5A1MA

Crystal structure of calcium-bound human adseverin domain a3
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
KMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKDANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Calcium-Controlled Conformational Choreography in the N-Terminal Half of Adseverin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Actin-binding protein
molecule keywords ADSEVERIN
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 5a1mA00
1VFQA 2MV2A 3CJCG 2FF6G 1NM1G 1YAGG 1HQZ1 3A5NS 1MDUA 1D4XG 1P8ZG 2NUPA 3EGDB 1T3YA 3FG7A 5KYUB 5KYYB 5L6WC 2QTVA 5HVKD 1AHQA 3EH2A 1UDMA 1SVRA 1V6FA 1T3XA 5FAFA 1TVJA 5KYYA 5KYWA 1EQYS 1AK6A 1KCQA 1M2VA 5IVUA 2XF1A 1T44G 1SVYA 1NLVG 2FGHA 3EGDA 1M2VB 1NMDG 1WM4A 3A5LS 3FG6A 2I2QA 3A5MS 3EFOB 1JHWA 1ESVS 2FF3A 4JD2H 1NPHA 2W0IA 1TMWA 1H1VG 5KYWB 1PD1A 1J72A 1Q8GA 3CI5G 2NUPB 4Z94G 5KYUA 3EFOA 1YVNG 1AK7A 5A1MA 2LLFA 4BEX1 1PCXA 2VIKA 2LXXA 1T2LA 1CFYA 3A5OS 1D0NA 1Q8XA 1X67A 4KEDA 1RGIG 1VKKA 3EGXA 3TU5B 1C0FS 5KYXB 3CJBG 4S10C 2HD7A 2L72A 1M4JA 4CBUG 3DAWB 2FH1A 3EG9A 1M2OA 3L50A 1WNJA 1SVQA 2VILA 3EH1A 3Q2BA 4LIZA 2FH2A 2FH4A 5FAEA 3FFNA 2NUTB 2MOTA 1PD0A 4CBWG 3EG9B 2FH3A 2NUTA 1DEJS 1COFA 4KEEA 5DD2A 4KEFA 2XFAA 1QPVA 2VACA 2D8BA 4PKGG 2LJ8A 3EGXB 4PKIG 1F7SA 4CBXG 3CIPG 2MP4A 5HVKB 1P8XA 5KYNA 1CNUA 1WFSA 1C0GS 5KYXA 3FFKA 2KVKA 4PKHB
chains in the Genus database with same CATH superfamily
1VFQA 2MV2A 3CJCG 2FF6G 1NM1G 1YAGG 1HQZ1 3A5NS 1MDUA 1D4XG 1P8ZG 2NUPA 3EGDB 1T3YA 3FG7A 5KYUB 5KYYB 5L6WC 2QTVA 5HVKD 1AHQA 3EH2A 1UDMA 1SVRA 1V6FA 1T3XA 5FAFA 1TVJA 5KYYA 5KYWA 1EQYS 1AK6A 1KCQA 1M2VA 5IVUA 2XF1A 1T44G 1SVYA 1NLVG 2FGHA 3EGDA 1M2VB 1NMDG 1WM4A 3A5LS 3FG6A 2I2QA 3A5MS 3EFOB 1JHWA 1ESVS 2FF3A 4JD2H 1NPHA 2W0IA 1TMWA 1H1VG 5KYWB 3DA7A 1PD1A 1J72A 1Q8GA 3CI5G 2NUPB 4Z94G 5KYUA 3EFOA 1YVNG 1AK7A 5A1MA 2LLFA 4BEX1 1PCXA 2VIKA 2LXXA 1T2LA 1CFYA 3A5OS 1D0NA 1Q8XA 1X67A 4KEDA 1RGIG 1VKKA 3EGXA 3TU5B 1C0FS 5KYXB 3CJBG 4S10C 2HD7A 2L72A 1M4JA 4CBUG 3DAWB 2FH1A 3EG9A 1M2OA 3L50A 1WNJA 1SVQA 2VILA 3EH1A 3Q2BA 4LIZA 2FH2A 2FH4A 5FAEA 3FFNA 2NUTB 2MOTA 1PD0A 4CBWG 3EG9B 2FH3A 2NUTA 1DEJS 1COFA 4KEEA 5DD2A 4KEFA 2XFAA 1QPVA 2VACA 2D8BA 4PKGG 2LJ8A 3EGXB 4PKIG 1F7SA 4CBXG 3CIPG 2MP4A 5HVKB 1P8XA 5KYNA 1CNUA 1WFSA 1C0GS 5KYXA 3FFKA 2KVKA 4PKHB
chains in the Genus database with same CATH topology
1VFQA 2MV2A 3CJCG 2FF6G 1NM1G 1YAGG 1HQZ1 3A5NS 1MDUA 1D4XG 1P8ZG 2NUPA 3EGDB 1T3YA 3FG7A 5KYUB 5KYYB 5L6WC 2QTVA 5HVKD 1AHQA 3EH2A 1UDMA 1SVRA 1V6FA 1T3XA 5FAFA 1TVJA 5KYYA 5KYWA 1EQYS 1AK6A 1KCQA 1M2VA 5IVUA 2XF1A 1T44G 1SVYA 1NLVG 2FGHA 3EGDA 1M2VB 1NMDG 1WM4A 3A5LS 3FG6A 2I2QA 3A5MS 3EFOB 1JHWA 1ESVS 2FF3A 4JD2H 1NPHA 2W0IA 1TMWA 1H1VG 5KYWB 3DA7A 1PD1A 1J72A 1Q8GA 3CI5G 2NUPB 4Z94G 5KYUA 3EFOA 1YVNG 1AK7A 5A1MA 2LLFA 4BEX1 1PCXA 2VIKA 2LXXA 1T2LA 1CFYA 3A5OS 1D0NA 1Q8XA 1X67A 4KEDA 1RGIG 1VKKA 3EGXA 3TU5B 1C0FS 5KYXB 3CJBG 4S10C 2HD7A 2L72A 1M4JA 4CBUG 3DAWB 2FH1A 3EG9A 1M2OA 3L50A 1WNJA 1SVQA 2VILA 3EH1A 3Q2BA 4LIZA 2FH2A 2FH4A 5FAEA 3FFNA 2NUTB 2MOTA 1PD0A 4CBWG 3EG9B 2FH3A 2NUTA 1DEJS 1COFA 4KEEA 5DD2A 4KEFA 2XFAA 1QPVA 2VACA 2D8BA 4PKGG 2LJ8A 3EGXB 4PKIG 1F7SA 4CBXG 3CIPG 2MP4A 5HVKB 1P8XA 5KYNA 1CNUA 1WFSA 1C0GS 5KYXA 3FFKA 2KVKA 4PKHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFQ A;  2MV2 A;  3CJC G;  2FF6 G;  1NM1 G;  1YAG G;  1HQZ 1;  3A5N S;  1MDU A;  1D4X G;  1P8Z G;  2NUP A;  3EGD B;  1T3Y A;  3FG7 A;  5KYU B;  5KYY B;  5L6W C;  2QTV A;  5HVK D;  1AHQ A;  3EH2 A;  1UDM A;  1SVR A;  1V6F A;  1T3X A;  5FAF A;  1TVJ A;  5KYY A;  5KYW A;  1EQY S;  1AK6 A;  1KCQ A;  1M2V A;  5IVU A;  2XF1 A;  1T44 G;  1SVY A;  1NLV G;  2FGH A;  3EGD A;  1M2V B;  1NMD G;  1WM4 A;  3A5L S;  3FG6 A;  2I2Q A;  3A5M S;  3EFO B;  1JHW A;  1ESV S;  2FF3 A;  4JD2 H;  1NPH A;  2W0I A;  1TMW A;  1H1V G;  5KYW B;  1PD1 A;  1J72 A;  1Q8G A;  3CI5 G;  2NUP B;  4Z94 G;  5KYU A;  3EFO A;  1YVN G;  1AK7 A;  5A1M A;  2LLF A;  4BEX 1;  1PCX A;  2VIK A;  2LXX A;  1T2L A;  1CFY A;  3A5O S;  1D0N A;  1Q8X A;  1X67 A;  4KED A;  1RGI G;  1VKK A;  3EGX A;  3TU5 B;  1C0F S;  5KYX B;  3CJB G;  4S10 C;  2HD7 A;  2L72 A;  1M4J A;  4CBU G;  3DAW B;  2FH1 A;  3EG9 A;  1M2O A;  3L50 A;  1WNJ A;  1SVQ A;  2VIL A;  3EH1 A;  3Q2B A;  4LIZ A;  2FH2 A;  2FH4 A;  5FAE A;  3FFN A;  2NUT B;  2MOT A;  1PD0 A;  4CBW G;  3EG9 B;  2FH3 A;  2NUT A;  1DEJ S;  1COF A;  4KEE A;  5DD2 A;  4KEF A;  2XFA A;  1QPV A;  2VAC A;  2D8B A;  4PKG G;  2LJ8 A;  3EGX B;  4PKI G;  1F7S A;  4CBX G;  3CIP G;  2MP4 A;  5HVK B;  1P8X A;  5KYN A;  1CNU A;  1WFS A;  1C0G S;  5KYX A;  3FFK A;  2KVK A;  4PKH B; 
#chains in the Genus database with same CATH topology
 1VFQ A;  2MV2 A;  3CJC G;  2FF6 G;  1NM1 G;  1YAG G;  1HQZ 1;  3A5N S;  1MDU A;  1D4X G;  1P8Z G;  2NUP A;  3EGD B;  1T3Y A;  3FG7 A;  5KYU B;  5KYY B;  5L6W C;  2QTV A;  5HVK D;  1AHQ A;  3EH2 A;  1UDM A;  1SVR A;  1V6F A;  1T3X A;  5FAF A;  1TVJ A;  5KYY A;  5KYW A;  1EQY S;  1AK6 A;  1KCQ A;  1M2V A;  5IVU A;  2XF1 A;  1T44 G;  1SVY A;  1NLV G;  2FGH A;  3EGD A;  1M2V B;  1NMD G;  1WM4 A;  3A5L S;  3FG6 A;  2I2Q A;  3A5M S;  3EFO B;  1JHW A;  1ESV S;  2FF3 A;  4JD2 H;  1NPH A;  2W0I A;  1TMW A;  1H1V G;  5KYW B;  3DA7 A;  1PD1 A;  1J72 A;  1Q8G A;  3CI5 G;  2NUP B;  4Z94 G;  5KYU A;  3EFO A;  1YVN G;  1AK7 A;  5A1M A;  2LLF A;  4BEX 1;  1PCX A;  2VIK A;  2LXX A;  1T2L A;  1CFY A;  3A5O S;  1D0N A;  1Q8X A;  1X67 A;  4KED A;  1RGI G;  1VKK A;  3EGX A;  3TU5 B;  1C0F S;  5KYX B;  3CJB G;  4S10 C;  2HD7 A;  2L72 A;  1M4J A;  4CBU G;  3DAW B;  2FH1 A;  3EG9 A;  1M2O A;  3L50 A;  1WNJ A;  1SVQ A;  2VIL A;  3EH1 A;  3Q2B A;  4LIZ A;  2FH2 A;  2FH4 A;  5FAE A;  3FFN A;  2NUT B;  2MOT A;  1PD0 A;  4CBW G;  3EG9 B;  2FH3 A;  2NUT A;  1DEJ S;  1COF A;  4KEE A;  5DD2 A;  4KEF A;  2XFA A;  1QPV A;  2VAC A;  2D8B A;  4PKG G;  2LJ8 A;  3EGX B;  4PKI G;  1F7S A;  4CBX G;  3CIP G;  2MP4 A;  5HVK B;  1P8X A;  5KYN A;  1CNU A;  1WFS A;  1C0G S;  5KYX A;  3FFK A;  2KVK A;  4PKH B; 
#chains in the Genus database with same CATH homology
 1VFQ A;  2MV2 A;  3CJC G;  2FF6 G;  1NM1 G;  1YAG G;  1HQZ 1;  3A5N S;  1MDU A;  1D4X G;  1P8Z G;  2NUP A;  3EGD B;  1T3Y A;  3FG7 A;  5KYU B;  5KYY B;  5L6W C;  2QTV A;  5HVK D;  1AHQ A;  3EH2 A;  1UDM A;  1SVR A;  1V6F A;  1T3X A;  5FAF A;  1TVJ A;  5KYY A;  5KYW A;  1EQY S;  1AK6 A;  1KCQ A;  1M2V A;  5IVU A;  2XF1 A;  1T44 G;  1SVY A;  1NLV G;  2FGH A;  3EGD A;  1M2V B;  1NMD G;  1WM4 A;  3A5L S;  3FG6 A;  2I2Q A;  3A5M S;  3EFO B;  1JHW A;  1ESV S;  2FF3 A;  4JD2 H;  1NPH A;  2W0I A;  1TMW A;  1H1V G;  5KYW B;  3DA7 A;  1PD1 A;  1J72 A;  1Q8G A;  3CI5 G;  2NUP B;  4Z94 G;  5KYU A;  3EFO A;  1YVN G;  1AK7 A;  5A1M A;  2LLF A;  4BEX 1;  1PCX A;  2VIK A;  2LXX A;  1T2L A;  1CFY A;  3A5O S;  1D0N A;  1Q8X A;  1X67 A;  4KED A;  1RGI G;  1VKK A;  3EGX A;  3TU5 B;  1C0F S;  5KYX B;  3CJB G;  4S10 C;  2HD7 A;  2L72 A;  1M4J A;  4CBU G;  3DAW B;  2FH1 A;  3EG9 A;  1M2O A;  3L50 A;  1WNJ A;  1SVQ A;  2VIL A;  3EH1 A;  3Q2B A;  4LIZ A;  2FH2 A;  2FH4 A;  5FAE A;  3FFN A;  2NUT B;  2MOT A;  1PD0 A;  4CBW G;  3EG9 B;  2FH3 A;  2NUT A;  1DEJ S;  1COF A;  4KEE A;  5DD2 A;  4KEF A;  2XFA A;  1QPV A;  2VAC A;  2D8B A;  4PKG G;  2LJ8 A;  3EGX B;  4PKI G;  1F7S A;  4CBX G;  3CIP G;  2MP4 A;  5HVK B;  1P8X A;  5KYN A;  1CNU A;  1WFS A;  1C0G S;  5KYX A;  3FFK A;  2KVK A;  4PKH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...