYX B;  3EFO B;  2D8B A;  3EGD A;  1RGI G;  2MP4 A;  2W0I A;  3EGX B;  1D0N A;  3A5L S;  1J72 A;  1AHQ A;  4CBX G;  1TMW A;  1AK6 A;  1V6F A;  3L50 A;  4KED A;  4BEX 1;  5IVU A;  2XFA A;  2FH3 A;  3EGD B;  1UDM A;  5HVK D;  5KYX A;  1NM1 G;  1NPH A;  2MOT A;  1WFS A;  5HVK B;  2NUP A;  1QPV A;  4KEF A;  5KYN A;  1T3X A;  1C0F S;  5DD2 A;  1HQZ 1;  1PD0 A;  4LIZ A;  2NUP B;  1P8Z G;  3EG9 A;  4JD2 H;  3EH1 A;  1TVJ A;  1ESV S;  1SVR A;  1DEJ S;  2NUT B;  4CBW G;  5KYW B;  2VIK A;  3CIP G;  3EG9 B;  3FFK A;  1Q8X A;  2FGH A;  5KYU B;  1C0G S;  2LXX A;  1SVY A;  2VIL A;  2L72 A;  5KYY A;  2QTV A;  1NMD G;  3CI5 G;  2FH1 A;  1M2O A;  5A1M A;  3FG7 A;  2MV2 A;  3DA7 A;  2NUT A;  1EQY S;  5KYW A;  4KEE A;  1M4J A;  3Q2B A;  1PD1 A;  4PKI G;  4Z94 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...