3TU5B

Actin complex with gelsolin segment 1 fused to cobl segment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
SVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASKLRKVAEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural States and dynamics of the d-loop in actin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/actin-binding protein
molecule keywords Actin, alpha skeletal muscle
total genus 41
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00626 Gelsolin Gelsolin repeat
B PF02205 WH2 WH2 motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3tu5B00
1SVQA 3EFOA 3EGXA 3EH2A 2VILA 2W0IA 2QTVA 5FAFA 1PD1A 1TVJA 2XFAA 1WM4A 2MV2A 3EG9B 3TU5B 3CJBG 1M2VA 3L50A 1M4JA 5A1MA 1VKKA 2NUTB 5KYXB 4CBXG 2FH4A 3CIPG 1C0FS 4S10C 3A5NS 1P8ZG 4KEFA 3EH1A 1M2OA 5KYUA 4KEDA 2VIKA 5KYNA 1PD0A 3FG7A 5KYUB 1AK7A 2FGHA 1P8XA 1AHQA 4BEX1 1TMWA 1V6FA 1VFQA 1CNUA 2LJ8A 1WNJA 5HVKB 1D4XG 1AK6A 3EGDB 1RGIG 1EQYS 1H1VG 1T44G 4LIZA 3EFOB 1NLVG 1C0GS 4PKIG 2MOTA 3DAWB 4Z94G 1M2VB 1COFA 1PCXA 2LLFA 2FH3A 2LXXA 3CI5G 2MP4A 3EGDA 3FFKA 1NM1G 5HVKD 3A5MS 5DD2A 5KYWA 5KYYA 1KCQA 1HQZ1 1X67A 2VACA 5KYWB 2L72A 2I2QA 1T3XA 3CJCG 1YAGG 1D0NA 1JHWA 5L6WC 2FF6G 5FAEA 3A5OS 5KYXA 4PKHB 3Q2BA 2HD7A 2NUPB 2NUPA 3FG6A 1NMDG 2FH1A 1UDMA 3EGXB 2NUTA 1ESVS 1CFYA 1MDUA 2FH2A 4CBWG 2FF3A 1SVRA 1T2LA 4PKGG 5IVUA 3A5LS 3FFNA 2KVKA 4JD2H 1Q8GA 1QPVA 1T3YA 1J72A 5KYYB 4CBUG 1DEJS 2D8BA 4KEEA 1Q8XA 1WFSA 1YVNG 2XF1A 1F7SA 1NPHA 3EG9A 1SVYA
chains in the Genus database with same CATH superfamily
1SVQA 3DA7A 3EFOA 3EGXA 3EH2A 2VILA 2W0IA 2QTVA 5FAFA 1PD1A 1TVJA 2XFAA 1WM4A 2MV2A 3EG9B 3TU5B 3CJBG 1M2VA 3L50A 1M4JA 5A1MA 1VKKA 2NUTB 5KYXB 4CBXG 2FH4A 3CIPG 1C0FS 4S10C 3A5NS 1P8ZG 4KEFA 3EH1A 1M2OA 5KYUA 4KEDA 2VIKA 5KYNA 1PD0A 3FG7A 5KYUB 1AK7A 2FGHA 1P8XA 1AHQA 4BEX1 1TMWA 1V6FA 1VFQA 1CNUA 2LJ8A 1WNJA 5HVKB 1D4XG 1AK6A 3EGDB 1RGIG 1EQYS 1H1VG 1T44G 4LIZA 3EFOB 1NLVG 1C0GS 4PKIG 2MOTA 3DAWB 4Z94G 1M2VB 1COFA 1PCXA 2LLFA 2FH3A 2LXXA 3CI5G 2MP4A 3EGDA 3FFKA 1NM1G 5HVKD 3A5MS 5DD2A 5KYWA 5KYYA 1KCQA 1HQZ1 1X67A 2VACA 5KYWB 2L72A 2I2QA 1T3XA 3CJCG 1YAGG 1D0NA 1JHWA 5L6WC 2FF6G 5FAEA 3A5OS 5KYXA 4PKHB 3Q2BA 2HD7A 2NUPB 2NUPA 3FG6A 1NMDG 2FH1A 1UDMA 3EGXB 2NUTA 1ESVS 1CFYA 1MDUA 2FH2A 4CBWG 2FF3A 1SVRA 1T2LA 4PKGG 5IVUA 3A5LS 3FFNA 2KVKA 4JD2H 1Q8GA 1QPVA 1T3YA 1J72A 5KYYB 4CBUG 1DEJS 2D8BA 4KEEA 1Q8XA 1WFSA 1YVNG 2XF1A 1F7SA 1NPHA 3EG9A 1SVYA
chains in the Genus database with same CATH topology
1SVQA 3DA7A 3EFOA 3EGXA 3EH2A 2VILA 2W0IA 2QTVA 5FAFA 1PD1A 1TVJA 2XFAA 1WM4A 2MV2A 3EG9B 3TU5B 3CJBG 1M2VA 3L50A 1M4JA 5A1MA 1VKKA 2NUTB 5KYXB 4CBXG 2FH4A 3CIPG 1C0FS 4S10C 3A5NS 1P8ZG 4KEFA 3EH1A 1M2OA 5KYUA 4KEDA 2VIKA 5KYNA 1PD0A 3FG7A 5KYUB 1AK7A 2FGHA 1P8XA 1AHQA 4BEX1 1TMWA 1V6FA 1VFQA 1CNUA 2LJ8A 1WNJA 5HVKB 1D4XG 1AK6A 3EGDB 1RGIG 1EQYS 1H1VG 1T44G 4LIZA 3EFOB 1NLVG 1C0GS 4PKIG 2MOTA 3DAWB 4Z94G 1M2VB 1COFA 1PCXA 2LLFA 2FH3A 2LXXA 3CI5G 2MP4A 3EGDA 3FFKA 1NM1G 5HVKD 3A5MS 5DD2A 5KYWA 5KYYA 1KCQA 1HQZ1 1X67A 2VACA 5KYWB 2L72A 2I2QA 1T3XA 3CJCG 1YAGG 1D0NA 1JHWA 5L6WC 2FF6G 5FAEA 3A5OS 5KYXA 4PKHB 3Q2BA 2HD7A 2NUPB 2NUPA 3FG6A 1NMDG 2FH1A 1UDMA 3EGXB 2NUTA 1ESVS 1CFYA 1MDUA 2FH2A 4CBWG 2FF3A 1SVRA 1T2LA 4PKGG 5IVUA 3A5LS 3FFNA 2KVKA 4JD2H 1Q8GA 1QPVA 1T3YA 1J72A 5KYYB 4CBUG 1DEJS 2D8BA 4KEEA 1Q8XA 1WFSA 1YVNG 2XF1A 1F7SA 1NPHA 3EG9A 1SVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SVQ A;  3EFO A;  3EGX A;  3EH2 A;  2VIL A;  2W0I A;  2QTV A;  5FAF A;  1PD1 A;  1TVJ A;  2XFA A;  1WM4 A;  2MV2 A;  3EG9 B;  3TU5 B;  3CJB G;  1M2V A;  3L50 A;  1M4J A;  5A1M A;  1VKK A;  2NUT B;  5KYX B;  4CBX G;  2FH4 A;  3CIP G;  1C0F S;  4S10 C;  3A5N S;  1P8Z G;  4KEF A;  3EH1 A;  1M2O A;  5KYU A;  4KED A;  2VIK A;  5KYN A;  1PD0 A;  3FG7 A;  5KYU B;  1AK7 A;  2FGH A;  1P8X A;  1AHQ A;  4BEX 1;  1TMW A;  1V6F A;  1VFQ A;  1CNU A;  2LJ8 A;  1WNJ A;  5HVK B;  1D4X G;  1AK6 A;  3EGD B;  1RGI G;  1EQY S;  1H1V G;  1T44 G;  4LIZ A;  3EFO B;  1NLV G;  1C0G S;  4PKI G;  2MOT A;  3DAW B;  4Z94 G;  1M2V B;  1COF A;  1PCX A;  2LLF A;  2FH3 A;  2LXX A;  3CI5 G;  2MP4 A;  3EGD A;  3FFK A;  1NM1 G;  5HVK D;  3A5M S;  5DD2 A;  5KYW A;  5KYY A;  1KCQ A;  1HQZ 1;  1X67 A;  2VAC A;  5KYW B;  2L72 A;  2I2Q A;  1T3X A;  3CJC G;  1YAG G;  1D0N A;  1JHW A;  5L6W C;  2FF6 G;  5FAE A;  3A5O S;  5KYX A;  4PKH B;  3Q2B A;  2HD7 A;  2NUP B;  2NUP A;  3FG6 A;  1NMD G;  2FH1 A;  1UDM A;  3EGX B;  2NUT A;  1ESV S;  1CFY A;  1MDU A;  2FH2 A;  4CBW G;  2FF3 A;  1SVR A;  1T2L A;  4PKG G;  5IVU A;  3A5L S;  3FFN A;  2KVK A;  4JD2 H;  1Q8G A;  1QPV A;  1T3Y A;  1J72 A;  5KYY B;  4CBU G;  1DEJ S;  2D8B A;  4KEE A;  1Q8X A;  1WFS A;  1YVN G;  2XF1 A;  1F7S A;  1NPH A;  3EG9 A;  1SVY A; 
#chains in the Genus database with same CATH topology
 1SVQ A;  3DA7 A;  3EFO A;  3EGX A;  3EH2 A;  2VIL A;  2W0I A;  2QTV A;  5FAF A;  1PD1 A;  1TVJ A;  2XFA A;  1WM4 A;  2MV2 A;  3EG9 B;  3TU5 B;  3CJB G;  1M2V A;  3L50 A;  1M4J A;  5A1M A;  1VKK A;  2NUT B;  5KYX B;  4CBX G;  2FH4 A;  3CIP G;  1C0F S;  4S10 C;  3A5N S;  1P8Z G;  4KEF A;  3EH1 A;  1M2O A;  5KYU A;  4KED A;  2VIK A;  5KYN A;  1PD0 A;  3FG7 A;  5KYU B;  1AK7 A;  2FGH A;  1P8X A;  1AHQ A;  4BEX 1;  1TMW A;  1V6F A;  1VFQ A;  1CNU A;  2LJ8 A;  1WNJ A;  5HVK B;  1D4X G;  1AK6 A;  3EGD B;  1RGI G;  1EQY S;  1H1V G;  1T44 G;  4LIZ A;  3EFO B;  1NLV G;  1C0G S;  4PKI G;  2MOT A;  3DAW B;  4Z94 G;  1M2V B;  1COF A;  1PCX A;  2LLF A;  2FH3 A;  2LXX A;  3CI5 G;  2MP4 A;  3EGD A;  3FFK A;  1NM1 G;  5HVK D;  3A5M S;  5DD2 A;  5KYW A;  5KYY A;  1KCQ A;  1HQZ 1;  1X67 A;  2VAC A;  5KYW B;  2L72 A;  2I2Q A;  1T3X A;  3CJC G;  1YAG G;  1D0N A;  1JHW A;  5L6W C;  2FF6 G;  5FAE A;  3A5O S;  5KYX A;  4PKH B;  3Q2B A;  2HD7 A;  2NUP B;  2NUP A;  3FG6 A;  1NMD G;  2FH1 A;  1UDM A;  3EGX B;  2NUT A;  1ESV S;  1CFY A;  1MDU A;  2FH2 A;  4CBW G;  2FF3 A;  1SVR A;  1T2L A;  4PKG G;  5IVU A;  3A5L S;  3FFN A;  2KVK A;  4JD2 H;  1Q8G A;  1QPV A;  1T3Y A;  1J72 A;  5KYY B;  4CBU G;  1DEJ S;  2D8B A;  4KEE A;  1Q8X A;  1WFS A;  1YVN G;  2XF1 A;  1F7S A;  1NPH A;  3EG9 A;  1SVY A; 
#chains in the Genus database with same CATH homology
 1SVQ A;  3DA7 A;  3EFO A;  3EGX A;  3EH2 A;  2VIL A;  2W0I A;  2QTV A;  5FAF A;  1PD1 A;  1TVJ A;  2XFA A;  1WM4 A;  2MV2 A;  3EG9 B;  3TU5 B;  3CJB G;  1M2V A;  3L50 A;  1M4J A;  5A1M A;  1VKK A;  2NUT B;  5KYX B;  4CBX G;  2FH4 A;  3CIP G;  1C0F S;  4S10 C;  3A5N S;  1P8Z G;  4KEF A;  3EH1 A;  1M2O A;  5KYU A;  4KED A;  2VIK A;  5KYN A;  1PD0 A;  3FG7 A;  5KYU B;  1AK7 A;  2FGH A;  1P8X A;  1AHQ A;  4BEX 1;  1TMW A;  1V6F A;  1VFQ A;  1CNU A;  2LJ8 A;  1WNJ A;  5HVK B;  1D4X G;  1AK6 A;  3EGD B;  1RGI G;  1EQY S;  1H1V G;  1T44 G;  4LIZ A;  3EFO B;  1NLV G;  1C0G S;  4PKI G;  2MOT A;  3DAW B;  4Z94 G;  1M2V B;  1COF A;  1PCX A;  2LLF A;  2FH3 A;  2LXX A;  3CI5 G;  2MP4 A;  3EGD A;  3FFK A;  1NM1 G;  5HVK D;  3A5M S;  5DD2 A;  5KYW A;  5KYY A;  1KCQ A;  1HQZ 1;  1X67 A;  2VAC A;  5KYW B;  2L72 A;  2I2Q A;  1T3X A;  3CJC G;  1YAG G;  1D0N A;  1JHW A;  5L6W C;  2FF6 G;  5FAE A;  3A5O S;  5KYX A;  4PKH B;  3Q2B A;  2HD7 A;  2NUP B;  2NUP A;  3FG6 A;  1NMD G;  2FH1 A;  1UDM A;  3EGX B;  2NUT A;  1ESV S;  1CFY A;  1MDU A;  2FH2 A;  4CBW G;  2FF3 A;  1SVR A;  1T2L A;  4PKG G;  5IVU A;  3A5L S;  3FFN A;  2KVK A;  4JD2 H;  1Q8G A;  1QPV A;  1T3Y A;  1J72 A;  5KYY B;  4CBU G;  1DEJ S;  2D8B A;  4KEE A;  1Q8X A;  1WFS A;  1YVN G;  2XF1 A;  1F7S A;  1NPH A;  3EG9 A;  1SVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...