5HVKD

Crystal structure of limk1 mutant d460n in complex with full-length cofilin-1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
164
structure length
164
Chain Sequence
ASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Noncanonical Substrate Recognition of Cofilin/ADF Proteins by LIM Kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords LIM domain kinase 1
total genus 30
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 5hvkD00
2FGHA 1C0GS 1CNUA 4KEDA 3FFNA 1YVNG 5KYUB 1T44G 1T2LA 2LXXA 3EGDA 1F7SA 1WFSA 2NUTA 5KYWB 4PKHB 3EH1A 1YAGG 2L72A 3CIPG 1T3YA 1C0FS 1PD0A 5FAEA 2MP4A 5KYXA 3CI5G 1PCXA 5KYNA 3A5OS 3EGXB 2MOTA 3L50A 4Z94G 2D8BA 2NUPA 3EG9B 4PKGG 1SVRA 3EH2A 1M2VA 3A5MS 1V6FA 1X67A 3Q2BA 4CBWG 3A5LS 5HVKB 3FG6A 5KYWA 2FF3A 5FAFA 3EG9A 4PKIG 1NPHA 1NM1G 1D0NA 5KYYB 1M2VB 1TMWA 1J72A 1PD1A 1Q8XA 4S10C 1VFQA 3EGXA 1KCQA 1HQZ1 5DD2A 1RGIG 1M2OA 2HD7A 1CFYA 2XFAA 1ESVS 1VKKA 1TVJA 1T3XA 5L6WC 4CBUG 2FH3A 3EGDB 1NMDG 1WNJA 1DEJS 1Q8GA 3CJCG 1QPVA 3EFOA 2LJ8A 4KEFA 1MDUA 5KYXB 3TU5B 2NUPB 2FH4A 1NLVG 2XF1A 1D4XG 2W0IA 2VILA 1EQYS 2FF6G 1H1VG 4JD2H 1M4JA 5KYUA 5IVUA 2KVKA 2FH2A 3A5NS 2VACA 1AK7A 4BEX1 1SVQA 2FH1A 2VIKA 4KEEA 1UDMA 3FFKA 4LIZA 1P8ZG 5HVKD 3DAWB 5KYYA 1SVYA 1AK6A 2I2QA 1P8XA 1AHQA 3CJBG 2MV2A 2QTVA 1JHWA 4CBXG 2NUTB 1COFA 5A1MA 3FG7A 1WM4A 2LLFA 3EFOB
chains in the Genus database with same CATH superfamily
2FGHA 1C0GS 1CNUA 4KEDA 3FFNA 1YVNG 5KYUB 1T44G 1T2LA 2LXXA 3EGDA 1F7SA 1WFSA 2NUTA 5KYWB 4PKHB 3EH1A 1YAGG 2L72A 3CIPG 1T3YA 1C0FS 1PD0A 5FAEA 2MP4A 5KYXA 3CI5G 1PCXA 5KYNA 3A5OS 3EGXB 2MOTA 3L50A 4Z94G 2D8BA 2NUPA 3EG9B 4PKGG 1SVRA 3EH2A 1M2VA 3A5MS 1V6FA 1X67A 3Q2BA 4CBWG 3A5LS 5HVKB 3FG6A 5KYWA 2FF3A 5FAFA 3EG9A 4PKIG 1NPHA 1NM1G 1D0NA 5KYYB 1M2VB 1TMWA 1J72A 1PD1A 1Q8XA 4S10C 1VFQA 3EGXA 1KCQA 1HQZ1 5DD2A 1RGIG 1M2OA 2HD7A 1CFYA 2XFAA 1ESVS 1VKKA 1TVJA 1T3XA 5L6WC 4CBUG 2FH3A 3EGDB 1NMDG 1WNJA 1DEJS 1Q8GA 3CJCG 1QPVA 3EFOA 2LJ8A 4KEFA 1MDUA 5KYXB 3TU5B 2NUPB 2FH4A 1NLVG 2XF1A 1D4XG 2W0IA 2VILA 1EQYS 2FF6G 1H1VG 4JD2H 1M4JA 5KYUA 5IVUA 2KVKA 2FH2A 3A5NS 2VACA 1AK7A 4BEX1 1SVQA 2FH1A 2VIKA 4KEEA 1UDMA 3FFKA 4LIZA 1P8ZG 5HVKD 3DAWB 5KYYA 1SVYA 1AK6A 2I2QA 1P8XA 1AHQA 3CJBG 2MV2A 2QTVA 1JHWA 4CBXG 2NUTB 3DA7A 1COFA 5A1MA 3FG7A 1WM4A 2LLFA 3EFOB
chains in the Genus database with same CATH topology
2FGHA 1C0GS 1CNUA 4KEDA 3FFNA 1YVNG 5KYUB 1T44G 1T2LA 2LXXA 3EGDA 1F7SA 1WFSA 2NUTA 5KYWB 4PKHB 3EH1A 1YAGG 2L72A 3CIPG 1T3YA 1C0FS 1PD0A 5FAEA 2MP4A 5KYXA 3CI5G 1PCXA 5KYNA 3A5OS 3EGXB 2MOTA 3L50A 4Z94G 2D8BA 2NUPA 3EG9B 4PKGG 1SVRA 3EH2A 1M2VA 3A5MS 1V6FA 1X67A 3Q2BA 4CBWG 3A5LS 5HVKB 3FG6A 5KYWA 2FF3A 5FAFA 3EG9A 4PKIG 1NPHA 1NM1G 1D0NA 5KYYB 1M2VB 1TMWA 1J72A 1PD1A 1Q8XA 4S10C 1VFQA 3EGXA 1KCQA 1HQZ1 5DD2A 1RGIG 1M2OA 2HD7A 1CFYA 2XFAA 1ESVS 1VKKA 1TVJA 1T3XA 5L6WC 4CBUG 2FH3A 3EGDB 1NMDG 1WNJA 1DEJS 1Q8GA 3CJCG 1QPVA 3EFOA 2LJ8A 4KEFA 1MDUA 5KYXB 3TU5B 2NUPB 2FH4A 1NLVG 2XF1A 1D4XG 2W0IA 2VILA 1EQYS 2FF6G 1H1VG 4JD2H 1M4JA 5KYUA 5IVUA 2KVKA 2FH2A 3A5NS 2VACA 1AK7A 4BEX1 1SVQA 2FH1A 2VIKA 4KEEA 1UDMA 3FFKA 4LIZA 1P8ZG 5HVKD 3DAWB 5KYYA 1SVYA 1AK6A 2I2QA 1P8XA 1AHQA 3CJBG 2MV2A 2QTVA 1JHWA 4CBXG 2NUTB 3DA7A 1COFA 5A1MA 3FG7A 1WM4A 2LLFA 3EFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGH A;  1C0G S;  1CNU A;  4KED A;  3FFN A;  1YVN G;  5KYU B;  1T44 G;  1T2L A;  2LXX A;  3EGD A;  1F7S A;  1WFS A;  2NUT A;  5KYW B;  4PKH B;  3EH1 A;  1YAG G;  2L72 A;  3CIP G;  1T3Y A;  1C0F S;  1PD0 A;  5FAE A;  2MP4 A;  5KYX A;  3CI5 G;  1PCX A;  5KYN A;  3A5O S;  3EGX B;  2MOT A;  3L50 A;  4Z94 G;  2D8B A;  2NUP A;  3EG9 B;  4PKG G;  1SVR A;  3EH2 A;  1M2V A;  3A5M S;  1V6F A;  1X67 A;  3Q2B A;  4CBW G;  3A5L S;  5HVK B;  3FG6 A;  5KYW A;  2FF3 A;  5FAF A;  3EG9 A;  4PKI G;  1NPH A;  1NM1 G;  1D0N A;  5KYY B;  1M2V B;  1TMW A;  1J72 A;  1PD1 A;  1Q8X A;  4S10 C;  1VFQ A;  3EGX A;  1KCQ A;  1HQZ 1;  5DD2 A;  1RGI G;  1M2O A;  2HD7 A;  1CFY A;  2XFA A;  1ESV S;  1VKK A;  1TVJ A;  1T3X A;  5L6W C;  4CBU G;  2FH3 A;  3EGD B;  1NMD G;  1WNJ A;  1DEJ S;  1Q8G A;  3CJC G;  1QPV A;  3EFO A;  2LJ8 A;  4KEF A;  1MDU A;  5KYX B;  3TU5 B;  2NUP B;  2FH4 A;  1NLV G;  2XF1 A;  1D4X G;  2W0I A;  2VIL A;  1EQY S;  2FF6 G;  1H1V G;  4JD2 H;  1M4J A;  5KYU A;  5IVU A;  2KVK A;  2FH2 A;  3A5N S;  2VAC A;  1AK7 A;  4BEX 1;  1SVQ A;  2FH1 A;  2VIK A;  4KEE A;  1UDM A;  3FFK A;  4LIZ A;  1P8Z G;  5HVK D;  3DAW B;  5KYY A;  1SVY A;  1AK6 A;  2I2Q A;  1P8X A;  1AHQ A;  3CJB G;  2MV2 A;  2QTV A;  1JHW A;  4CBX G;  2NUT B;  1COF A;  5A1M A;  3FG7 A;  1WM4 A;  2LLF A;  3EFO B; 
#chains in the Genus database with same CATH topology
 2FGH A;  1C0G S;  1CNU A;  4KED A;  3FFN A;  1YVN G;  5KYU B;  1T44 G;  1T2L A;  2LXX A;  3EGD A;  1F7S A;  1WFS A;  2NUT A;  5KYW B;  4PKH B;  3EH1 A;  1YAG G;  2L72 A;  3CIP G;  1T3Y A;  1C0F S;  1PD0 A;  5FAE A;  2MP4 A;  5KYX A;  3CI5 G;  1PCX A;  5KYN A;  3A5O S;  3EGX B;  2MOT A;  3L50 A;  4Z94 G;  2D8B A;  2NUP A;  3EG9 B;  4PKG G;  1SVR A;  3EH2 A;  1M2V A;  3A5M S;  1V6F A;  1X67 A;  3Q2B A;  4CBW G;  3A5L S;  5HVK B;  3FG6 A;  5KYW A;  2FF3 A;  5FAF A;  3EG9 A;  4PKI G;  1NPH A;  1NM1 G;  1D0N A;  5KYY B;  1M2V B;  1TMW A;  1J72 A;  1PD1 A;  1Q8X A;  4S10 C;  1VFQ A;  3EGX A;  1KCQ A;  1HQZ 1;  5DD2 A;  1RGI G;  1M2O A;  2HD7 A;  1CFY A;  2XFA A;  1ESV S;  1VKK A;  1TVJ A;  1T3X A;  5L6W C;  4CBU G;  2FH3 A;  3EGD B;  1NMD G;  1WNJ A;  1DEJ S;  1Q8G A;  3CJC G;  1QPV A;  3EFO A;  2LJ8 A;  4KEF A;  1MDU A;  5KYX B;  3TU5 B;  2NUP B;  2FH4 A;  1NLV G;  2XF1 A;  1D4X G;  2W0I A;  2VIL A;  1EQY S;  2FF6 G;  1H1V G;  4JD2 H;  1M4J A;  5KYU A;  5IVU A;  2KVK A;  2FH2 A;  3A5N S;  2VAC A;  1AK7 A;  4BEX 1;  1SVQ A;  2FH1 A;  2VIK A;  4KEE A;  1UDM A;  3FFK A;  4LIZ A;  1P8Z G;  5HVK D;  3DAW B;  5KYY A;  1SVY A;  1AK6 A;  2I2Q A;  1P8X A;  1AHQ A;  3CJB G;  2MV2 A;  2QTV A;  1JHW A;  4CBX G;  2NUT B;  3DA7 A;  1COF A;  5A1M A;  3FG7 A;  1WM4 A;  2LLF A;  3EFO B; 
#chains in the Genus database with same CATH homology
 2FGH A;  1C0G S;  1CNU A;  4KED A;  3FFN A;  1YVN G;  5KYU B;  1T44 G;  1T2L A;  2LXX A;  3EGD A;  1F7S A;  1WFS A;  2NUT A;  5KYW B;  4PKH B;  3EH1 A;  1YAG G;  2L72 A;  3CIP G;  1T3Y A;  1C0F S;  1PD0 A;  5FAE A;  2MP4 A;  5KYX A;  3CI5 G;  1PCX A;  5KYN A;  3A5O S;  3EGX B;  2MOT A;  3L50 A;  4Z94 G;  2D8B A;  2NUP A;  3EG9 B;  4PKG G;  1SVR A;  3EH2 A;  1M2V A;  3A5M S;  1V6F A;  1X67 A;  3Q2B A;  4CBW G;  3A5L S;  5HVK B;  3FG6 A;  5KYW A;  2FF3 A;  5FAF A;  3EG9 A;  4PKI G;  1NPH A;  1NM1 G;  1D0N A;  5KYY B;  1M2V B;  1TMW A;  1J72 A;  1PD1 A;  1Q8X A;  4S10 C;  1VFQ A;  3EGX A;  1KCQ A;  1HQZ 1;  5DD2 A;  1RGI G;  1M2O A;  2HD7 A;  1CFY A;  2XFA A;  1ESV S;  1VKK A;  1TVJ A;  1T3X A;  5L6W C;  4CBU G;  2FH3 A;  3EGD B;  1NMD G;  1WNJ A;  1DEJ S;  1Q8G A;  3CJC G;  1QPV A;  3EFO A;  2LJ8 A;  4KEF A;  1MDU A;  5KYX B;  3TU5 B;  2NUP B;  2FH4 A;  1NLV G;  2XF1 A;  1D4X G;  2W0I A;  2VIL A;  1EQY S;  2FF6 G;  1H1V G;  4JD2 H;  1M4J A;  5KYU A;  5IVU A;  2KVK A;  2FH2 A;  3A5N S;  2VAC A;  1AK7 A;  4BEX 1;  1SVQ A;  2FH1 A;  2VIK A;  4KEE A;  1UDM A;  3FFK A;  4LIZ A;  1P8Z G;  5HVK D;  3DAW B;  5KYY A;  1SVY A;  1AK6 A;  2I2Q A;  1P8X A;  1AHQ A;  3CJB G;  2MV2 A;  2QTV A;  1JHW A;  4CBX G;  2NUT B;  3DA7 A;  1COF A;  5A1M A;  3FG7 A;  1WM4 A;  2LLF A;  3EFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...