1NM1G

Crystal structure of d. dicsoideum actin complexed with gelsolin segment 1 and mg atp at 1.8 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
123
structure length
123
Chain Sequence
VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Actin
total genus 38
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2003-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nm1G00
1DEJS 3EGXB 1M2VA 2NUTA 2FH4A 3CI5G 4CBUG 5HVKD 3EH2A 4LIZA 4KEEA 5FAFA 1M2OA 3EFOA 3CJCG 4CBXG 2FF6G 2W0IA 3EG9B 2MP4A 2XF1A 1P8ZG 5L6WC 2D8BA 1T2LA 3CJBG 2MOTA 1T44G 1SVRA 3EH1A 1EQYS 3DAWB 5IVUA 3EFOB 1CNUA 5DD2A 1PD1A 2LXXA 1NMDG 1Q8XA 5HVKB 1TVJA 5KYWB 1ESVS 3EG9A 2NUPB 2NUTB 4Z94G 1F7SA 3TU5B 2LLFA 1X67A 3L50A 2VILA 2FH1A 4BEX1 1HQZ1 1C0GS 5KYUA 1P8XA 3Q2BA 1M4JA 4CBWG 4KEFA 3EGXA 1D0NA 5KYUB 5KYYB 1NM1G 1T3XA 1AK6A 1WNJA 2QTVA 2VIKA 1WFSA 2LJ8A 2NUPA 5KYWA 2KVKA 1WM4A 1NLVG 1J72A 3FFNA 4S10C 2FGHA 1RGIG 1PCXA 1TMWA 1D4XG 1KCQA 1SVYA 3FG7A 3A5OS 1MDUA 1VFQA 2MV2A 2XFAA 2FH3A 3A5MS 1H1VG 1CFYA 4KEDA 1YAGG 1JHWA 1NPHA 3A5LS 1PD0A 3EGDB 3EGDA 4PKIG 1VKKA 1COFA 3FG6A 2L72A 1QPVA 1YVNG 1UDMA 1SVQA 1Q8GA 2FH2A 2FF3A 3CIPG 4JD2H 1M2VB 4PKGG 5KYNA 1AHQA 1V6FA 2VACA 5FAEA 1AK7A 5KYYA 3FFKA 5KYXA 1T3YA 3A5NS 2HD7A 5KYXB 5A1MA 2I2QA 4PKHB 1C0FS
chains in the Genus database with same CATH superfamily
1DEJS 3EGXB 1M2VA 2NUTA 2FH4A 3CI5G 4CBUG 5HVKD 3EH2A 4LIZA 4KEEA 5FAFA 1M2OA 3EFOA 3CJCG 4CBXG 2FF6G 2W0IA 3EG9B 2MP4A 2XF1A 3DA7A 1P8ZG 5L6WC 2D8BA 1T2LA 3CJBG 2MOTA 1T44G 1SVRA 3EH1A 1EQYS 3DAWB 5IVUA 3EFOB 1CNUA 5DD2A 1PD1A 2LXXA 1NMDG 1Q8XA 5HVKB 1TVJA 5KYWB 1ESVS 3EG9A 2NUPB 2NUTB 4Z94G 1F7SA 3TU5B 2LLFA 1X67A 3L50A 2VILA 2FH1A 4BEX1 1HQZ1 1C0GS 5KYUA 1P8XA 3Q2BA 1M4JA 4CBWG 4KEFA 3EGXA 1D0NA 5KYUB 5KYYB 1NM1G 1T3XA 1AK6A 1WNJA 2QTVA 2VIKA 1WFSA 2LJ8A 2NUPA 5KYWA 2KVKA 1WM4A 1NLVG 1J72A 3FFNA 4S10C 2FGHA 1RGIG 1PCXA 1TMWA 1D4XG 1KCQA 1SVYA 3FG7A 3A5OS 1MDUA 1VFQA 2MV2A 2XFAA 2FH3A 3A5MS 1H1VG 1CFYA 4KEDA 1YAGG 1JHWA 1NPHA 3A5LS 1PD0A 3EGDB 3EGDA 4PKIG 1VKKA 1COFA 3FG6A 2L72A 1QPVA 1YVNG 1UDMA 1SVQA 1Q8GA 2FH2A 2FF3A 3CIPG 4JD2H 1M2VB 4PKGG 5KYNA 1AHQA 1V6FA 2VACA 5FAEA 1AK7A 5KYYA 3FFKA 5KYXA 1T3YA 3A5NS 2HD7A 5KYXB 5A1MA 2I2QA 4PKHB 1C0FS
chains in the Genus database with same CATH topology
1DEJS 3EGXB 1M2VA 2NUTA 2FH4A 3CI5G 4CBUG 5HVKD 3EH2A 4LIZA 4KEEA 5FAFA 1M2OA 3EFOA 3CJCG 4CBXG 2FF6G 2W0IA 3EG9B 2MP4A 2XF1A 3DA7A 1P8ZG 5L6WC 2D8BA 1T2LA 3CJBG 2MOTA 1T44G 1SVRA 3EH1A 1EQYS 3DAWB 5IVUA 3EFOB 1CNUA 5DD2A 1PD1A 2LXXA 1NMDG 1Q8XA 5HVKB 1TVJA 5KYWB 1ESVS 3EG9A 2NUPB 2NUTB 4Z94G 1F7SA 3TU5B 2LLFA 1X67A 3L50A 2VILA 2FH1A 4BEX1 1HQZ1 1C0GS 5KYUA 1P8XA 3Q2BA 1M4JA 4CBWG 4KEFA 3EGXA 1D0NA 5KYUB 5KYYB 1NM1G 1T3XA 1AK6A 1WNJA 2QTVA 2VIKA 1WFSA 2LJ8A 2NUPA 5KYWA 2KVKA 1WM4A 1NLVG 1J72A 3FFNA 4S10C 2FGHA 1RGIG 1PCXA 1TMWA 1D4XG 1KCQA 1SVYA 3FG7A 3A5OS 1MDUA 1VFQA 2MV2A 2XFAA 2FH3A 3A5MS 1H1VG 1CFYA 4KEDA 1YAGG 1JHWA 1NPHA 3A5LS 1PD0A 3EGDB 3EGDA 4PKIG 1VKKA 1COFA 3FG6A 2L72A 1QPVA 1YVNG 1UDMA 1SVQA 1Q8GA 2FH2A 2FF3A 3CIPG 4JD2H 1M2VB 4PKGG 5KYNA 1AHQA 1V6FA 2VACA 5FAEA 1AK7A 5KYYA 3FFKA 5KYXA 1T3YA 3A5NS 2HD7A 5KYXB 5A1MA 2I2QA 4PKHB 1C0FS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEJ S;  3EGX B;  1M2V A;  2NUT A;  2FH4 A;  3CI5 G;  4CBU G;  5HVK D;  3EH2 A;  4LIZ A;  4KEE A;  5FAF A;  1M2O A;  3EFO A;  3CJC G;  4CBX G;  2FF6 G;  2W0I A;  3EG9 B;  2MP4 A;  2XF1 A;  1P8Z G;  5L6W C;  2D8B A;  1T2L A;  3CJB G;  2MOT A;  1T44 G;  1SVR A;  3EH1 A;  1EQY S;  3DAW B;  5IVU A;  3EFO B;  1CNU A;  5DD2 A;  1PD1 A;  2LXX A;  1NMD G;  1Q8X A;  5HVK B;  1TVJ A;  5KYW B;  1ESV S;  3EG9 A;  2NUP B;  2NUT B;  4Z94 G;  1F7S A;  3TU5 B;  2LLF A;  1X67 A;  3L50 A;  2VIL A;  2FH1 A;  4BEX 1;  1HQZ 1;  1C0G S;  5KYU A;  1P8X A;  3Q2B A;  1M4J A;  4CBW G;  4KEF A;  3EGX A;  1D0N A;  5KYU B;  5KYY B;  1NM1 G;  1T3X A;  1AK6 A;  1WNJ A;  2QTV A;  2VIK A;  1WFS A;  2LJ8 A;  2NUP A;  5KYW A;  2KVK A;  1WM4 A;  1NLV G;  1J72 A;  3FFN A;  4S10 C;  2FGH A;  1RGI G;  1PCX A;  1TMW A;  1D4X G;  1KCQ A;  1SVY A;  3FG7 A;  3A5O S;  1MDU A;  1VFQ A;  2MV2 A;  2XFA A;  2FH3 A;  3A5M S;  1H1V G;  1CFY A;  4KED A;  1YAG G;  1JHW A;  1NPH A;  3A5L S;  1PD0 A;  3EGD B;  3EGD A;  4PKI G;  1VKK A;  1COF A;  3FG6 A;  2L72 A;  1QPV A;  1YVN G;  1UDM A;  1SVQ A;  1Q8G A;  2FH2 A;  2FF3 A;  3CIP G;  4JD2 H;  1M2V B;  4PKG G;  5KYN A;  1AHQ A;  1V6F A;  2VAC A;  5FAE A;  1AK7 A;  5KYY A;  3FFK A;  5KYX A;  1T3Y A;  3A5N S;  2HD7 A;  5KYX B;  5A1M A;  2I2Q A;  4PKH B;  1C0F S; 
#chains in the Genus database with same CATH topology
 1DEJ S;  3EGX B;  1M2V A;  2NUT A;  2FH4 A;  3CI5 G;  4CBU G;  5HVK D;  3EH2 A;  4LIZ A;  4KEE A;  5FAF A;  1M2O A;  3EFO A;  3CJC G;  4CBX G;  2FF6 G;  2W0I A;  3EG9 B;  2MP4 A;  2XF1 A;  3DA7 A;  1P8Z G;  5L6W C;  2D8B A;  1T2L A;  3CJB G;  2MOT A;  1T44 G;  1SVR A;  3EH1 A;  1EQY S;  3DAW B;  5IVU A;  3EFO B;  1CNU A;  5DD2 A;  1PD1 A;  2LXX A;  1NMD G;  1Q8X A;  5HVK B;  1TVJ A;  5KYW B;  1ESV S;  3EG9 A;  2NUP B;  2NUT B;  4Z94 G;  1F7S A;  3TU5 B;  2LLF A;  1X67 A;  3L50 A;  2VIL A;  2FH1 A;  4BEX 1;  1HQZ 1;  1C0G S;  5KYU A;  1P8X A;  3Q2B A;  1M4J A;  4CBW G;  4KEF A;  3EGX A;  1D0N A;  5KYU B;  5KYY B;  1NM1 G;  1T3X A;  1AK6 A;  1WNJ A;  2QTV A;  2VIK A;  1WFS A;  2LJ8 A;  2NUP A;  5KYW A;  2KVK A;  1WM4 A;  1NLV G;  1J72 A;  3FFN A;  4S10 C;  2FGH A;  1RGI G;  1PCX A;  1TMW A;  1D4X G;  1KCQ A;  1SVY A;  3FG7 A;  3A5O S;  1MDU A;  1VFQ A;  2MV2 A;  2XFA A;  2FH3 A;  3A5M S;  1H1V G;  1CFY A;  4KED A;  1YAG G;  1JHW A;  1NPH A;  3A5L S;  1PD0 A;  3EGD B;  3EGD A;  4PKI G;  1VKK A;  1COF A;  3FG6 A;  2L72 A;  1QPV A;  1YVN G;  1UDM A;  1SVQ A;  1Q8G A;  2FH2 A;  2FF3 A;  3CIP G;  4JD2 H;  1M2V B;  4PKG G;  5KYN A;  1AHQ A;  1V6F A;  2VAC A;  5FAE A;  1AK7 A;  5KYY A;  3FFK A;  5KYX A;  1T3Y A;  3A5N S;  2HD7 A;  5KYX B;  5A1M A;  2I2Q A;  4PKH B;  1C0F S; 
#chains in the Genus database with same CATH homology
 1DEJ S;  3EGX B;  1M2V A;  2NUT A;  2FH4 A;  3CI5 G;  4CBU G;  5HVK D;  3EH2 A;  4LIZ A;  4KEE A;  5FAF A;  1M2O A;  3EFO A;  3CJC G;  4CBX G;  2FF6 G;  2W0I A;  3EG9 B;  2MP4 A;  2XF1 A;  3DA7 A;  1P8Z G;  5L6W C;  2D8B A;  1T2L A;  3CJB G;  2MOT A;  1T44 G;  1SVR A;  3EH1 A;  1EQY S;  3DAW B;  5IVU A;  3EFO B;  1CNU A;  5DD2 A;  1PD1 A;  2LXX A;  1NMD G;  1Q8X A;  5HVK B;  1TVJ A;  5KYW B;  1ESV S;  3EG9 A;  2NUP B;  2NUT B;  4Z94 G;  1F7S A;  3TU5 B;  2LLF A;  1X67 A;  3L50 A;  2VIL A;  2FH1 A;  4BEX 1;  1HQZ 1;  1C0G S;  5KYU A;  1P8X A;  3Q2B A;  1M4J A;  4CBW G;  4KEF A;  3EGX A;  1D0N A;  5KYU B;  5KYY B;  1NM1 G;  1T3X A;  1AK6 A;  1WNJ A;  2QTV A;  2VIK A;  1WFS A;  2LJ8 A;  2NUP A;  5KYW A;  2KVK A;  1WM4 A;  1NLV G;  1J72 A;  3FFN A;  4S10 C;  2FGH A;  1RGI G;  1PCX A;  1TMW A;  1D4X G;  1KCQ A;  1SVY A;  3FG7 A;  3A5O S;  1MDU A;  1VFQ A;  2MV2 A;  2XFA A;  2FH3 A;  3A5M S;  1H1V G;  1CFY A;  4KED A;  1YAG G;  1JHW A;  1NPH A;  3A5L S;  1PD0 A;  3EGD B;  3EGD A;  4PKI G;  1VKK A;  1COF A;  3FG6 A;  2L72 A;  1QPV A;  1YVN G;  1UDM A;  1SVQ A;  1Q8G A;  2FH2 A;  2FF3 A;  3CIP G;  4JD2 H;  1M2V B;  4PKG G;  5KYN A;  1AHQ A;  1V6F A;  2VAC A;  5FAE A;  1AK7 A;  5KYY A;  3FFK A;  5KYX A;  1T3Y A;  3A5N S;  2HD7 A;  5KYX B;  5A1M A;  2I2Q A;  4PKH B;  1C0F S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...