2FF3A

Crystal structure of gelsolin domain 1:n-wasp v2 motif hybrid in complex with actin
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
125
structure length
125
Chain Sequence
EHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Actin Interaction with Multiple WH2/beta-Thymosin Motif-Containing Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/contractile protein
molecule keywords Gelsolin
total genus 38
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 2ff3A00
5KYXA 4JD2H 5FAFA 5FAEA 1AK7A 3CIPG 3A5NS 5L6WC 1P8ZG 4KEDA 3DAWB 3EGXB 2MOTA 4CBUG 5KYXB 2LJ8A 3TU5B 2FH1A 1C0FS 4PKIG 1TMWA 2D8BA 5KYYB 1M2VB 1X67A 1PD1A 1T3XA 3CJBG 4KEFA 3A5MS 1DEJS 1NMDG 1KCQA 3EG9A 4PKGG 1AHQA 1HQZ1 1PCXA 1QPVA 3EG9B 4CBXG 4LIZA 3L50A 2FH2A 3EGDA 2I2QA 2MV2A 1JHWA 2L72A 3A5OS 1WM4A 5KYUA 5KYWA 1NM1G 2FH4A 2LXXA 4S10C 3FFNA 1WNJA 1AK6A 1TVJA 1SVQA 5DD2A 2XFAA 1NPHA 1M2OA 1D0NA 3EFOA 5IVUA 1M2VA 1T2LA 5KYYA 2NUPA 1COFA 1C0GS 2VIKA 1P8XA 1MDUA 3FFKA 1SVYA 1VFQA 2MP4A 3EGXA 5HVKD 2VILA 1CNUA 3EFOB 1NLVG 2VACA 4PKHB 1YAGG 1UDMA 2NUPB 2HD7A 4CBWG 2KVKA 1V6FA 3A5LS 1WFSA 2FF6G 2NUTA 1YVNG 2FF3A 3EH2A 5KYNA 3EH1A 1EQYS 1CFYA 3CI5G 1F7SA 3FG7A 2LLFA 3CJCG 5KYWB 3EGDB 3Q2BA 2XF1A 3FG6A 5HVKB 1T44G 2FGHA 1Q8XA 5A1MA 2W0IA 4KEEA 2FH3A 4Z94G 1Q8GA 1SVRA 1VKKA 2QTVA 1M4JA 4BEX1 1RGIG 1PD0A 5KYUB 1D4XG 1J72A 1H1VG 1ESVS 1T3YA 2NUTB
chains in the Genus database with same CATH superfamily
5KYXA 4JD2H 5FAFA 5FAEA 1AK7A 3CIPG 3A5NS 5L6WC 1P8ZG 4KEDA 3DAWB 3EGXB 2MOTA 4CBUG 5KYXB 2LJ8A 3TU5B 2FH1A 1C0FS 4PKIG 1TMWA 2D8BA 5KYYB 1M2VB 1X67A 1PD1A 1T3XA 3CJBG 4KEFA 3A5MS 1DEJS 1NMDG 1KCQA 3EG9A 4PKGG 1AHQA 1HQZ1 1PCXA 1QPVA 3EG9B 4CBXG 4LIZA 3L50A 2FH2A 3EGDA 2I2QA 2MV2A 1JHWA 2L72A 3A5OS 1WM4A 5KYUA 5KYWA 3DA7A 1NM1G 2FH4A 2LXXA 4S10C 3FFNA 1WNJA 1AK6A 1TVJA 1SVQA 5DD2A 2XFAA 1NPHA 1M2OA 1D0NA 3EFOA 5IVUA 1M2VA 1T2LA 5KYYA 2NUPA 1COFA 1C0GS 2VIKA 1P8XA 1MDUA 3FFKA 1SVYA 1VFQA 2MP4A 3EGXA 5HVKD 2VILA 1CNUA 3EFOB 1NLVG 2VACA 4PKHB 1YAGG 1UDMA 2NUPB 2HD7A 4CBWG 2KVKA 1V6FA 3A5LS 1WFSA 2FF6G 2NUTA 1YVNG 2FF3A 3EH2A 5KYNA 3EH1A 1EQYS 1CFYA 3CI5G 1F7SA 3FG7A 2LLFA 3CJCG 5KYWB 3EGDB 3Q2BA 2XF1A 3FG6A 5HVKB 1T44G 2FGHA 1Q8XA 5A1MA 2W0IA 4KEEA 2FH3A 4Z94G 1Q8GA 1SVRA 1VKKA 2QTVA 1M4JA 4BEX1 1RGIG 1PD0A 5KYUB 1D4XG 1J72A 1H1VG 1ESVS 1T3YA 2NUTB
chains in the Genus database with same CATH topology
5KYXA 4JD2H 5FAFA 5FAEA 1AK7A 3CIPG 3A5NS 5L6WC 1P8ZG 4KEDA 3DAWB 3EGXB 2MOTA 4CBUG 5KYXB 2LJ8A 3TU5B 2FH1A 1C0FS 4PKIG 1TMWA 2D8BA 5KYYB 1M2VB 1X67A 1PD1A 1T3XA 3CJBG 4KEFA 3A5MS 1DEJS 1NMDG 1KCQA 3EG9A 4PKGG 1AHQA 1HQZ1 1PCXA 1QPVA 3EG9B 4CBXG 4LIZA 3L50A 2FH2A 3EGDA 2I2QA 2MV2A 1JHWA 2L72A 3A5OS 1WM4A 5KYUA 5KYWA 3DA7A 1NM1G 2FH4A 2LXXA 4S10C 3FFNA 1WNJA 1AK6A 1TVJA 1SVQA 5DD2A 2XFAA 1NPHA 1M2OA 1D0NA 3EFOA 5IVUA 1M2VA 1T2LA 5KYYA 2NUPA 1COFA 1C0GS 2VIKA 1P8XA 1MDUA 3FFKA 1SVYA 1VFQA 2MP4A 3EGXA 5HVKD 2VILA 1CNUA 3EFOB 1NLVG 2VACA 4PKHB 1YAGG 1UDMA 2NUPB 2HD7A 4CBWG 2KVKA 1V6FA 3A5LS 1WFSA 2FF6G 2NUTA 1YVNG 2FF3A 3EH2A 5KYNA 3EH1A 1EQYS 1CFYA 3CI5G 1F7SA 3FG7A 2LLFA 3CJCG 5KYWB 3EGDB 3Q2BA 2XF1A 3FG6A 5HVKB 1T44G 2FGHA 1Q8XA 5A1MA 2W0IA 4KEEA 2FH3A 4Z94G 1Q8GA 1SVRA 1VKKA 2QTVA 1M4JA 4BEX1 1RGIG 1PD0A 5KYUB 1D4XG 1J72A 1H1VG 1ESVS 1T3YA 2NUTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KYX A;  4JD2 H;  5FAF A;  5FAE A;  1AK7 A;  3CIP G;  3A5N S;  5L6W C;  1P8Z G;  4KED A;  3DAW B;  3EGX B;  2MOT A;  4CBU G;  5KYX B;  2LJ8 A;  3TU5 B;  2FH1 A;  1C0F S;  4PKI G;  1TMW A;  2D8B A;  5KYY B;  1M2V B;  1X67 A;  1PD1 A;  1T3X A;  3CJB G;  4KEF A;  3A5M S;  1DEJ S;  1NMD G;  1KCQ A;  3EG9 A;  4PKG G;  1AHQ A;  1HQZ 1;  1PCX A;  1QPV A;  3EG9 B;  4CBX G;  4LIZ A;  3L50 A;  2FH2 A;  3EGD A;  2I2Q A;  2MV2 A;  1JHW A;  2L72 A;  3A5O S;  1WM4 A;  5KYU A;  5KYW A;  1NM1 G;  2FH4 A;  2LXX A;  4S10 C;  3FFN A;  1WNJ A;  1AK6 A;  1TVJ A;  1SVQ A;  5DD2 A;  2XFA A;  1NPH A;  1M2O A;  1D0N A;  3EFO A;  5IVU A;  1M2V A;  1T2L A;  5KYY A;  2NUP A;  1COF A;  1C0G S;  2VIK A;  1P8X A;  1MDU A;  3FFK A;  1SVY A;  1VFQ A;  2MP4 A;  3EGX A;  5HVK D;  2VIL A;  1CNU A;  3EFO B;  1NLV G;  2VAC A;  4PKH B;  1YAG G;  1UDM A;  2NUP B;  2HD7 A;  4CBW G;  2KVK A;  1V6F A;  3A5L S;  1WFS A;  2FF6 G;  2NUT A;  1YVN G;  2FF3 A;  3EH2 A;  5KYN A;  3EH1 A;  1EQY S;  1CFY A;  3CI5 G;  1F7S A;  3FG7 A;  2LLF A;  3CJC G;  5KYW B;  3EGD B;  3Q2B A;  2XF1 A;  3FG6 A;  5HVK B;  1T44 G;  2FGH A;  1Q8X A;  5A1M A;  2W0I A;  4KEE A;  2FH3 A;  4Z94 G;  1Q8G A;  1SVR A;  1VKK A;  2QTV A;  1M4J A;  4BEX 1;  1RGI G;  1PD0 A;  5KYU B;  1D4X G;  1J72 A;  1H1V G;  1ESV S;  1T3Y A;  2NUT B; 
#chains in the Genus database with same CATH topology
 5KYX A;  4JD2 H;  5FAF A;  5FAE A;  1AK7 A;  3CIP G;  3A5N S;  5L6W C;  1P8Z G;  4KED A;  3DAW B;  3EGX B;  2MOT A;  4CBU G;  5KYX B;  2LJ8 A;  3TU5 B;  2FH1 A;  1C0F S;  4PKI G;  1TMW A;  2D8B A;  5KYY B;  1M2V B;  1X67 A;  1PD1 A;  1T3X A;  3CJB G;  4KEF A;  3A5M S;  1DEJ S;  1NMD G;  1KCQ A;  3EG9 A;  4PKG G;  1AHQ A;  1HQZ 1;  1PCX A;  1QPV A;  3EG9 B;  4CBX G;  4LIZ A;  3L50 A;  2FH2 A;  3EGD A;  2I2Q A;  2MV2 A;  1JHW A;  2L72 A;  3A5O S;  1WM4 A;  5KYU A;  5KYW A;  3DA7 A;  1NM1 G;  2FH4 A;  2LXX A;  4S10 C;  3FFN A;  1WNJ A;  1AK6 A;  1TVJ A;  1SVQ A;  5DD2 A;  2XFA A;  1NPH A;  1M2O A;  1D0N A;  3EFO A;  5IVU A;  1M2V A;  1T2L A;  5KYY A;  2NUP A;  1COF A;  1C0G S;  2VIK A;  1P8X A;  1MDU A;  3FFK A;  1SVY A;  1VFQ A;  2MP4 A;  3EGX A;  5HVK D;  2VIL A;  1CNU A;  3EFO B;  1NLV G;  2VAC A;  4PKH B;  1YAG G;  1UDM A;  2NUP B;  2HD7 A;  4CBW G;  2KVK A;  1V6F A;  3A5L S;  1WFS A;  2FF6 G;  2NUT A;  1YVN G;  2FF3 A;  3EH2 A;  5KYN A;  3EH1 A;  1EQY S;  1CFY A;  3CI5 G;  1F7S A;  3FG7 A;  2LLF A;  3CJC G;  5KYW B;  3EGD B;  3Q2B A;  2XF1 A;  3FG6 A;  5HVK B;  1T44 G;  2FGH A;  1Q8X A;  5A1M A;  2W0I A;  4KEE A;  2FH3 A;  4Z94 G;  1Q8G A;  1SVR A;  1VKK A;  2QTV A;  1M4J A;  4BEX 1;  1RGI G;  1PD0 A;  5KYU B;  1D4X G;  1J72 A;  1H1V G;  1ESV S;  1T3Y A;  2NUT B; 
#chains in the Genus database with same CATH homology
 5KYX A;  4JD2 H;  5FAF A;  5FAE A;  1AK7 A;  3CIP G;  3A5N S;  5L6W C;  1P8Z G;  4KED A;  3DAW B;  3EGX B;  2MOT A;  4CBU G;  5KYX B;  2LJ8 A;  3TU5 B;  2FH1 A;  1C0F S;  4PKI G;  1TMW A;  2D8B A;  5KYY B;  1M2V B;  1X67 A;  1PD1 A;  1T3X A;  3CJB G;  4KEF A;  3A5M S;  1DEJ S;  1NMD G;  1KCQ A;  3EG9 A;  4PKG G;  1AHQ A;  1HQZ 1;  1PCX A;  1QPV A;  3EG9 B;  4CBX G;  4LIZ A;  3L50 A;  2FH2 A;  3EGD A;  2I2Q A;  2MV2 A;  1JHW A;  2L72 A;  3A5O S;  1WM4 A;  5KYU A;  5KYW A;  3DA7 A;  1NM1 G;  2FH4 A;  2LXX A;  4S10 C;  3FFN A;  1WNJ A;  1AK6 A;  1TVJ A;  1SVQ A;  5DD2 A;  2XFA A;  1NPH A;  1M2O A;  1D0N A;  3EFO A;  5IVU A;  1M2V A;  1T2L A;  5KYY A;  2NUP A;  1COF A;  1C0G S;  2VIK A;  1P8X A;  1MDU A;  3FFK A;  1SVY A;  1VFQ A;  2MP4 A;  3EGX A;  5HVK D;  2VIL A;  1CNU A;  3EFO B;  1NLV G;  2VAC A;  4PKH B;  1YAG G;  1UDM A;  2NUP B;  2HD7 A;  4CBW G;  2KVK A;  1V6F A;  3A5L S;  1WFS A;  2FF6 G;  2NUT A;  1YVN G;  2FF3 A;  3EH2 A;  5KYN A;  3EH1 A;  1EQY S;  1CFY A;  3CI5 G;  1F7S A;  3FG7 A;  2LLF A;  3CJC G;  5KYW B;  3EGD B;  3Q2B A;  2XF1 A;  3FG6 A;  5HVK B;  1T44 G;  2FGH A;  1Q8X A;  5A1M A;  2W0I A;  4KEE A;  2FH3 A;  4Z94 G;  1Q8G A;  1SVR A;  1VKK A;  2QTV A;  1M4J A;  4BEX 1;  1RGI G;  1PD0 A;  5KYU B;  1D4X G;  1J72 A;  1H1V G;  1ESV S;  1T3Y A;  2NUT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...