1UDMA

Solution structure of coactosin-like protein (cofilin family) from mus musculus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
GSEGAATMATKIDKEACRAAYNLVRDDGSAVIWVTFRYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGEDVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANYDAQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structures of actin depolymerizing factor homology domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Coactosin-like protein
total genus 27
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1udmA00
1M2VA 3EH1A 1J72A 1HQZ1 1WNJA 3A5OS 1PD1A 2LJ8A 3FFNA 1H1VG 3FFKA 3A5NS 4PKGG 5DD2A 1Q8XA 4CBUG 1ESVS 2VILA 5A1MA 1NPHA 1T3YA 2L72A 2NUTB 3EG9A 5FAEA 1M4JA 2FF6G 1T44G 2FH3A 2FGHA 1EQYS 1YVNG 2D8BA 2W0IA 2MOTA 2KVKA 5KYWA 5IVUA 4JD2H 1V6FA 5KYXA 1P8XA 1NLVG 3EGDB 2I2QA 3L50A 3FG6A 2XF1A 1NM1G 1C0FS 3EGXB 1VFQA 1VKKA 1COFA 2FF3A 3A5MS 1JHWA 2XFAA 1C0GS 2FH1A 1M2OA 3FG7A 3EGDA 4BEX1 2MV2A 1F7SA 1TVJA 2FH4A 1KCQA 4CBXG 5KYXB 2NUPB 5KYUB 1D0NA 3CIPG 4KEDA 5KYWB 1CNUA 1TMWA 1WM4A 1D4XG 2FH2A 3DAWB 1X67A 4PKHB 4CBWG 1T3XA 2NUTA 3EG9B 3CJCG 2HD7A 5L6WC 4S10C 1SVRA 4KEEA 4KEFA 2VACA 3CI5G 2QTVA 2VIKA 4Z94G 1T2LA 2NUPA 1DEJS 5KYUA 1Q8GA 1PD0A 3TU5B 1YAGG 3CJBG 1AK7A 1CFYA 1RGIG 4PKIG 5HVKB 5KYNA 1P8ZG 1PCXA 3EFOB 5KYYA 3Q2BA 5FAFA 2MP4A 1AK6A 1M2VB 1NMDG 2LXXA 3EGXA 3EFOA 5KYYB 3A5LS 1SVQA 1WFSA 2LLFA 1SVYA 5HVKD 1MDUA 4LIZA 1UDMA 3EH2A 1AHQA 1QPVA
chains in the Genus database with same CATH superfamily
1M2VA 3EH1A 1J72A 1HQZ1 1WNJA 3A5OS 1PD1A 2LJ8A 3FFNA 1H1VG 3FFKA 3A5NS 4PKGG 5DD2A 1Q8XA 4CBUG 1ESVS 2VILA 5A1MA 1NPHA 1T3YA 2L72A 2NUTB 3EG9A 5FAEA 1M4JA 3DA7A 2FF6G 1T44G 2FH3A 2FGHA 1EQYS 1YVNG 2D8BA 2W0IA 2MOTA 2KVKA 5KYWA 5IVUA 4JD2H 1V6FA 5KYXA 1P8XA 1NLVG 3EGDB 2I2QA 3L50A 3FG6A 2XF1A 1NM1G 1C0FS 3EGXB 1VFQA 1VKKA 1COFA 2FF3A 3A5MS 1JHWA 2XFAA 1C0GS 2FH1A 1M2OA 3FG7A 3EGDA 4BEX1 2MV2A 1F7SA 1TVJA 2FH4A 1KCQA 4CBXG 5KYXB 2NUPB 5KYUB 1D0NA 3CIPG 4KEDA 5KYWB 1CNUA 1TMWA 1WM4A 1D4XG 2FH2A 3DAWB 1X67A 4PKHB 4CBWG 1T3XA 2NUTA 3EG9B 3CJCG 2HD7A 5L6WC 4S10C 1SVRA 4KEEA 4KEFA 2VACA 3CI5G 2QTVA 2VIKA 4Z94G 1T2LA 2NUPA 1DEJS 5KYUA 1Q8GA 1PD0A 3TU5B 1YAGG 3CJBG 1AK7A 1CFYA 1RGIG 4PKIG 5HVKB 5KYNA 1P8ZG 1PCXA 3EFOB 5KYYA 3Q2BA 5FAFA 2MP4A 1AK6A 1M2VB 1NMDG 2LXXA 3EGXA 3EFOA 5KYYB 3A5LS 1SVQA 1WFSA 2LLFA 1SVYA 5HVKD 1MDUA 4LIZA 1UDMA 3EH2A 1AHQA 1QPVA
chains in the Genus database with same CATH topology
1M2VA 3EH1A 1J72A 1HQZ1 1WNJA 3A5OS 1PD1A 2LJ8A 3FFNA 1H1VG 3FFKA 3A5NS 4PKGG 5DD2A 1Q8XA 4CBUG 1ESVS 2VILA 5A1MA 1NPHA 1T3YA 2L72A 2NUTB 3EG9A 5FAEA 1M4JA 3DA7A 2FF6G 1T44G 2FH3A 2FGHA 1EQYS 1YVNG 2D8BA 2W0IA 2MOTA 2KVKA 5KYWA 5IVUA 4JD2H 1V6FA 5KYXA 1P8XA 1NLVG 3EGDB 2I2QA 3L50A 3FG6A 2XF1A 1NM1G 1C0FS 3EGXB 1VFQA 1VKKA 1COFA 2FF3A 3A5MS 1JHWA 2XFAA 1C0GS 2FH1A 1M2OA 3FG7A 3EGDA 4BEX1 2MV2A 1F7SA 1TVJA 2FH4A 1KCQA 4CBXG 5KYXB 2NUPB 5KYUB 1D0NA 3CIPG 4KEDA 5KYWB 1CNUA 1TMWA 1WM4A 1D4XG 2FH2A 3DAWB 1X67A 4PKHB 4CBWG 1T3XA 2NUTA 3EG9B 3CJCG 2HD7A 5L6WC 4S10C 1SVRA 4KEEA 4KEFA 2VACA 3CI5G 2QTVA 2VIKA 4Z94G 1T2LA 2NUPA 1DEJS 5KYUA 1Q8GA 1PD0A 3TU5B 1YAGG 3CJBG 1AK7A 1CFYA 1RGIG 4PKIG 5HVKB 5KYNA 1P8ZG 1PCXA 3EFOB 5KYYA 3Q2BA 5FAFA 2MP4A 1AK6A 1M2VB 1NMDG 2LXXA 3EGXA 3EFOA 5KYYB 3A5LS 1SVQA 1WFSA 2LLFA 1SVYA 5HVKD 1MDUA 4LIZA 1UDMA 3EH2A 1AHQA 1QPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M2V A;  3EH1 A;  1J72 A;  1HQZ 1;  1WNJ A;  3A5O S;  1PD1 A;  2LJ8 A;  3FFN A;  1H1V G;  3FFK A;  3A5N S;  4PKG G;  5DD2 A;  1Q8X A;  4CBU G;  1ESV S;  2VIL A;  5A1M A;  1NPH A;  1T3Y A;  2L72 A;  2NUT B;  3EG9 A;  5FAE A;  1M4J A;  2FF6 G;  1T44 G;  2FH3 A;  2FGH A;  1EQY S;  1YVN G;  2D8B A;  2W0I A;  2MOT A;  2KVK A;  5KYW A;  5IVU A;  4JD2 H;  1V6F A;  5KYX A;  1P8X A;  1NLV G;  3EGD B;  2I2Q A;  3L50 A;  3FG6 A;  2XF1 A;  1NM1 G;  1C0F S;  3EGX B;  1VFQ A;  1VKK A;  1COF A;  2FF3 A;  3A5M S;  1JHW A;  2XFA A;  1C0G S;  2FH1 A;  1M2O A;  3FG7 A;  3EGD A;  4BEX 1;  2MV2 A;  1F7S A;  1TVJ A;  2FH4 A;  1KCQ A;  4CBX G;  5KYX B;  2NUP B;  5KYU B;  1D0N A;  3CIP G;  4KED A;  5KYW B;  1CNU A;  1TMW A;  1WM4 A;  1D4X G;  2FH2 A;  3DAW B;  1X67 A;  4PKH B;  4CBW G;  1T3X A;  2NUT A;  3EG9 B;  3CJC G;  2HD7 A;  5L6W C;  4S10 C;  1SVR A;  4KEE A;  4KEF A;  2VAC A;  3CI5 G;  2QTV A;  2VIK A;  4Z94 G;  1T2L A;  2NUP A;  1DEJ S;  5KYU A;  1Q8G A;  1PD0 A;  3TU5 B;  1YAG G;  3CJB G;  1AK7 A;  1CFY A;  1RGI G;  4PKI G;  5HVK B;  5KYN A;  1P8Z G;  1PCX A;  3EFO B;  5KYY A;  3Q2B A;  5FAF A;  2MP4 A;  1AK6 A;  1M2V B;  1NMD G;  2LXX A;  3EGX A;  3EFO A;  5KYY B;  3A5L S;  1SVQ A;  1WFS A;  2LLF A;  1SVY A;  5HVK D;  1MDU A;  4LIZ A;  1UDM A;  3EH2 A;  1AHQ A;  1QPV A; 
#chains in the Genus database with same CATH topology
 1M2V A;  3EH1 A;  1J72 A;  1HQZ 1;  1WNJ A;  3A5O S;  1PD1 A;  2LJ8 A;  3FFN A;  1H1V G;  3FFK A;  3A5N S;  4PKG G;  5DD2 A;  1Q8X A;  4CBU G;  1ESV S;  2VIL A;  5A1M A;  1NPH A;  1T3Y A;  2L72 A;  2NUT B;  3EG9 A;  5FAE A;  1M4J A;  3DA7 A;  2FF6 G;  1T44 G;  2FH3 A;  2FGH A;  1EQY S;  1YVN G;  2D8B A;  2W0I A;  2MOT A;  2KVK A;  5KYW A;  5IVU A;  4JD2 H;  1V6F A;  5KYX A;  1P8X A;  1NLV G;  3EGD B;  2I2Q A;  3L50 A;  3FG6 A;  2XF1 A;  1NM1 G;  1C0F S;  3EGX B;  1VFQ A;  1VKK A;  1COF A;  2FF3 A;  3A5M S;  1JHW A;  2XFA A;  1C0G S;  2FH1 A;  1M2O A;  3FG7 A;  3EGD A;  4BEX 1;  2MV2 A;  1F7S A;  1TVJ A;  2FH4 A;  1KCQ A;  4CBX G;  5KYX B;  2NUP B;  5KYU B;  1D0N A;  3CIP G;  4KED A;  5KYW B;  1CNU A;  1TMW A;  1WM4 A;  1D4X G;  2FH2 A;  3DAW B;  1X67 A;  4PKH B;  4CBW G;  1T3X A;  2NUT A;  3EG9 B;  3CJC G;  2HD7 A;  5L6W C;  4S10 C;  1SVR A;  4KEE A;  4KEF A;  2VAC A;  3CI5 G;  2QTV A;  2VIK A;  4Z94 G;  1T2L A;  2NUP A;  1DEJ S;  5KYU A;  1Q8G A;  1PD0 A;  3TU5 B;  1YAG G;  3CJB G;  1AK7 A;  1CFY A;  1RGI G;  4PKI G;  5HVK B;  5KYN A;  1P8Z G;  1PCX A;  3EFO B;  5KYY A;  3Q2B A;  5FAF A;  2MP4 A;  1AK6 A;  1M2V B;  1NMD G;  2LXX A;  3EGX A;  3EFO A;  5KYY B;  3A5L S;  1SVQ A;  1WFS A;  2LLF A;  1SVY A;  5HVK D;  1MDU A;  4LIZ A;  1UDM A;  3EH2 A;  1AHQ A;  1QPV A; 
#chains in the Genus database with same CATH homology
 1M2V A;  3EH1 A;  1J72 A;  1HQZ 1;  1WNJ A;  3A5O S;  1PD1 A;  2LJ8 A;  3FFN A;  1H1V G;  3FFK A;  3A5N S;  4PKG G;  5DD2 A;  1Q8X A;  4CBU G;  1ESV S;  2VIL A;  5A1M A;  1NPH A;  1T3Y A;  2L72 A;  2NUT B;  3EG9 A;  5FAE A;  1M4J A;  3DA7 A;  2FF6 G;  1T44 G;  2FH3 A;  2FGH A;  1EQY S;  1YVN G;  2D8B A;  2W0I A;  2MOT A;  2KVK A;  5KYW A;  5IVU A;  4JD2 H;  1V6F A;  5KYX A;  1P8X A;  1NLV G;  3EGD B;  2I2Q A;  3L50 A;  3FG6 A;  2XF1 A;  1NM1 G;  1C0F S;  3EGX B;  1VFQ A;  1VKK A;  1COF A;  2FF3 A;  3A5M S;  1JHW A;  2XFA A;  1C0G S;  2FH1 A;  1M2O A;  3FG7 A;  3EGD A;  4BEX 1;  2MV2 A;  1F7S A;  1TVJ A;  2FH4 A;  1KCQ A;  4CBX G;  5KYX B;  2NUP B;  5KYU B;  1D0N A;  3CIP G;  4KED A;  5KYW B;  1CNU A;  1TMW A;  1WM4 A;  1D4X G;  2FH2 A;  3DAW B;  1X67 A;  4PKH B;  4CBW G;  1T3X A;  2NUT A;  3EG9 B;  3CJC G;  2HD7 A;  5L6W C;  4S10 C;  1SVR A;  4KEE A;  4KEF A;  2VAC A;  3CI5 G;  2QTV A;  2VIK A;  4Z94 G;  1T2L A;  2NUP A;  1DEJ S;  5KYU A;  1Q8G A;  1PD0 A;  3TU5 B;  1YAG G;  3CJB G;  1AK7 A;  1CFY A;  1RGI G;  4PKI G;  5HVK B;  5KYN A;  1P8Z G;  1PCX A;  3EFO B;  5KYY A;  3Q2B A;  5FAF A;  2MP4 A;  1AK6 A;  1M2V B;  1NMD G;  2LXX A;  3EGX A;  3EFO A;  5KYY B;  3A5L S;  1SVQ A;  1WFS A;  2LLF A;  1SVY A;  5HVK D;  1MDU A;  4LIZ A;  1UDM A;  3EH2 A;  1AHQ A;  1QPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...