2A50A

Fluorescent protein asfp595, wt, off-state
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
64
structure length
64
Chain Sequence
HGSASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GFP-like non-fluorescent chromoprotein FP595 chain 1
publication title Structure and mechanism of the reversible photoswitch of a fluorescent protein
pubmed doi rcsb
source organism Anemonia sulcata
molecule tags Luminescent protein
total genus 8
structure length 64
sequence length 64
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a50A00
2G16A 2A56A 2G2SA 2GW4A 3CFFL 3CFAL 2G3DA 3LF4A 2A54A 2A52A 5EXCA 2A53A 2A50A 3CFHL 2G5ZA
chains in the Genus database with same CATH superfamily
3UK2A 4MULA 3COWA 4DDKA 3EMOA 3LE8A 4MQ6A 4DDMA 3UY4A 4MUHA 3Q12A 2A86A 1MOPA 3CFIA 3MUEA 5G2FA 2EJCA 2RETA 4IXJA 2GW4A 3IUBA 1N2GA 4G5FA 3IODA 2A84A 1N2BA 2A52A 2A54A 3N8HA 4EFKA 3CFAL 2GR8A 5KWVA 5BW0B 3QTTA 3AG5A 4MUJA 4BHRA 1IHOA 4G5YA 3IMCA 5HG0A 2I52A 4MUGA 3CI0I 3MXTA 4EF6A 4FZJA 1N2JA 4MUKA 3IUEA 2G16A 3IOCA 3IMEA 1N2OA 2X3FA 1N2IA 4DE5A 4MUEA 2OGFA 3CFFL 2A56A 3LF4A 3COYA 3CFHL 3INNA 3Q10A 3CI0K 2GR7A 3IOBA 2A7XA 3HL6A 3IVCA 3IMGA 3IOEA 1V8FA 3AG6A 2A88A 3COZA 4MUFA 3UA0A 2IECA 1UFVA 2G3DA 1N2EA 1N2HA 2LMEA 2A53A 3COVA 4DDHA 4MUNA 3IVXA 5EXCA 3ISJA 2G5ZA 4MUIA 2G2SA 2A50A 3IVGA
chains in the Genus database with same CATH topology
3UK2A 4MULA 3COWA 4DDKA 3LE8A 4MQ6A 4DDMA 3UY4A 4MUHA 3Q12A 2A86A 1MOPA 3MUEA 5G2FA 2EJCA 4IXJA 2GW4A 3IUBA 1N2GA 4G5FA 3IODA 2A84A 1N2BA 2A52A 2A54A 3N8HA 4EFKA 3CFAL 5KWVA 3QTTA 3AG5A 4MUJA 4BHRA 1IHOA 4G5YA 3IMCA 5HG0A 4MUGA 3MXTA 4EF6A 4FZJA 1N2JA 4MUKA 3IUEA 2G16A 3IOCA 3IMEA 1N2OA 2X3FA 1N2IA 4DE5A 4MUEA 3CFFL 2A56A 3LF4A 3COYA 3CFHL 3INNA 3Q10A 3IOBA 2A7XA 3HL6A 3IVCA 3IMGA 3IOEA 1V8FA 3AG6A 2A88A 3COZA 4MUFA 3UA0A 1UFVA 2G3DA 1N2EA 1N2HA 2A53A 3COVA 4DDHA 4MUNA 3IVXA 5EXCA 3ISJA 2G5ZA 4MUIA 2G2SA 2A50A 3IVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G16 A;  2A56 A;  2G2S A;  2GW4 A;  3CFF L;  3CFA L;  2G3D A;  3LF4 A;  2A54 A;  2A52 A;  5EXC A;  2A53 A;  2A50 A;  3CFH L;  2G5Z A; 
#chains in the Genus database with same CATH topology
 3UK2 A;  4MUL A;  3COW A;  4DDK A;  3EMO A;  3LE8 A;  4MQ6 A;  4DDM A;  3UY4 A;  4MUH A;  3Q12 A;  2A86 A;  1MOP A;  3CFI A;  3MUE A;  5G2F A;  2EJC A;  2RET A;  4IXJ A;  2GW4 A;  3IUB A;  1N2G A;  4G5F A;  3IOD A;  2A84 A;  1N2B A;  2A52 A;  2A54 A;  3N8H A;  4EFK A;  3CFA L;  2GR8 A;  5KWV A;  5BW0 B;  3QTT A;  3AG5 A;  4MUJ A;  4BHR A;  1IHO A;  4G5Y A;  3IMC A;  5HG0 A;  2I52 A;  4MUG A;  3CI0 I;  3MXT A;  4EF6 A;  4FZJ A;  1N2J A;  4MUK A;  3IUE A;  2G16 A;  3IOC A;  3IME A;  1N2O A;  2X3F A;  1N2I A;  4DE5 A;  4MUE A;  2OGF A;  3CFF L;  2A56 A;  3LF4 A;  3COY A;  3CFH L;  3INN A;  3Q10 A;  3CI0 K;  2GR7 A;  3IOB A;  2A7X A;  3HL6 A;  3IVC A;  3IMG A;  3IOE A;  1V8F A;  3AG6 A;  2A88 A;  3COZ A;  4MUF A;  3UA0 A;  2IEC A;  1UFV A;  2G3D A;  1N2E A;  1N2H A;  2LME A;  2A53 A;  3COV A;  4DDH A;  4MUN A;  3IVX A;  5EXC A;  3ISJ A;  2G5Z A;  4MUI A;  2G2S A;  2A50 A;  3IVG A; 
#chains in the Genus database with same CATH homology
 3UK2 A;  4MUL A;  3COW A;  4DDK A;  3LE8 A;  4MQ6 A;  4DDM A;  3UY4 A;  4MUH A;  3Q12 A;  2A86 A;  1MOP A;  3MUE A;  5G2F A;  2EJC A;  4IXJ A;  2GW4 A;  3IUB A;  1N2G A;  4G5F A;  3IOD A;  2A84 A;  1N2B A;  2A52 A;  2A54 A;  3N8H A;  4EFK A;  3CFA L;  5KWV A;  3QTT A;  3AG5 A;  4MUJ A;  4BHR A;  1IHO A;  4G5Y A;  3IMC A;  5HG0 A;  4MUG A;  3MXT A;  4EF6 A;  4FZJ A;  1N2J A;  4MUK A;  3IUE A;  2G16 A;  3IOC A;  3IME A;  1N2O A;  2X3F A;  1N2I A;  4DE5 A;  4MUE A;  3CFF L;  2A56 A;  3LF4 A;  3COY A;  3CFH L;  3INN A;  3Q10 A;  3IOB A;  2A7X A;  3HL6 A;  3IVC A;  3IMG A;  3IOE A;  1V8F A;  3AG6 A;  2A88 A;  3COZ A;  4MUF A;  3UA0 A;  1UFV A;  2G3D A;  1N2E A;  1N2H A;  2A53 A;  3COV A;  4DDH A;  4MUN A;  3IVX A;  5EXC A;  3ISJ A;  2G5Z A;  4MUI A;  2G2S A;  2A50 A;  3IVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...