2A50A

Fluorescent protein asfp595, wt, off-state
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
64
structure length
64
Chain Sequence
HGSASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of the reversible photoswitch of a fluorescent protein
pubmed doi rcsb
source organism Anemonia sulcata
molecule tags Luminescent protein
molecule keywords GFP-like non-fluorescent chromoprotein FP595 chain 1
total genus 8
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a50A00
2GW4A 2G5ZA 3CFHL 3CFFL 5EXCA 2A56A 2A50A 2A54A 2G2SA 3CFAL 3LF4A 2G16A 2G3DA 2A53A 2A52A
chains in the Genus database with same CATH superfamily
2RETA 1IHOA 4MQ6A 3ISJA 4MULA 2G5ZA 2IECA 3HL6A 3IVCA 2G16A 1N2HA 3IOBA 2X3FA 2EJCA 2GW4A 3COVA 3AG5A 4DDHA 3LE8A 3CFHL 5EXCA 3QTTA 4MUJA 4EF6A 4MUNA 3IOEA 5HG0A 3IUBA 4MUIA 3IODA 2I52A 3N8HA 3COWA 4BHRA 3LF4A 1N2IA 1V8FA 4MUKA 3UA0A 3IUEA 3UY4A 3EMOA 4MUEA 2G3DA 5G2FA 3IMCA 3CI0K 3IMGA 1MOPA 2G2SA 2A88A 5BW0B 3IMEA 4G5FA 1N2EA 2A56A 3MXTA 3MUEA 2A84A 4G5YA 3CFAL 3AG6A 2A52A 4EFKA 4DDMA 3CI0I 2A53A 3Q10A 4MUHA 3Q12A 1N2OA 3CFIA 4IXJA 3INNA 2A7XA 3IVXA 3IVGA 1UFVA 3CFFL 5KWVA 2OGFA 3IOCA 2GR8A 4DDKA 4FZJA 3UK2A 2A50A 4MUFA 2A86A 4DE5A 3COZA 2A54A 1N2BA 1N2JA 1N2GA 4MUGA 2GR7A 2LMEA 3COYA
chains in the Genus database with same CATH topology
1IHOA 4MQ6A 3ISJA 4MULA 2G5ZA 3HL6A 3IVCA 2G16A 1N2HA 3IOBA 2X3FA 2EJCA 2GW4A 3COVA 3AG5A 4DDHA 3LE8A 3CFHL 5EXCA 3QTTA 4MUJA 4EF6A 4MUNA 3IOEA 5HG0A 3IUBA 4MUIA 3IODA 3N8HA 3COWA 4BHRA 3LF4A 1N2IA 1V8FA 4MUKA 3UA0A 3IUEA 3UY4A 4MUEA 2G3DA 5G2FA 3IMCA 3IMGA 1MOPA 2G2SA 2A88A 3IMEA 4G5FA 1N2EA 2A56A 3MXTA 3MUEA 2A84A 4G5YA 3CFAL 3AG6A 2A52A 4EFKA 4DDMA 2A53A 3Q10A 4MUHA 3Q12A 1N2OA 4IXJA 3INNA 2A7XA 3IVXA 3IVGA 1UFVA 3CFFL 5KWVA 3IOCA 4DDKA 4FZJA 3UK2A 2A50A 4MUFA 2A86A 4DE5A 3COZA 2A54A 1N2BA 1N2JA 1N2GA 4MUGA 3COYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GW4 A;  2G5Z A;  3CFH L;  3CFF L;  5EXC A;  2A56 A;  2A50 A;  2A54 A;  2G2S A;  3CFA L;  3LF4 A;  2G16 A;  2G3D A;  2A53 A;  2A52 A; 
#chains in the Genus database with same CATH topology
 2RET A;  1IHO A;  4MQ6 A;  3ISJ A;  4MUL A;  2G5Z A;  2IEC A;  3HL6 A;  3IVC A;  2G16 A;  1N2H A;  3IOB A;  2X3F A;  2EJC A;  2GW4 A;  3COV A;  3AG5 A;  4DDH A;  3LE8 A;  3CFH L;  5EXC A;  3QTT A;  4MUJ A;  4EF6 A;  4MUN A;  3IOE A;  5HG0 A;  3IUB A;  4MUI A;  3IOD A;  2I52 A;  3N8H A;  3COW A;  4BHR A;  3LF4 A;  1N2I A;  1V8F A;  4MUK A;  3UA0 A;  3IUE A;  3UY4 A;  3EMO A;  4MUE A;  2G3D A;  5G2F A;  3IMC A;  3CI0 K;  3IMG A;  1MOP A;  2G2S A;  2A88 A;  5BW0 B;  3IME A;  4G5F A;  1N2E A;  2A56 A;  3MXT A;  3MUE A;  2A84 A;  4G5Y A;  3CFA L;  3AG6 A;  2A52 A;  4EFK A;  4DDM A;  3CI0 I;  2A53 A;  3Q10 A;  4MUH A;  3Q12 A;  1N2O A;  3CFI A;  4IXJ A;  3INN A;  2A7X A;  3IVX A;  3IVG A;  1UFV A;  3CFF L;  5KWV A;  2OGF A;  3IOC A;  2GR8 A;  4DDK A;  4FZJ A;  3UK2 A;  2A50 A;  4MUF A;  2A86 A;  4DE5 A;  3COZ A;  2A54 A;  1N2B A;  1N2J A;  1N2G A;  4MUG A;  2GR7 A;  2LME A;  3COY A; 
#chains in the Genus database with same CATH homology
 1IHO A;  4MQ6 A;  3ISJ A;  4MUL A;  2G5Z A;  3HL6 A;  3IVC A;  2G16 A;  1N2H A;  3IOB A;  2X3F A;  2EJC A;  2GW4 A;  3COV A;  3AG5 A;  4DDH A;  3LE8 A;  3CFH L;  5EXC A;  3QTT A;  4MUJ A;  4EF6 A;  4MUN A;  3IOE A;  5HG0 A;  3IUB A;  4MUI A;  3IOD A;  3N8H A;  3COW A;  4BHR A;  3LF4 A;  1N2I A;  1V8F A;  4MUK A;  3UA0 A;  3IUE A;  3UY4 A;  4MUE A;  2G3D A;  5G2F A;  3IMC A;  3IMG A;  1MOP A;  2G2S A;  2A88 A;  3IME A;  4G5F A;  1N2E A;  2A56 A;  3MXT A;  3MUE A;  2A84 A;  4G5Y A;  3CFA L;  3AG6 A;  2A52 A;  4EFK A;  4DDM A;  2A53 A;  3Q10 A;  4MUH A;  3Q12 A;  1N2O A;  4IXJ A;  3INN A;  2A7X A;  3IVX A;  3IVG A;  1UFV A;  3CFF L;  5KWV A;  3IOC A;  4DDK A;  4FZJ A;  3UK2 A;  2A50 A;  4MUF A;  2A86 A;  4DE5 A;  3COZ A;  2A54 A;  1N2B A;  1N2J A;  1N2G A;  4MUG A;  3COY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...