1NM1G

Crystal structure of d. dicsoideum actin complexed with gelsolin segment 1 and mg atp at 1.8 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
123
Chain Sequence
VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Actin
total genus 38
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2003-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nm1G00
1V6FA 1M4JA 3EGXB 3EH2A 1SVQA 1EQYS 3A5MS 5L6WC 1M2VA 1T3YA 2I2QA 2VILA 1SVYA 1WM4A 1JHWA 2NUPA 4KEEA 1D0NA 1D4XG 1HQZ1 4BEX1 1DEJS 4PKGG 4CBUG 1M2VB 1PD1A 1P8XA 1T44G 5FAEA 4PKHB 5KYUA 1PCXA 1F7SA 5IVUA 2FGHA 2FH4A 2FH2A 5KYXA 5KYXB 2FF6G 5KYUB 5HVKD 3CJCG 4CBXG 4PKIG 2LLFA 1AHQA 5KYYA 1UDMA 1X67A 3DAWB 1Q8XA 4Z94G 1QPVA 3CIPG 5DD2A 2MOTA 1YVNG 3CI5G 1TVJA 1NPHA 1PD0A 2VACA 3EGXA 5KYYB 1C0FS 2NUTA 3A5OS 1AK7A 1ESVS 3EFOB 3FFKA 1VKKA 2HD7A 1NMDG 4KEDA 3FG7A 5A1MA 4JD2H 2QTVA 2NUPB 3FFNA 1T2LA 1COFA 4S10C 3EH1A 3EG9A 2MV2A 1KCQA 2MP4A 3L50A 2L72A 2NUTB 1AK6A 3TU5B 2FH1A 2LJ8A 2XF1A 2D8BA 5KYWA 5KYWB 3A5NS 1CFYA 1P8ZG 1VFQA 3EG9B 1M2OA 3Q2BA 2VIKA 2KVKA 3EFOA 4LIZA 1RGIG 1C0GS 1T3XA 4KEFA 1TMWA 3CJBG 5FAFA 3FG6A 2XFAA 2W0IA 1MDUA 2FH3A 3A5LS 5KYNA 2FF3A 1YAGG 1WNJA 1SVRA 4CBWG 5HVKB 2LXXA 1CNUA 1J72A 1WFSA 1H1VG 3EGDB 3EGDA 1NLVG 1NM1G 1Q8GA
chains in the Genus database with same CATH superfamily
1V6FA 1M4JA 3EGXB 3EH2A 1SVQA 1EQYS 3A5MS 5L6WC 1M2VA 1T3YA 2I2QA 2VILA 1SVYA 1WM4A 1JHWA 2NUPA 4KEEA 1D0NA 1D4XG 1HQZ1 4BEX1 1DEJS 4PKGG 4CBUG 1M2VB 1PD1A 1P8XA 1T44G 5FAEA 4PKHB 5KYUA 1PCXA 1F7SA 5IVUA 2FGHA 3DA7A 2FH4A 2FH2A 5KYXA 5KYXB 2FF6G 5KYUB 5HVKD 3CJCG 4CBXG 4PKIG 2LLFA 1AHQA 5KYYA 1UDMA 1X67A 3DAWB 1Q8XA 4Z94G 1QPVA 3CIPG 5DD2A 2MOTA 1YVNG 3CI5G 1TVJA 1NPHA 1PD0A 2VACA 3EGXA 5KYYB 1C0FS 2NUTA 3A5OS 1AK7A 1ESVS 3EFOB 3FFKA 1VKKA 2HD7A 1NMDG 4KEDA 3FG7A 5A1MA 4JD2H 2QTVA 2NUPB 3FFNA 1T2LA 1COFA 4S10C 3EH1A 3EG9A 2MV2A 1KCQA 2MP4A 3L50A 2L72A 2NUTB 1AK6A 3TU5B 2FH1A 2LJ8A 2XF1A 2D8BA 5KYWA 5KYWB 3A5NS 1CFYA 1P8ZG 1VFQA 3EG9B 1M2OA 3Q2BA 2VIKA 2KVKA 3EFOA 4LIZA 1RGIG 1C0GS 1T3XA 4KEFA 1TMWA 3CJBG 5FAFA 3FG6A 2XFAA 2W0IA 1MDUA 2FH3A 3A5LS 5KYNA 2FF3A 1YAGG 1WNJA 1SVRA 4CBWG 5HVKB 2LXXA 1CNUA 1J72A 1WFSA 1H1VG 3EGDB 3EGDA 1NLVG 1NM1G 1Q8GA
chains in the Genus database with same CATH topology
1V6FA 1M4JA 3EGXB 3EH2A 1SVQA 1EQYS 3A5MS 5L6WC 1M2VA 1T3YA 2I2QA 2VILA 1SVYA 1WM4A 1JHWA 2NUPA 4KEEA 1D0NA 1D4XG 1HQZ1 4BEX1 1DEJS 4PKGG 4CBUG 1M2VB 1PD1A 1P8XA 1T44G 5FAEA 4PKHB 5KYUA 1PCXA 1F7SA 5IVUA 2FGHA 3DA7A 2FH4A 2FH2A 5KYXA 5KYXB 2FF6G 5KYUB 5HVKD 3CJCG 4CBXG 4PKIG 2LLFA 1AHQA 5KYYA 1UDMA 1X67A 3DAWB 1Q8XA 4Z94G 1QPVA 3CIPG 5DD2A 2MOTA 1YVNG 3CI5G 1TVJA 1NPHA 1PD0A 2VACA 3EGXA 5KYYB 1C0FS 2NUTA 3A5OS 1AK7A 1ESVS 3EFOB 3FFKA 1VKKA 2HD7A 1NMDG 4KEDA 3FG7A 5A1MA 4JD2H 2QTVA 2NUPB 3FFNA 1T2LA 1COFA 4S10C 3EH1A 3EG9A 2MV2A 1KCQA 2MP4A 3L50A 2L72A 2NUTB 1AK6A 3TU5B 2FH1A 2LJ8A 2XF1A 2D8BA 5KYWA 5KYWB 3A5NS 1CFYA 1P8ZG 1VFQA 3EG9B 1M2OA 3Q2BA 2VIKA 2KVKA 3EFOA 4LIZA 1RGIG 1C0GS 1T3XA 4KEFA 1TMWA 3CJBG 5FAFA 3FG6A 2XFAA 2W0IA 1MDUA 2FH3A 3A5LS 5KYNA 2FF3A 1YAGG 1WNJA 1SVRA 4CBWG 5HVKB 2LXXA 1CNUA 1J72A 1WFSA 1H1VG 3EGDB 3EGDA 1NLVG 1NM1G 1Q8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6F A;  1M4J A;  3EGX B;  3EH2 A;  1SVQ A;  1EQY S;  3A5M S;  5L6W C;  1M2V A;  1T3Y A;  2I2Q A;  2VIL A;  1SVY A;  1WM4 A;  1JHW A;  2NUP A;  4KEE A;  1D0N A;  1D4X G;  1HQZ 1;  4BEX 1;  1DEJ S;  4PKG G;  4CBU G;  1M2V B;  1PD1 A;  1P8X A;  1T44 G;  5FAE A;  4PKH B;  5KYU A;  1PCX A;  1F7S A;  5IVU A;  2FGH A;  2FH4 A;  2FH2 A;  5KYX A;  5KYX B;  2FF6 G;  5KYU B;  5HVK D;  3CJC G;  4CBX G;  4PKI G;  2LLF A;  1AHQ A;  5KYY A;  1UDM A;  1X67 A;  3DAW B;  1Q8X A;  4Z94 G;  1QPV A;  3CIP G;  5DD2 A;  2MOT A;  1YVN G;  3CI5 G;  1TVJ A;  1NPH A;  1PD0 A;  2VAC A;  3EGX A;  5KYY B;  1C0F S;  2NUT A;  3A5O S;  1AK7 A;  1ESV S;  3EFO B;  3FFK A;  1VKK A;  2HD7 A;  1NMD G;  4KED A;  3FG7 A;  5A1M A;  4JD2 H;  2QTV A;  2NUP B;  3FFN A;  1T2L A;  1COF A;  4S10 C;  3EH1 A;  3EG9 A;  2MV2 A;  1KCQ A;  2MP4 A;  3L50 A;  2L72 A;  2NUT B;  1AK6 A;  3TU5 B;  2FH1 A;  2LJ8 A;  2XF1 A;  2D8B A;  5KYW A;  5KYW B;  3A5N S;  1CFY A;  1P8Z G;  1VFQ A;  3EG9 B;  1M2O A;  3Q2B A;  2VIK A;  2KVK A;  3EFO A;  4LIZ A;  1RGI G;  1C0G S;  1T3X A;  4KEF A;  1TMW A;  3CJB G;  5FAF A;  3FG6 A;  2XFA A;  2W0I A;  1MDU A;  2FH3 A;  3A5L S;  5KYN A;  2FF3 A;  1YAG G;  1WNJ A;  1SVR A;  4CBW G;  5HVK B;  2LXX A;  1CNU A;  1J72 A;  1WFS A;  1H1V G;  3EGD B;  3EGD A;  1NLV G;  1NM1 G;  1Q8G A; 
#chains in the Genus database with same CATH topology
 1V6F A;  1M4J A;  3EGX B;  3EH2 A;  1SVQ A;  1EQY S;  3A5M S;  5L6W C;  1M2V A;  1T3Y A;  2I2Q A;  2VIL A;  1SVY A;  1WM4 A;  1JHW A;  2NUP A;  4KEE A;  1D0N A;  1D4X G;  1HQZ 1;  4BEX 1;  1DEJ S;  4PKG G;  4CBU G;  1M2V B;  1PD1 A;  1P8X A;  1T44 G;  5FAE A;  4PKH B;  5KYU A;  1PCX A;  1F7S A;  5IVU A;  2FGH A;  3DA7 A;  2FH4 A;  2FH2 A;  5KYX A;  5KYX B;  2FF6 G;  5KYU B;  5HVK D;  3CJC G;  4CBX G;  4PKI G;  2LLF A;  1AHQ A;  5KYY A;  1UDM A;  1X67 A;  3DAW B;  1Q8X A;  4Z94 G;  1QPV A;  3CIP G;  5DD2 A;  2MOT A;  1YVN G;  3CI5 G;  1TVJ A;  1NPH A;  1PD0 A;  2VAC A;  3EGX A;  5KYY B;  1C0F S;  2NUT A;  3A5O S;  1AK7 A;  1ESV S;  3EFO B;  3FFK A;  1VKK A;  2HD7 A;  1NMD G;  4KED A;  3FG7 A;  5A1M A;  4JD2 H;  2QTV A;  2NUP B;  3FFN A;  1T2L A;  1COF A;  4S10 C;  3EH1 A;  3EG9 A;  2MV2 A;  1KCQ A;  2MP4 A;  3L50 A;  2L72 A;  2NUT B;  1AK6 A;  3TU5 B;  2FH1 A;  2LJ8 A;  2XF1 A;  2D8B A;  5KYW A;  5KYW B;  3A5N S;  1CFY A;  1P8Z G;  1VFQ A;  3EG9 B;  1M2O A;  3Q2B A;  2VIK A;  2KVK A;  3EFO A;  4LIZ A;  1RGI G;  1C0G S;  1T3X A;  4KEF A;  1TMW A;  3CJB G;  5FAF A;  3FG6 A;  2XFA A;  2W0I A;  1MDU A;  2FH3 A;  3A5L S;  5KYN A;  2FF3 A;  1YAG G;  1WNJ A;  1SVR A;  4CBW G;  5HVK B;  2LXX A;  1CNU A;  1J72 A;  1WFS A;  1H1V G;  3EGD B;  3EGD A;  1NLV G;  1NM1 G;  1Q8G A; 
#chains in the Genus database with same CATH homology
 1V6F A;  1M4J A;  3EGX B;  3EH2 A;  1SVQ A;  1EQY S;  3A5M S;  5L6W C;  1M2V A;  1T3Y A;  2I2Q A;  2VIL A;  1SVY A;  1WM4 A;  1JHW A;  2NUP A;  4KEE A;  1D0N A;  1D4X G;  1HQZ 1;  4BEX 1;  1DEJ S;  4PKG G;  4CBU G;  1M2V B;  1PD1 A;  1P8X A;  1T44 G;  5FAE A;  4PKH B;  5KYU A;  1PCX A;  1F7S A;  5IVU A;  2FGH A;  3DA7 A;  2FH4 A;  2FH2 A;  5KYX A;  5KYX B;  2FF6 G;  5KYU B;  5HVK D;  3CJC G;  4CBX G;  4PKI G;  2LLF A;  1AHQ A;  5KYY A;  1UDM A;  1X67 A;  3DAW B;  1Q8X A;  4Z94 G;  1QPV A;  3CIP G;  5DD2 A;  2MOT A;  1YVN G;  3CI5 G;  1TVJ A;  1NPH A;  1PD0 A;  2VAC A;  3EGX A;  5KYY B;  1C0F S;  2NUT A;  3A5O S;  1AK7 A;  1ESV S;  3EFO B;  3FFK A;  1VKK A;  2HD7 A;  1NMD G;  4KED A;  3FG7 A;  5A1M A;  4JD2 H;  2QTV A;  2NUP B;  3FFN A;  1T2L A;  1COF A;  4S10 C;  3EH1 A;  3EG9 A;  2MV2 A;  1KCQ A;  2MP4 A;  3L50 A;  2L72 A;  2NUT B;  1AK6 A;  3TU5 B;  2FH1 A;  2LJ8 A;  2XF1 A;  2D8B A;  5KYW A;  5KYW B;  3A5N S;  1CFY A;  1P8Z G;  1VFQ A;  3EG9 B;  1M2O A;  3Q2B A;  2VIK A;  2KVK A;  3EFO A;  4LIZ A;  1RGI G;  1C0G S;  1T3X A;  4KEF A;  1TMW A;  3CJB G;  5FAF A;  3FG6 A;  2XFA A;  2W0I A;  1MDU A;  2FH3 A;  3A5L S;  5KYN A;  2FF3 A;  1YAG G;  1WNJ A;  1SVR A;  4CBW G;  5HVK B;  2LXX A;  1CNU A;  1J72 A;  1WFS A;  1H1V G;  3EGD B;  3EGD A;  1NLV G;  1NM1 G;  1Q8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...