1TVJA

Solution structure of chick cofilin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
166
structure length
166
Chain Sequence
MASGVTVNDEVIKVFNDMKVRKSSTPEEIKKRKKAVLFCLSDDKKQIIVEEAKQILVGDIGDTVEDPYTAFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Study of the Molecular Basis for Phosphoinositide Regulation of the Cofilin-Actin Interactions.
rcsb
source organism Gallus gallus
molecule tags Actin-binding protein
molecule keywords Cofilin
total genus 35
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1tvjA00
2VIKA 1CNUA 3DAWB 1WFSA 1RGIG 1P8ZG 4BEX1 3FFKA 2FH1A 2NUTA 2FH4A 3EG9B 1M4JA 1EQYS 4KEEA 4KEDA 3EGXB 3CJCG 4JD2H 3CJBG 1KCQA 1SVQA 4LIZA 2W0IA 1D4XG 1SVRA 3FG7A 2LLFA 3TU5B 3A5LS 2XFAA 5DD2A 3A5MS 3CI5G 1D0NA 1F7SA 5KYUA 5A1MA 1PD1A 1NM1G 1P8XA 1AK6A 2XF1A 1J72A 4PKHB 2L72A 1COFA 1YAGG 5KYNA 3EGXA 5IVUA 1H1VG 2KVKA 1MDUA 3EH1A 3L50A 2FH2A 2NUPB 3CIPG 1M2VB 1M2OA 2NUTB 2HD7A 2MP4A 1CFYA 1AHQA 3FFNA 4CBWG 1TVJA 1WNJA 1VFQA 3Q2BA 4PKIG 1M2VA 5FAFA 2D8BA 1C0GS 2FF3A 5KYYB 2QTVA 1VKKA 1NPHA 1TMWA 5KYUB 1T3XA 1Q8XA 2FH3A 2FF6G 5HVKD 2LXXA 2VILA 3EGDB 2I2QA 2LJ8A 5KYWB 5KYXA 5KYYA 3EG9A 2NUPA 1PD0A 1NMDG 4CBXG 3A5NS 1AK7A 1T2LA 5FAEA 3EFOA 4Z94G 1UDMA 1ESVS 2VACA 5L6WC 1YVNG 5KYWA 1Q8GA 1SVYA 1T3YA 3FG6A 1WM4A 1JHWA 2FGHA 1DEJS 3EH2A 2MV2A 1C0FS 1T44G 4KEFA 1PCXA 1X67A 3EFOB 1NLVG 5HVKB 4CBUG 3A5OS 4S10C 2MOTA 4PKGG 1V6FA 1HQZ1 5KYXB 1QPVA 3EGDA
chains in the Genus database with same CATH superfamily
2VIKA 1CNUA 3DAWB 1WFSA 1RGIG 1P8ZG 4BEX1 3FFKA 2FH1A 2NUTA 2FH4A 3EG9B 1M4JA 1EQYS 4KEEA 4KEDA 3EGXB 3CJCG 4JD2H 3CJBG 1KCQA 1SVQA 4LIZA 2W0IA 1D4XG 1SVRA 3FG7A 2LLFA 3TU5B 3A5LS 2XFAA 5DD2A 3A5MS 3CI5G 1D0NA 1F7SA 5KYUA 5A1MA 1PD1A 3DA7A 1NM1G 1P8XA 1AK6A 2XF1A 1J72A 4PKHB 2L72A 1COFA 1YAGG 5KYNA 3EGXA 5IVUA 1H1VG 2KVKA 1MDUA 3EH1A 3L50A 2FH2A 2NUPB 3CIPG 1M2VB 1M2OA 2NUTB 2HD7A 2MP4A 1CFYA 1AHQA 3FFNA 4CBWG 1TVJA 1WNJA 1VFQA 3Q2BA 4PKIG 1M2VA 5FAFA 2D8BA 1C0GS 2FF3A 5KYYB 2QTVA 1VKKA 1NPHA 1TMWA 5KYUB 1T3XA 1Q8XA 2FH3A 2FF6G 5HVKD 2LXXA 2VILA 3EGDB 2I2QA 2LJ8A 5KYWB 5KYXA 5KYYA 3EG9A 2NUPA 1PD0A 1NMDG 4CBXG 3A5NS 1AK7A 1T2LA 5FAEA 3EFOA 4Z94G 1UDMA 1ESVS 2VACA 5L6WC 1YVNG 5KYWA 1Q8GA 1SVYA 1T3YA 3FG6A 1WM4A 1JHWA 2FGHA 1DEJS 3EH2A 2MV2A 1C0FS 1T44G 4KEFA 1PCXA 1X67A 3EFOB 1NLVG 5HVKB 4CBUG 3A5OS 4S10C 2MOTA 4PKGG 1V6FA 1HQZ1 5KYXB 1QPVA 3EGDA
chains in the Genus database with same CATH topology
2VIKA 1CNUA 3DAWB 1WFSA 1RGIG 1P8ZG 4BEX1 3FFKA 2FH1A 2NUTA 2FH4A 3EG9B 1M4JA 1EQYS 4KEEA 4KEDA 3EGXB 3CJCG 4JD2H 3CJBG 1KCQA 1SVQA 4LIZA 2W0IA 1D4XG 1SVRA 3FG7A 2LLFA 3TU5B 3A5LS 2XFAA 5DD2A 3A5MS 3CI5G 1D0NA 1F7SA 5KYUA 5A1MA 1PD1A 3DA7A 1NM1G 1P8XA 1AK6A 2XF1A 1J72A 4PKHB 2L72A 1COFA 1YAGG 5KYNA 3EGXA 5IVUA 1H1VG 2KVKA 1MDUA 3EH1A 3L50A 2FH2A 2NUPB 3CIPG 1M2VB 1M2OA 2NUTB 2HD7A 2MP4A 1CFYA 1AHQA 3FFNA 4CBWG 1TVJA 1WNJA 1VFQA 3Q2BA 4PKIG 1M2VA 5FAFA 2D8BA 1C0GS 2FF3A 5KYYB 2QTVA 1VKKA 1NPHA 1TMWA 5KYUB 1T3XA 1Q8XA 2FH3A 2FF6G 5HVKD 2LXXA 2VILA 3EGDB 2I2QA 2LJ8A 5KYWB 5KYXA 5KYYA 3EG9A 2NUPA 1PD0A 1NMDG 4CBXG 3A5NS 1AK7A 1T2LA 5FAEA 3EFOA 4Z94G 1UDMA 1ESVS 2VACA 5L6WC 1YVNG 5KYWA 1Q8GA 1SVYA 1T3YA 3FG6A 1WM4A 1JHWA 2FGHA 1DEJS 3EH2A 2MV2A 1C0FS 1T44G 4KEFA 1PCXA 1X67A 3EFOB 1NLVG 5HVKB 4CBUG 3A5OS 4S10C 2MOTA 4PKGG 1V6FA 1HQZ1 5KYXB 1QPVA 3EGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VIK A;  1CNU A;  3DAW B;  1WFS A;  1RGI G;  1P8Z G;  4BEX 1;  3FFK A;  2FH1 A;  2NUT A;  2FH4 A;  3EG9 B;  1M4J A;  1EQY S;  4KEE A;  4KED A;  3EGX B;  3CJC G;  4JD2 H;  3CJB G;  1KCQ A;  1SVQ A;  4LIZ A;  2W0I A;  1D4X G;  1SVR A;  3FG7 A;  2LLF A;  3TU5 B;  3A5L S;  2XFA A;  5DD2 A;  3A5M S;  3CI5 G;  1D0N A;  1F7S A;  5KYU A;  5A1M A;  1PD1 A;  1NM1 G;  1P8X A;  1AK6 A;  2XF1 A;  1J72 A;  4PKH B;  2L72 A;  1COF A;  1YAG G;  5KYN A;  3EGX A;  5IVU A;  1H1V G;  2KVK A;  1MDU A;  3EH1 A;  3L50 A;  2FH2 A;  2NUP B;  3CIP G;  1M2V B;  1M2O A;  2NUT B;  2HD7 A;  2MP4 A;  1CFY A;  1AHQ A;  3FFN A;  4CBW G;  1TVJ A;  1WNJ A;  1VFQ A;  3Q2B A;  4PKI G;  1M2V A;  5FAF A;  2D8B A;  1C0G S;  2FF3 A;  5KYY B;  2QTV A;  1VKK A;  1NPH A;  1TMW A;  5KYU B;  1T3X A;  1Q8X A;  2FH3 A;  2FF6 G;  5HVK D;  2LXX A;  2VIL A;  3EGD B;  2I2Q A;  2LJ8 A;  5KYW B;  5KYX A;  5KYY A;  3EG9 A;  2NUP A;  1PD0 A;  1NMD G;  4CBX G;  3A5N S;  1AK7 A;  1T2L A;  5FAE A;  3EFO A;  4Z94 G;  1UDM A;  1ESV S;  2VAC A;  5L6W C;  1YVN G;  5KYW A;  1Q8G A;  1SVY A;  1T3Y A;  3FG6 A;  1WM4 A;  1JHW A;  2FGH A;  1DEJ S;  3EH2 A;  2MV2 A;  1C0F S;  1T44 G;  4KEF A;  1PCX A;  1X67 A;  3EFO B;  1NLV G;  5HVK B;  4CBU G;  3A5O S;  4S10 C;  2MOT A;  4PKG G;  1V6F A;  1HQZ 1;  5KYX B;  1QPV A;  3EGD A; 
#chains in the Genus database with same CATH topology
 2VIK A;  1CNU A;  3DAW B;  1WFS A;  1RGI G;  1P8Z G;  4BEX 1;  3FFK A;  2FH1 A;  2NUT A;  2FH4 A;  3EG9 B;  1M4J A;  1EQY S;  4KEE A;  4KED A;  3EGX B;  3CJC G;  4JD2 H;  3CJB G;  1KCQ A;  1SVQ A;  4LIZ A;  2W0I A;  1D4X G;  1SVR A;  3FG7 A;  2LLF A;  3TU5 B;  3A5L S;  2XFA A;  5DD2 A;  3A5M S;  3CI5 G;  1D0N A;  1F7S A;  5KYU A;  5A1M A;  1PD1 A;  3DA7 A;  1NM1 G;  1P8X A;  1AK6 A;  2XF1 A;  1J72 A;  4PKH B;  2L72 A;  1COF A;  1YAG G;  5KYN A;  3EGX A;  5IVU A;  1H1V G;  2KVK A;  1MDU A;  3EH1 A;  3L50 A;  2FH2 A;  2NUP B;  3CIP G;  1M2V B;  1M2O A;  2NUT B;  2HD7 A;  2MP4 A;  1CFY A;  1AHQ A;  3FFN A;  4CBW G;  1TVJ A;  1WNJ A;  1VFQ A;  3Q2B A;  4PKI G;  1M2V A;  5FAF A;  2D8B A;  1C0G S;  2FF3 A;  5KYY B;  2QTV A;  1VKK A;  1NPH A;  1TMW A;  5KYU B;  1T3X A;  1Q8X A;  2FH3 A;  2FF6 G;  5HVK D;  2LXX A;  2VIL A;  3EGD B;  2I2Q A;  2LJ8 A;  5KYW B;  5KYX A;  5KYY A;  3EG9 A;  2NUP A;  1PD0 A;  1NMD G;  4CBX G;  3A5N S;  1AK7 A;  1T2L A;  5FAE A;  3EFO A;  4Z94 G;  1UDM A;  1ESV S;  2VAC A;  5L6W C;  1YVN G;  5KYW A;  1Q8G A;  1SVY A;  1T3Y A;  3FG6 A;  1WM4 A;  1JHW A;  2FGH A;  1DEJ S;  3EH2 A;  2MV2 A;  1C0F S;  1T44 G;  4KEF A;  1PCX A;  1X67 A;  3EFO B;  1NLV G;  5HVK B;  4CBU G;  3A5O S;  4S10 C;  2MOT A;  4PKG G;  1V6F A;  1HQZ 1;  5KYX B;  1QPV A;  3EGD A; 
#chains in the Genus database with same CATH homology
 2VIK A;  1CNU A;  3DAW B;  1WFS A;  1RGI G;  1P8Z G;  4BEX 1;  3FFK A;  2FH1 A;  2NUT A;  2FH4 A;  3EG9 B;  1M4J A;  1EQY S;  4KEE A;  4KED A;  3EGX B;  3CJC G;  4JD2 H;  3CJB G;  1KCQ A;  1SVQ A;  4LIZ A;  2W0I A;  1D4X G;  1SVR A;  3FG7 A;  2LLF A;  3TU5 B;  3A5L S;  2XFA A;  5DD2 A;  3A5M S;  3CI5 G;  1D0N A;  1F7S A;  5KYU A;  5A1M A;  1PD1 A;  3DA7 A;  1NM1 G;  1P8X A;  1AK6 A;  2XF1 A;  1J72 A;  4PKH B;  2L72 A;  1COF A;  1YAG G;  5KYN A;  3EGX A;  5IVU A;  1H1V G;  2KVK A;  1MDU A;  3EH1 A;  3L50 A;  2FH2 A;  2NUP B;  3CIP G;  1M2V B;  1M2O A;  2NUT B;  2HD7 A;  2MP4 A;  1CFY A;  1AHQ A;  3FFN A;  4CBW G;  1TVJ A;  1WNJ A;  1VFQ A;  3Q2B A;  4PKI G;  1M2V A;  5FAF A;  2D8B A;  1C0G S;  2FF3 A;  5KYY B;  2QTV A;  1VKK A;  1NPH A;  1TMW A;  5KYU B;  1T3X A;  1Q8X A;  2FH3 A;  2FF6 G;  5HVK D;  2LXX A;  2VIL A;  3EGD B;  2I2Q A;  2LJ8 A;  5KYW B;  5KYX A;  5KYY A;  3EG9 A;  2NUP A;  1PD0 A;  1NMD G;  4CBX G;  3A5N S;  1AK7 A;  1T2L A;  5FAE A;  3EFO A;  4Z94 G;  1UDM A;  1ESV S;  2VAC A;  5L6W C;  1YVN G;  5KYW A;  1Q8G A;  1SVY A;  1T3Y A;  3FG6 A;  1WM4 A;  1JHW A;  2FGH A;  1DEJ S;  3EH2 A;  2MV2 A;  1C0F S;  1T44 G;  4KEF A;  1PCX A;  1X67 A;  3EFO B;  1NLV G;  5HVK B;  4CBU G;  3A5O S;  4S10 C;  2MOT A;  4PKG G;  1V6F A;  1HQZ 1;  5KYX B;  1QPV A;  3EGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...