1UDMA

Solution structure of coactosin-like protein (cofilin family) from mus musculus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
149
structure length
149
Chain Sequence
GSEGAATMATKIDKEACRAAYNLVRDDGSAVIWVTFRYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGEDVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANYDAQSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structures of actin depolymerizing factor homology domains.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Coactosin-like protein
total genus 27
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1udmA00
3EFOB 3FG7A 5FAFA 1MDUA 2VACA 5KYWA 5FAEA 2LXXA 1VFQA 5HVKD 5KYUA 1D4XG 3FG6A 4PKHB 1NLVG 3A5NS 2FH4A 1UDMA 2QTVA 2MP4A 2MOTA 5DD2A 1TMWA 3EGDB 1PCXA 2FH1A 4PKIG 5KYWB 4KEDA 1SVRA 3TU5B 1T3XA 1ESVS 1KCQA 2FF3A 3CI5G 2KVKA 1C0FS 3EGXA 4PKGG 2FH2A 1H1VG 5IVUA 1COFA 2FH3A 1M2VA 1YVNG 1V6FA 4JD2H 1WFSA 2FGHA 2XF1A 1T3YA 1EQYS 1SVQA 3EGXB 3FFKA 5HVKB 1VKKA 1M2OA 1QPVA 2I2QA 2XFAA 3A5MS 1WM4A 2NUTA 2NUPA 1Q8GA 1T44G 1AK6A 1P8XA 1RGIG 3A5OS 5KYXA 1TVJA 2VIKA 1AHQA 3Q2BA 3DAWB 5KYXB 2W0IA 4BEX1 3EFOA 4CBXG 1SVYA 1M2VB 4LIZA 1AK7A 4KEEA 1HQZ1 1T2LA 1PD1A 5KYYA 5KYYB 3FFNA 2MV2A 1YAGG 5A1MA 5KYNA 3EGDA 3CJBG 1NM1G 2HD7A 1D0NA 1CNUA 2NUTB 3EG9B 1P8ZG 1CFYA 2D8BA 1JHWA 4CBWG 1F7SA 3CIPG 1X67A 1NMDG 1C0GS 2LLFA 4KEFA 3EH1A 1DEJS 4Z94G 1M4JA 1Q8XA 3A5LS 5L6WC 2FF6G 3EG9A 3L50A 1NPHA 4CBUG 2LJ8A 1WNJA 3CJCG 2VILA 1PD0A 2L72A 5KYUB 2NUPB 3EH2A 4S10C 1J72A
chains in the Genus database with same CATH superfamily
3EFOB 3FG7A 5FAFA 1MDUA 2VACA 5KYWA 5FAEA 2LXXA 1VFQA 5HVKD 5KYUA 1D4XG 3FG6A 4PKHB 1NLVG 3A5NS 2FH4A 1UDMA 2QTVA 2MP4A 2MOTA 5DD2A 1TMWA 3EGDB 1PCXA 2FH1A 4PKIG 5KYWB 4KEDA 1SVRA 3TU5B 1T3XA 1ESVS 1KCQA 2FF3A 3CI5G 2KVKA 1C0FS 3EGXA 4PKGG 2FH2A 1H1VG 5IVUA 1COFA 2FH3A 1M2VA 1YVNG 1V6FA 4JD2H 1WFSA 2FGHA 2XF1A 1T3YA 1EQYS 1SVQA 3EGXB 3FFKA 5HVKB 1VKKA 1M2OA 1QPVA 2I2QA 2XFAA 3A5MS 3DA7A 1WM4A 2NUTA 2NUPA 1Q8GA 1T44G 1AK6A 1P8XA 1RGIG 3A5OS 5KYXA 1TVJA 2VIKA 1AHQA 3Q2BA 3DAWB 5KYXB 2W0IA 4BEX1 3EFOA 4CBXG 1SVYA 1M2VB 4LIZA 1AK7A 4KEEA 1HQZ1 1T2LA 1PD1A 5KYYA 5KYYB 3FFNA 2MV2A 1YAGG 5A1MA 5KYNA 3EGDA 3CJBG 1NM1G 2HD7A 1D0NA 1CNUA 2NUTB 3EG9B 1P8ZG 1CFYA 2D8BA 1JHWA 4CBWG 1F7SA 3CIPG 1X67A 1NMDG 1C0GS 2LLFA 4KEFA 3EH1A 1DEJS 4Z94G 1M4JA 1Q8XA 3A5LS 5L6WC 2FF6G 3EG9A 3L50A 1NPHA 4CBUG 2LJ8A 1WNJA 3CJCG 2VILA 1PD0A 2L72A 5KYUB 2NUPB 3EH2A 4S10C 1J72A
chains in the Genus database with same CATH topology
3EFOB 3FG7A 5FAFA 1MDUA 2VACA 5KYWA 5FAEA 2LXXA 1VFQA 5HVKD 5KYUA 1D4XG 3FG6A 4PKHB 1NLVG 3A5NS 2FH4A 1UDMA 2QTVA 2MP4A 2MOTA 5DD2A 1TMWA 3EGDB 1PCXA 2FH1A 4PKIG 5KYWB 4KEDA 1SVRA 3TU5B 1T3XA 1ESVS 1KCQA 2FF3A 3CI5G 2KVKA 1C0FS 3EGXA 4PKGG 2FH2A 1H1VG 5IVUA 1COFA 2FH3A 1M2VA 1YVNG 1V6FA 4JD2H 1WFSA 2FGHA 2XF1A 1T3YA 1EQYS 1SVQA 3EGXB 3FFKA 5HVKB 1VKKA 1M2OA 1QPVA 2I2QA 2XFAA 3A5MS 3DA7A 1WM4A 2NUTA 2NUPA 1Q8GA 1T44G 1AK6A 1P8XA 1RGIG 3A5OS 5KYXA 1TVJA 2VIKA 1AHQA 3Q2BA 3DAWB 5KYXB 2W0IA 4BEX1 3EFOA 4CBXG 1SVYA 1M2VB 4LIZA 1AK7A 4KEEA 1HQZ1 1T2LA 1PD1A 5KYYA 5KYYB 3FFNA 2MV2A 1YAGG 5A1MA 5KYNA 3EGDA 3CJBG 1NM1G 2HD7A 1D0NA 1CNUA 2NUTB 3EG9B 1P8ZG 1CFYA 2D8BA 1JHWA 4CBWG 1F7SA 3CIPG 1X67A 1NMDG 1C0GS 2LLFA 4KEFA 3EH1A 1DEJS 4Z94G 1M4JA 1Q8XA 3A5LS 5L6WC 2FF6G 3EG9A 3L50A 1NPHA 4CBUG 2LJ8A 1WNJA 3CJCG 2VILA 1PD0A 2L72A 5KYUB 2NUPB 3EH2A 4S10C 1J72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFO B;  3FG7 A;  5FAF A;  1MDU A;  2VAC A;  5KYW A;  5FAE A;  2LXX A;  1VFQ A;  5HVK D;  5KYU A;  1D4X G;  3FG6 A;  4PKH B;  1NLV G;  3A5N S;  2FH4 A;  1UDM A;  2QTV A;  2MP4 A;  2MOT A;  5DD2 A;  1TMW A;  3EGD B;  1PCX A;  2FH1 A;  4PKI G;  5KYW B;  4KED A;  1SVR A;  3TU5 B;  1T3X A;  1ESV S;  1KCQ A;  2FF3 A;  3CI5 G;  2KVK A;  1C0F S;  3EGX A;  4PKG G;  2FH2 A;  1H1V G;  5IVU A;  1COF A;  2FH3 A;  1M2V A;  1YVN G;  1V6F A;  4JD2 H;  1WFS A;  2FGH A;  2XF1 A;  1T3Y A;  1EQY S;  1SVQ A;  3EGX B;  3FFK A;  5HVK B;  1VKK A;  1M2O A;  1QPV A;  2I2Q A;  2XFA A;  3A5M S;  1WM4 A;  2NUT A;  2NUP A;  1Q8G A;  1T44 G;  1AK6 A;  1P8X A;  1RGI G;  3A5O S;  5KYX A;  1TVJ A;  2VIK A;  1AHQ A;  3Q2B A;  3DAW B;  5KYX B;  2W0I A;  4BEX 1;  3EFO A;  4CBX G;  1SVY A;  1M2V B;  4LIZ A;  1AK7 A;  4KEE A;  1HQZ 1;  1T2L A;  1PD1 A;  5KYY A;  5KYY B;  3FFN A;  2MV2 A;  1YAG G;  5A1M A;  5KYN A;  3EGD A;  3CJB G;  1NM1 G;  2HD7 A;  1D0N A;  1CNU A;  2NUT B;  3EG9 B;  1P8Z G;  1CFY A;  2D8B A;  1JHW A;  4CBW G;  1F7S A;  3CIP G;  1X67 A;  1NMD G;  1C0G S;  2LLF A;  4KEF A;  3EH1 A;  1DEJ S;  4Z94 G;  1M4J A;  1Q8X A;  3A5L S;  5L6W C;  2FF6 G;  3EG9 A;  3L50 A;  1NPH A;  4CBU G;  2LJ8 A;  1WNJ A;  3CJC G;  2VIL A;  1PD0 A;  2L72 A;  5KYU B;  2NUP B;  3EH2 A;  4S10 C;  1J72 A; 
#chains in the Genus database with same CATH topology
 3EFO B;  3FG7 A;  5FAF A;  1MDU A;  2VAC A;  5KYW A;  5FAE A;  2LXX A;  1VFQ A;  5HVK D;  5KYU A;  1D4X G;  3FG6 A;  4PKH B;  1NLV G;  3A5N S;  2FH4 A;  1UDM A;  2QTV A;  2MP4 A;  2MOT A;  5DD2 A;  1TMW A;  3EGD B;  1PCX A;  2FH1 A;  4PKI G;  5KYW B;  4KED A;  1SVR A;  3TU5 B;  1T3X A;  1ESV S;  1KCQ A;  2FF3 A;  3CI5 G;  2KVK A;  1C0F S;  3EGX A;  4PKG G;  2FH2 A;  1H1V G;  5IVU A;  1COF A;  2FH3 A;  1M2V A;  1YVN G;  1V6F A;  4JD2 H;  1WFS A;  2FGH A;  2XF1 A;  1T3Y A;  1EQY S;  1SVQ A;  3EGX B;  3FFK A;  5HVK B;  1VKK A;  1M2O A;  1QPV A;  2I2Q A;  2XFA A;  3A5M S;  3DA7 A;  1WM4 A;  2NUT A;  2NUP A;  1Q8G A;  1T44 G;  1AK6 A;  1P8X A;  1RGI G;  3A5O S;  5KYX A;  1TVJ A;  2VIK A;  1AHQ A;  3Q2B A;  3DAW B;  5KYX B;  2W0I A;  4BEX 1;  3EFO A;  4CBX G;  1SVY A;  1M2V B;  4LIZ A;  1AK7 A;  4KEE A;  1HQZ 1;  1T2L A;  1PD1 A;  5KYY A;  5KYY B;  3FFN A;  2MV2 A;  1YAG G;  5A1M A;  5KYN A;  3EGD A;  3CJB G;  1NM1 G;  2HD7 A;  1D0N A;  1CNU A;  2NUT B;  3EG9 B;  1P8Z G;  1CFY A;  2D8B A;  1JHW A;  4CBW G;  1F7S A;  3CIP G;  1X67 A;  1NMD G;  1C0G S;  2LLF A;  4KEF A;  3EH1 A;  1DEJ S;  4Z94 G;  1M4J A;  1Q8X A;  3A5L S;  5L6W C;  2FF6 G;  3EG9 A;  3L50 A;  1NPH A;  4CBU G;  2LJ8 A;  1WNJ A;  3CJC G;  2VIL A;  1PD0 A;  2L72 A;  5KYU B;  2NUP B;  3EH2 A;  4S10 C;  1J72 A; 
#chains in the Genus database with same CATH homology
 3EFO B;  3FG7 A;  5FAF A;  1MDU A;  2VAC A;  5KYW A;  5FAE A;  2LXX A;  1VFQ A;  5HVK D;  5KYU A;  1D4X G;  3FG6 A;  4PKH B;  1NLV G;  3A5N S;  2FH4 A;  1UDM A;  2QTV A;  2MP4 A;  2MOT A;  5DD2 A;  1TMW A;  3EGD B;  1PCX A;  2FH1 A;  4PKI G;  5KYW B;  4KED A;  1SVR A;  3TU5 B;  1T3X A;  1ESV S;  1KCQ A;  2FF3 A;  3CI5 G;  2KVK A;  1C0F S;  3EGX A;  4PKG G;  2FH2 A;  1H1V G;  5IVU A;  1COF A;  2FH3 A;  1M2V A;  1YVN G;  1V6F A;  4JD2 H;  1WFS A;  2FGH A;  2XF1 A;  1T3Y A;  1EQY S;  1SVQ A;  3EGX B;  3FFK A;  5HVK B;  1VKK A;  1M2O A;  1QPV A;  2I2Q A;  2XFA A;  3A5M S;  3DA7 A;  1WM4 A;  2NUT A;  2NUP A;  1Q8G A;  1T44 G;  1AK6 A;  1P8X A;  1RGI G;  3A5O S;  5KYX A;  1TVJ A;  2VIK A;  1AHQ A;  3Q2B A;  3DAW B;  5KYX B;  2W0I A;  4BEX 1;  3EFO A;  4CBX G;  1SVY A;  1M2V B;  4LIZ A;  1AK7 A;  4KEE A;  1HQZ 1;  1T2L A;  1PD1 A;  5KYY A;  5KYY B;  3FFN A;  2MV2 A;  1YAG G;  5A1M A;  5KYN A;  3EGD A;  3CJB G;  1NM1 G;  2HD7 A;  1D0N A;  1CNU A;  2NUT B;  3EG9 B;  1P8Z G;  1CFY A;  2D8B A;  1JHW A;  4CBW G;  1F7S A;  3CIP G;  1X67 A;  1NMD G;  1C0G S;  2LLF A;  4KEF A;  3EH1 A;  1DEJ S;  4Z94 G;  1M4J A;  1Q8X A;  3A5L S;  5L6W C;  2FF6 G;  3EG9 A;  3L50 A;  1NPH A;  4CBU G;  2LJ8 A;  1WNJ A;  3CJC G;  2VIL A;  1PD0 A;  2L72 A;  5KYU B;  2NUP B;  3EH2 A;  4S10 C;  1J72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...