4KEDA

Crystal structure of cofilin mutant (cof1-157p)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
VAVADESLTAFNDLKLGKKYKFILFGLNDAKTEIVVKETSTDPSYDAFLEKLPENDCLYAIYDFEYEINGKRSKIVFFTWSPDTAPVRSKMVYASSKDALRRALNGVSTDVQGTDFSEVSYDSVLEDVSRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cofilin Mutant (cof1-157p)
rcsb
source organism Saccharomyces cerevisiae
molecule tags Actin binding protein
molecule keywords Cofilin
total genus 35
structure length 131
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4kedA00
4BEX1 4CBUG 3EH2A 2XF1A 1M2VB 1AK7A 1SVRA 1PD1A 2LLFA 3DAWB 2NUTA 3A5OS 1NLVG 1YAGG 1NM1G 1WFSA 4S10C 3Q2BA 5KYYB 1SVQA 1AHQA 2LXXA 2FGHA 5KYUB 1VKKA 2FH1A 4PKGG 3FG7A 1JHWA 1J72A 1KCQA 3EGDA 1YVNG 1M4JA 3A5MS 3EG9B 1T3YA 2XFAA 2W0IA 2NUPB 3EG9A 1C0GS 2FF3A 2KVKA 3CJCG 1T3XA 1T2LA 2MOTA 2D8BA 3FG6A 3CIPG 5KYUA 3EFOB 2MV2A 1NPHA 5DD2A 1ESVS 3FFNA 5L6WC 3TU5B 4KEFA 3FFKA 3CJBG 3A5NS 3EGDB 2VILA 3CI5G 2FH4A 5HVKD 1X67A 1NMDG 1D0NA 1P8XA 5HVKB 1AK6A 1PCXA 5IVUA 1CFYA 5KYXA 5KYWA 1Q8XA 2I2QA 5KYNA 4LIZA 4JD2H 1TMWA 3EFOA 4Z94G 1F7SA 4KEEA 5A1MA 1MDUA 5FAFA 1M2VA 2MP4A 4CBWG 1CNUA 2NUTB 1V6FA 5KYWB 5KYXB 1DEJS 2NUPA 2L72A 1PD0A 1TVJA 3A5LS 2VACA 4PKHB 2LJ8A 1EQYS 4KEDA 1WNJA 3EH1A 1RGIG 1VFQA 1P8ZG 2FH3A 1M2OA 1UDMA 2FH2A 1T44G 1HQZ1 1SVYA 3EGXB 4PKIG 1Q8GA 2VIKA 1C0FS 1D4XG 2FF6G 3EGXA 2HD7A 5KYYA 1H1VG 2QTVA 3L50A 5FAEA 1COFA 1WM4A 4CBXG 1QPVA
chains in the Genus database with same CATH superfamily
4BEX1 4CBUG 3EH2A 2XF1A 1M2VB 1AK7A 1SVRA 1PD1A 2LLFA 3DAWB 2NUTA 3A5OS 1NLVG 1YAGG 1NM1G 1WFSA 4S10C 3Q2BA 5KYYB 1SVQA 1AHQA 2LXXA 2FGHA 5KYUB 1VKKA 2FH1A 4PKGG 3FG7A 1JHWA 1J72A 1KCQA 3EGDA 1YVNG 1M4JA 3A5MS 3EG9B 1T3YA 2XFAA 2W0IA 2NUPB 3EG9A 1C0GS 2FF3A 2KVKA 3CJCG 1T3XA 1T2LA 2MOTA 2D8BA 3FG6A 3CIPG 5KYUA 3EFOB 2MV2A 1NPHA 5DD2A 1ESVS 3FFNA 5L6WC 3TU5B 4KEFA 3FFKA 3CJBG 3A5NS 3EGDB 2VILA 3CI5G 2FH4A 5HVKD 1X67A 1NMDG 1D0NA 1P8XA 5HVKB 1AK6A 1PCXA 5IVUA 1CFYA 5KYXA 5KYWA 1Q8XA 2I2QA 5KYNA 4LIZA 4JD2H 1TMWA 3EFOA 4Z94G 1F7SA 4KEEA 5A1MA 1MDUA 5FAFA 1M2VA 2MP4A 4CBWG 1CNUA 2NUTB 1V6FA 5KYWB 5KYXB 1DEJS 2NUPA 2L72A 1PD0A 1TVJA 3A5LS 2VACA 4PKHB 2LJ8A 3DA7A 1EQYS 4KEDA 1WNJA 3EH1A 1RGIG 1VFQA 1P8ZG 2FH3A 1M2OA 1UDMA 2FH2A 1T44G 1HQZ1 1SVYA 3EGXB 4PKIG 1Q8GA 2VIKA 1C0FS 1D4XG 2FF6G 3EGXA 2HD7A 5KYYA 1H1VG 2QTVA 3L50A 5FAEA 1COFA 1WM4A 4CBXG 1QPVA
chains in the Genus database with same CATH topology
4BEX1 4CBUG 3EH2A 2XF1A 1M2VB 1AK7A 1SVRA 1PD1A 2LLFA 3DAWB 2NUTA 3A5OS 1NLVG 1YAGG 1NM1G 1WFSA 4S10C 3Q2BA 5KYYB 1SVQA 1AHQA 2LXXA 2FGHA 5KYUB 1VKKA 2FH1A 4PKGG 3FG7A 1JHWA 1J72A 1KCQA 3EGDA 1YVNG 1M4JA 3A5MS 3EG9B 1T3YA 2XFAA 2W0IA 2NUPB 3EG9A 1C0GS 2FF3A 2KVKA 3CJCG 1T3XA 1T2LA 2MOTA 2D8BA 3FG6A 3CIPG 5KYUA 3EFOB 2MV2A 1NPHA 5DD2A 1ESVS 3FFNA 5L6WC 3TU5B 4KEFA 3FFKA 3CJBG 3A5NS 3EGDB 2VILA 3CI5G 2FH4A 5HVKD 1X67A 1NMDG 1D0NA 1P8XA 5HVKB 1AK6A 1PCXA 5IVUA 1CFYA 5KYXA 5KYWA 1Q8XA 2I2QA 5KYNA 4LIZA 4JD2H 1TMWA 3EFOA 4Z94G 1F7SA 4KEEA 5A1MA 1MDUA 5FAFA 1M2VA 2MP4A 4CBWG 1CNUA 2NUTB 1V6FA 5KYWB 5KYXB 1DEJS 2NUPA 2L72A 1PD0A 1TVJA 3A5LS 2VACA 4PKHB 2LJ8A 3DA7A 1EQYS 4KEDA 1WNJA 3EH1A 1RGIG 1VFQA 1P8ZG 2FH3A 1M2OA 1UDMA 2FH2A 1T44G 1HQZ1 1SVYA 3EGXB 4PKIG 1Q8GA 2VIKA 1C0FS 1D4XG 2FF6G 3EGXA 2HD7A 5KYYA 1H1VG 2QTVA 3L50A 5FAEA 1COFA 1WM4A 4CBXG 1QPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEX 1;  4CBU G;  3EH2 A;  2XF1 A;  1M2V B;  1AK7 A;  1SVR A;  1PD1 A;  2LLF A;  3DAW B;  2NUT A;  3A5O S;  1NLV G;  1YAG G;  1NM1 G;  1WFS A;  4S10 C;  3Q2B A;  5KYY B;  1SVQ A;  1AHQ A;  2LXX A;  2FGH A;  5KYU B;  1VKK A;  2FH1 A;  4PKG G;  3FG7 A;  1JHW A;  1J72 A;  1KCQ A;  3EGD A;  1YVN G;  1M4J A;  3A5M S;  3EG9 B;  1T3Y A;  2XFA A;  2W0I A;  2NUP B;  3EG9 A;  1C0G S;  2FF3 A;  2KVK A;  3CJC G;  1T3X A;  1T2L A;  2MOT A;  2D8B A;  3FG6 A;  3CIP G;  5KYU A;  3EFO B;  2MV2 A;  1NPH A;  5DD2 A;  1ESV S;  3FFN A;  5L6W C;  3TU5 B;  4KEF A;  3FFK A;  3CJB G;  3A5N S;  3EGD B;  2VIL A;  3CI5 G;  2FH4 A;  5HVK D;  1X67 A;  1NMD G;  1D0N A;  1P8X A;  5HVK B;  1AK6 A;  1PCX A;  5IVU A;  1CFY A;  5KYX A;  5KYW A;  1Q8X A;  2I2Q A;  5KYN A;  4LIZ A;  4JD2 H;  1TMW A;  3EFO A;  4Z94 G;  1F7S A;  4KEE A;  5A1M A;  1MDU A;  5FAF A;  1M2V A;  2MP4 A;  4CBW G;  1CNU A;  2NUT B;  1V6F A;  5KYW B;  5KYX B;  1DEJ S;  2NUP A;  2L72 A;  1PD0 A;  1TVJ A;  3A5L S;  2VAC A;  4PKH B;  2LJ8 A;  1EQY S;  4KED A;  1WNJ A;  3EH1 A;  1RGI G;  1VFQ A;  1P8Z G;  2FH3 A;  1M2O A;  1UDM A;  2FH2 A;  1T44 G;  1HQZ 1;  1SVY A;  3EGX B;  4PKI G;  1Q8G A;  2VIK A;  1C0F S;  1D4X G;  2FF6 G;  3EGX A;  2HD7 A;  5KYY A;  1H1V G;  2QTV A;  3L50 A;  5FAE A;  1COF A;  1WM4 A;  4CBX G;  1QPV A; 
#chains in the Genus database with same CATH topology
 4BEX 1;  4CBU G;  3EH2 A;  2XF1 A;  1M2V B;  1AK7 A;  1SVR A;  1PD1 A;  2LLF A;  3DAW B;  2NUT A;  3A5O S;  1NLV G;  1YAG G;  1NM1 G;  1WFS A;  4S10 C;  3Q2B A;  5KYY B;  1SVQ A;  1AHQ A;  2LXX A;  2FGH A;  5KYU B;  1VKK A;  2FH1 A;  4PKG G;  3FG7 A;  1JHW A;  1J72 A;  1KCQ A;  3EGD A;  1YVN G;  1M4J A;  3A5M S;  3EG9 B;  1T3Y A;  2XFA A;  2W0I A;  2NUP B;  3EG9 A;  1C0G S;  2FF3 A;  2KVK A;  3CJC G;  1T3X A;  1T2L A;  2MOT A;  2D8B A;  3FG6 A;  3CIP G;  5KYU A;  3EFO B;  2MV2 A;  1NPH A;  5DD2 A;  1ESV S;  3FFN A;  5L6W C;  3TU5 B;  4KEF A;  3FFK A;  3CJB G;  3A5N S;  3EGD B;  2VIL A;  3CI5 G;  2FH4 A;  5HVK D;  1X67 A;  1NMD G;  1D0N A;  1P8X A;  5HVK B;  1AK6 A;  1PCX A;  5IVU A;  1CFY A;  5KYX A;  5KYW A;  1Q8X A;  2I2Q A;  5KYN A;  4LIZ A;  4JD2 H;  1TMW A;  3EFO A;  4Z94 G;  1F7S A;  4KEE A;  5A1M A;  1MDU A;  5FAF A;  1M2V A;  2MP4 A;  4CBW G;  1CNU A;  2NUT B;  1V6F A;  5KYW B;  5KYX B;  1DEJ S;  2NUP A;  2L72 A;  1PD0 A;  1TVJ A;  3A5L S;  2VAC A;  4PKH B;  2LJ8 A;  3DA7 A;  1EQY S;  4KED A;  1WNJ A;  3EH1 A;  1RGI G;  1VFQ A;  1P8Z G;  2FH3 A;  1M2O A;  1UDM A;  2FH2 A;  1T44 G;  1HQZ 1;  1SVY A;  3EGX B;  4PKI G;  1Q8G A;  2VIK A;  1C0F S;  1D4X G;  2FF6 G;  3EGX A;  2HD7 A;  5KYY A;  1H1V G;  2QTV A;  3L50 A;  5FAE A;  1COF A;  1WM4 A;  4CBX G;  1QPV A; 
#chains in the Genus database with same CATH homology
 4BEX 1;  4CBU G;  3EH2 A;  2XF1 A;  1M2V B;  1AK7 A;  1SVR A;  1PD1 A;  2LLF A;  3DAW B;  2NUT A;  3A5O S;  1NLV G;  1YAG G;  1NM1 G;  1WFS A;  4S10 C;  3Q2B A;  5KYY B;  1SVQ A;  1AHQ A;  2LXX A;  2FGH A;  5KYU B;  1VKK A;  2FH1 A;  4PKG G;  3FG7 A;  1JHW A;  1J72 A;  1KCQ A;  3EGD A;  1YVN G;  1M4J A;  3A5M S;  3EG9 B;  1T3Y A;  2XFA A;  2W0I A;  2NUP B;  3EG9 A;  1C0G S;  2FF3 A;  2KVK A;  3CJC G;  1T3X A;  1T2L A;  2MOT A;  2D8B A;  3FG6 A;  3CIP G;  5KYU A;  3EFO B;  2MV2 A;  1NPH A;  5DD2 A;  1ESV S;  3FFN A;  5L6W C;  3TU5 B;  4KEF A;  3FFK A;  3CJB G;  3A5N S;  3EGD B;  2VIL A;  3CI5 G;  2FH4 A;  5HVK D;  1X67 A;  1NMD G;  1D0N A;  1P8X A;  5HVK B;  1AK6 A;  1PCX A;  5IVU A;  1CFY A;  5KYX A;  5KYW A;  1Q8X A;  2I2Q A;  5KYN A;  4LIZ A;  4JD2 H;  1TMW A;  3EFO A;  4Z94 G;  1F7S A;  4KEE A;  5A1M A;  1MDU A;  5FAF A;  1M2V A;  2MP4 A;  4CBW G;  1CNU A;  2NUT B;  1V6F A;  5KYW B;  5KYX B;  1DEJ S;  2NUP A;  2L72 A;  1PD0 A;  1TVJ A;  3A5L S;  2VAC A;  4PKH B;  2LJ8 A;  3DA7 A;  1EQY S;  4KED A;  1WNJ A;  3EH1 A;  1RGI G;  1VFQ A;  1P8Z G;  2FH3 A;  1M2O A;  1UDM A;  2FH2 A;  1T44 G;  1HQZ 1;  1SVY A;  3EGX B;  4PKI G;  1Q8G A;  2VIK A;  1C0F S;  1D4X G;  2FF6 G;  3EGX A;  2HD7 A;  5KYY A;  1H1V G;  2QTV A;  3L50 A;  5FAE A;  1COF A;  1WM4 A;  4CBX G;  1QPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...