4KEDA

Crystal structure of cofilin mutant (cof1-157p)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
131
Chain Sequence
VAVADESLTAFNDLKLGKKYKFILFGLNDAKTEIVVKETSTDPSYDAFLEKLPENDCLYAIYDFEYEINGKRSKIVFFTWSPDTAPVRSKMVYASSKDALRRALNGVSTDVQGTDFSEVSYDSVLEDVSRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cofilin Mutant (cof1-157p)
rcsb
source organism Saccharomyces cerevisiae
molecule tags Actin binding protein
molecule keywords Cofilin
total genus 35
structure length 131
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4kedA00
3FFKA 1MDUA 4LIZA 4BEX1 3EG9B 5IVUA 2MV2A 1J72A 1PD1A 4KEDA 2FH2A 1RGIG 5DD2A 2D8BA 1C0GS 5FAFA 5KYYA 2QTVA 1YAGG 3FG7A 1VKKA 1T3YA 1D0NA 5KYYB 1PCXA 1KCQA 1UDMA 2LJ8A 3FFNA 1QPVA 3EG9A 3CJBG 2FH4A 1H1VG 5HVKD 2FF3A 4JD2H 4PKHB 3TU5B 4Z94G 4CBWG 3EH2A 2W0IA 1HQZ1 5KYNA 4KEEA 2VIKA 2L72A 1COFA 1NLVG 3A5MS 3CJCG 1C0FS 2MP4A 4PKGG 5KYXB 1X67A 1WNJA 5L6WC 1V6FA 2HD7A 1M2VB 5HVKB 2XFAA 3A5NS 1SVYA 1D4XG 1CNUA 3CI5G 1P8XA 2KVKA 3EFOB 2NUTB 1M2OA 2NUPA 1Q8GA 1SVQA 1M4JA 3DAWB 2NUPB 1P8ZG 2XF1A 1AK7A 4CBUG 3CIPG 3EH1A 1NPHA 5KYWB 5KYXA 1NMDG 1WM4A 1M2VA 2NUTA 4S10C 3A5LS 1SVRA 1T2LA 4CBXG 1EQYS 1F7SA 1Q8XA 2FH1A 2MOTA 5KYUA 3EGDA 1AK6A 3EFOA 1T44G 3EGXB 2FF6G 2FH3A 3EGDB 1PD0A 3EGXA 3FG6A 1NM1G 2FGHA 2VILA 1JHWA 1CFYA 1YVNG 1ESVS 1T3XA 3Q2BA 5A1MA 1AHQA 5FAEA 2LLFA 1TMWA 2VACA 1TVJA 1WFSA 4PKIG 1DEJS 1VFQA 5KYWA 2I2QA 4KEFA 2LXXA 3L50A 5KYUB 3A5OS
chains in the Genus database with same CATH superfamily
3FFKA 1MDUA 4LIZA 4BEX1 3EG9B 5IVUA 2MV2A 1J72A 1PD1A 4KEDA 2FH2A 1RGIG 5DD2A 2D8BA 1C0GS 5FAFA 5KYYA 2QTVA 1YAGG 3FG7A 1VKKA 1T3YA 1D0NA 5KYYB 1PCXA 1KCQA 1UDMA 2LJ8A 3FFNA 1QPVA 3EG9A 3CJBG 2FH4A 1H1VG 5HVKD 2FF3A 4JD2H 4PKHB 3TU5B 4Z94G 4CBWG 3EH2A 2W0IA 1HQZ1 5KYNA 4KEEA 2VIKA 2L72A 1COFA 1NLVG 3A5MS 3CJCG 1C0FS 2MP4A 4PKGG 5KYXB 1X67A 1WNJA 5L6WC 1V6FA 2HD7A 1M2VB 5HVKB 2XFAA 3A5NS 1SVYA 1D4XG 1CNUA 3CI5G 1P8XA 2KVKA 3EFOB 2NUTB 1M2OA 2NUPA 1Q8GA 1SVQA 1M4JA 3DAWB 2NUPB 1P8ZG 2XF1A 1AK7A 4CBUG 3CIPG 3EH1A 1NPHA 5KYWB 5KYXA 1NMDG 1WM4A 1M2VA 2NUTA 4S10C 3A5LS 1SVRA 1T2LA 3DA7A 4CBXG 1EQYS 1F7SA 1Q8XA 2FH1A 2MOTA 5KYUA 3EGDA 1AK6A 3EFOA 1T44G 3EGXB 2FF6G 2FH3A 3EGDB 1PD0A 3EGXA 3FG6A 1NM1G 2FGHA 2VILA 1JHWA 1CFYA 1YVNG 1ESVS 1T3XA 3Q2BA 5A1MA 1AHQA 5FAEA 2LLFA 1TMWA 2VACA 1TVJA 1WFSA 4PKIG 1DEJS 1VFQA 5KYWA 2I2QA 4KEFA 2LXXA 3L50A 5KYUB 3A5OS
chains in the Genus database with same CATH topology
3FFKA 1MDUA 4LIZA 4BEX1 3EG9B 5IVUA 2MV2A 1J72A 1PD1A 4KEDA 2FH2A 1RGIG 5DD2A 2D8BA 1C0GS 5FAFA 5KYYA 2QTVA 1YAGG 3FG7A 1VKKA 1T3YA 1D0NA 5KYYB 1PCXA 1KCQA 1UDMA 2LJ8A 3FFNA 1QPVA 3EG9A 3CJBG 2FH4A 1H1VG 5HVKD 2FF3A 4JD2H 4PKHB 3TU5B 4Z94G 4CBWG 3EH2A 2W0IA 1HQZ1 5KYNA 4KEEA 2VIKA 2L72A 1COFA 1NLVG 3A5MS 3CJCG 1C0FS 2MP4A 4PKGG 5KYXB 1X67A 1WNJA 5L6WC 1V6FA 2HD7A 1M2VB 5HVKB 2XFAA 3A5NS 1SVYA 1D4XG 1CNUA 3CI5G 1P8XA 2KVKA 3EFOB 2NUTB 1M2OA 2NUPA 1Q8GA 1SVQA 1M4JA 3DAWB 2NUPB 1P8ZG 2XF1A 1AK7A 4CBUG 3CIPG 3EH1A 1NPHA 5KYWB 5KYXA 1NMDG 1WM4A 1M2VA 2NUTA 4S10C 3A5LS 1SVRA 1T2LA 3DA7A 4CBXG 1EQYS 1F7SA 1Q8XA 2FH1A 2MOTA 5KYUA 3EGDA 1AK6A 3EFOA 1T44G 3EGXB 2FF6G 2FH3A 3EGDB 1PD0A 3EGXA 3FG6A 1NM1G 2FGHA 2VILA 1JHWA 1CFYA 1YVNG 1ESVS 1T3XA 3Q2BA 5A1MA 1AHQA 5FAEA 2LLFA 1TMWA 2VACA 1TVJA 1WFSA 4PKIG 1DEJS 1VFQA 5KYWA 2I2QA 4KEFA 2LXXA 3L50A 5KYUB 3A5OS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FFK A;  1MDU A;  4LIZ A;  4BEX 1;  3EG9 B;  5IVU A;  2MV2 A;  1J72 A;  1PD1 A;  4KED A;  2FH2 A;  1RGI G;  5DD2 A;  2D8B A;  1C0G S;  5FAF A;  5KYY A;  2QTV A;  1YAG G;  3FG7 A;  1VKK A;  1T3Y A;  1D0N A;  5KYY B;  1PCX A;  1KCQ A;  1UDM A;  2LJ8 A;  3FFN A;  1QPV A;  3EG9 A;  3CJB G;  2FH4 A;  1H1V G;  5HVK D;  2FF3 A;  4JD2 H;  4PKH B;  3TU5 B;  4Z94 G;  4CBW G;  3EH2 A;  2W0I A;  1HQZ 1;  5KYN A;  4KEE A;  2VIK A;  2L72 A;  1COF A;  1NLV G;  3A5M S;  3CJC G;  1C0F S;  2MP4 A;  4PKG G;  5KYX B;  1X67 A;  1WNJ A;  5L6W C;  1V6F A;  2HD7 A;  1M2V B;  5HVK B;  2XFA A;  3A5N S;  1SVY A;  1D4X G;  1CNU A;  3CI5 G;  1P8X A;  2KVK A;  3EFO B;  2NUT B;  1M2O A;  2NUP A;  1Q8G A;  1SVQ A;  1M4J A;  3DAW B;  2NUP B;  1P8Z G;  2XF1 A;  1AK7 A;  4CBU G;  3CIP G;  3EH1 A;  1NPH A;  5KYW B;  5KYX A;  1NMD G;  1WM4 A;  1M2V A;  2NUT A;  4S10 C;  3A5L S;  1SVR A;  1T2L A;  4CBX G;  1EQY S;  1F7S A;  1Q8X A;  2FH1 A;  2MOT A;  5KYU A;  3EGD A;  1AK6 A;  3EFO A;  1T44 G;  3EGX B;  2FF6 G;  2FH3 A;  3EGD B;  1PD0 A;  3EGX A;  3FG6 A;  1NM1 G;  2FGH A;  2VIL A;  1JHW A;  1CFY A;  1YVN G;  1ESV S;  1T3X A;  3Q2B A;  5A1M A;  1AHQ A;  5FAE A;  2LLF A;  1TMW A;  2VAC A;  1TVJ A;  1WFS A;  4PKI G;  1DEJ S;  1VFQ A;  5KYW A;  2I2Q A;  4KEF A;  2LXX A;  3L50 A;  5KYU B;  3A5O S; 
#chains in the Genus database with same CATH topology
 3FFK A;  1MDU A;  4LIZ A;  4BEX 1;  3EG9 B;  5IVU A;  2MV2 A;  1J72 A;  1PD1 A;  4KED A;  2FH2 A;  1RGI G;  5DD2 A;  2D8B A;  1C0G S;  5FAF A;  5KYY A;  2QTV A;  1YAG G;  3FG7 A;  1VKK A;  1T3Y A;  1D0N A;  5KYY B;  1PCX A;  1KCQ A;  1UDM A;  2LJ8 A;  3FFN A;  1QPV A;  3EG9 A;  3CJB G;  2FH4 A;  1H1V G;  5HVK D;  2FF3 A;  4JD2 H;  4PKH B;  3TU5 B;  4Z94 G;  4CBW G;  3EH2 A;  2W0I A;  1HQZ 1;  5KYN A;  4KEE A;  2VIK A;  2L72 A;  1COF A;  1NLV G;  3A5M S;  3CJC G;  1C0F S;  2MP4 A;  4PKG G;  5KYX B;  1X67 A;  1WNJ A;  5L6W C;  1V6F A;  2HD7 A;  1M2V B;  5HVK B;  2XFA A;  3A5N S;  1SVY A;  1D4X G;  1CNU A;  3CI5 G;  1P8X A;  2KVK A;  3EFO B;  2NUT B;  1M2O A;  2NUP A;  1Q8G A;  1SVQ A;  1M4J A;  3DAW B;  2NUP B;  1P8Z G;  2XF1 A;  1AK7 A;  4CBU G;  3CIP G;  3EH1 A;  1NPH A;  5KYW B;  5KYX A;  1NMD G;  1WM4 A;  1M2V A;  2NUT A;  4S10 C;  3A5L S;  1SVR A;  1T2L A;  3DA7 A;  4CBX G;  1EQY S;  1F7S A;  1Q8X A;  2FH1 A;  2MOT A;  5KYU A;  3EGD A;  1AK6 A;  3EFO A;  1T44 G;  3EGX B;  2FF6 G;  2FH3 A;  3EGD B;  1PD0 A;  3EGX A;  3FG6 A;  1NM1 G;  2FGH A;  2VIL A;  1JHW A;  1CFY A;  1YVN G;  1ESV S;  1T3X A;  3Q2B A;  5A1M A;  1AHQ A;  5FAE A;  2LLF A;  1TMW A;  2VAC A;  1TVJ A;  1WFS A;  4PKI G;  1DEJ S;  1VFQ A;  5KYW A;  2I2Q A;  4KEF A;  2LXX A;  3L50 A;  5KYU B;  3A5O S; 
#chains in the Genus database with same CATH homology
 3FFK A;  1MDU A;  4LIZ A;  4BEX 1;  3EG9 B;  5IVU A;  2MV2 A;  1J72 A;  1PD1 A;  4KED A;  2FH2 A;  1RGI G;  5DD2 A;  2D8B A;  1C0G S;  5FAF A;  5KYY A;  2QTV A;  1YAG G;  3FG7 A;  1VKK A;  1T3Y A;  1D0N A;  5KYY B;  1PCX A;  1KCQ A;  1UDM A;  2LJ8 A;  3FFN A;  1QPV A;  3EG9 A;  3CJB G;  2FH4 A;  1H1V G;  5HVK D;  2FF3 A;  4JD2 H;  4PKH B;  3TU5 B;  4Z94 G;  4CBW G;  3EH2 A;  2W0I A;  1HQZ 1;  5KYN A;  4KEE A;  2VIK A;  2L72 A;  1COF A;  1NLV G;  3A5M S;  3CJC G;  1C0F S;  2MP4 A;  4PKG G;  5KYX B;  1X67 A;  1WNJ A;  5L6W C;  1V6F A;  2HD7 A;  1M2V B;  5HVK B;  2XFA A;  3A5N S;  1SVY A;  1D4X G;  1CNU A;  3CI5 G;  1P8X A;  2KVK A;  3EFO B;  2NUT B;  1M2O A;  2NUP A;  1Q8G A;  1SVQ A;  1M4J A;  3DAW B;  2NUP B;  1P8Z G;  2XF1 A;  1AK7 A;  4CBU G;  3CIP G;  3EH1 A;  1NPH A;  5KYW B;  5KYX A;  1NMD G;  1WM4 A;  1M2V A;  2NUT A;  4S10 C;  3A5L S;  1SVR A;  1T2L A;  3DA7 A;  4CBX G;  1EQY S;  1F7S A;  1Q8X A;  2FH1 A;  2MOT A;  5KYU A;  3EGD A;  1AK6 A;  3EFO A;  1T44 G;  3EGX B;  2FF6 G;  2FH3 A;  3EGD B;  1PD0 A;  3EGX A;  3FG6 A;  1NM1 G;  2FGH A;  2VIL A;  1JHW A;  1CFY A;  1YVN G;  1ESV S;  1T3X A;  3Q2B A;  5A1M A;  1AHQ A;  5FAE A;  2LLF A;  1TMW A;  2VAC A;  1TVJ A;  1WFS A;  4PKI G;  1DEJ S;  1VFQ A;  5KYW A;  2I2Q A;  4KEF A;  2LXX A;  3L50 A;  5KYU B;  3A5O S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...