5EXCA

Photoconverted red fluorescent protein dendrfp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
NLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTLNLTVKEGAPLPFSYDILTTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Crystal structure of the fluorescent protein from Dendronephthya sp. in both green and photoconverted red forms.
pubmed doi rcsb
source organism Dendronephthya sp. ssal-2002
molecule tags Fluorescent protein
total genus 8
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 5excA00
3CFHL 2G2SA 3CFFL 2A53A 2A50A 2G3DA 3LF4A 2A56A 2A54A 2A52A 5EXCA 2GW4A 2G16A 3CFAL 2G5ZA
chains in the Genus database with same CATH superfamily
4EFKA 3IODA 3QTTA 3EMOA 2GW4A 3IMEA 4DE5A 2A56A 3MXTA 1N2IA 4BHRA 3AG6A 4MUIA 1IHOA 2A52A 4IXJA 3IVGA 4FZJA 4MQ6A 1UFVA 4MULA 4G5FA 2A53A 2A7XA 2IECA 5BW0B 3Q10A 2RETA 3ISJA 3CFAL 3UA0A 4MUKA 2EJCA 1N2JA 3LE8A 5G2FA 2A84A 3IOCA 3MUEA 4MUFA 3CFHL 3IVXA 3CI0K 5HG0A 2A88A 3COZA 3CFFL 4EF6A 3IUBA 1N2BA 3HL6A 2I52A 2A50A 2G3DA 3IVCA 3IOEA 3INNA 3IMCA 5EXCA 3CFIA 1V8FA 2GR8A 3IOBA 1N2EA 3IMGA 2A54A 4MUEA 2GR7A 1N2GA 3IUEA 2OGFA 3COVA 1N2HA 4MUJA 4DDKA 1MOPA 5KWVA 3LF4A 3AG5A 4MUHA 3Q12A 2G5ZA 3CI0I 4MUNA 3N8HA 3UK2A 4DDHA 2G16A 2LMEA 3COYA 2A86A 2G2SA 3COWA 1N2OA 4MUGA 3UY4A 2X3FA 4DDMA 4G5YA
chains in the Genus database with same CATH topology
4EFKA 3IODA 3QTTA 2GW4A 3IMEA 4DE5A 2A56A 3MXTA 1N2IA 4BHRA 3AG6A 4MUIA 1IHOA 2A52A 4IXJA 3IVGA 4FZJA 4MQ6A 1UFVA 4MULA 4G5FA 2A53A 2A7XA 3Q10A 3ISJA 3CFAL 3UA0A 4MUKA 2EJCA 1N2JA 3LE8A 5G2FA 2A84A 3IOCA 3MUEA 4MUFA 3CFHL 3IVXA 5HG0A 2A88A 3COZA 3CFFL 4EF6A 3IUBA 1N2BA 3HL6A 2A50A 2G3DA 3IVCA 3IOEA 3INNA 3IMCA 5EXCA 1V8FA 3IOBA 1N2EA 3IMGA 2A54A 4MUEA 1N2GA 3IUEA 3COVA 1N2HA 4MUJA 4DDKA 1MOPA 5KWVA 3LF4A 3AG5A 4MUHA 3Q12A 2G5ZA 4MUNA 3N8HA 3UK2A 4DDHA 2G16A 3COYA 2A86A 2G2SA 3COWA 1N2OA 4MUGA 3UY4A 2X3FA 4DDMA 4G5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFH L;  2G2S A;  3CFF L;  2A53 A;  2A50 A;  2G3D A;  3LF4 A;  2A56 A;  2A54 A;  2A52 A;  5EXC A;  2GW4 A;  2G16 A;  3CFA L;  2G5Z A; 
#chains in the Genus database with same CATH topology
 4EFK A;  3IOD A;  3QTT A;  3EMO A;  2GW4 A;  3IME A;  4DE5 A;  2A56 A;  3MXT A;  1N2I A;  4BHR A;  3AG6 A;  4MUI A;  1IHO A;  2A52 A;  4IXJ A;  3IVG A;  4FZJ A;  4MQ6 A;  1UFV A;  4MUL A;  4G5F A;  2A53 A;  2A7X A;  2IEC A;  5BW0 B;  3Q10 A;  2RET A;  3ISJ A;  3CFA L;  3UA0 A;  4MUK A;  2EJC A;  1N2J A;  3LE8 A;  5G2F A;  2A84 A;  3IOC A;  3MUE A;  4MUF A;  3CFH L;  3IVX A;  3CI0 K;  5HG0 A;  2A88 A;  3COZ A;  3CFF L;  4EF6 A;  3IUB A;  1N2B A;  3HL6 A;  2I52 A;  2A50 A;  2G3D A;  3IVC A;  3IOE A;  3INN A;  3IMC A;  5EXC A;  3CFI A;  1V8F A;  2GR8 A;  3IOB A;  1N2E A;  3IMG A;  2A54 A;  4MUE A;  2GR7 A;  1N2G A;  3IUE A;  2OGF A;  3COV A;  1N2H A;  4MUJ A;  4DDK A;  1MOP A;  5KWV A;  3LF4 A;  3AG5 A;  4MUH A;  3Q12 A;  2G5Z A;  3CI0 I;  4MUN A;  3N8H A;  3UK2 A;  4DDH A;  2G16 A;  2LME A;  3COY A;  2A86 A;  2G2S A;  3COW A;  1N2O A;  4MUG A;  3UY4 A;  2X3F A;  4DDM A;  4G5Y A; 
#chains in the Genus database with same CATH homology
 4EFK A;  3IOD A;  3QTT A;  2GW4 A;  3IME A;  4DE5 A;  2A56 A;  3MXT A;  1N2I A;  4BHR A;  3AG6 A;  4MUI A;  1IHO A;  2A52 A;  4IXJ A;  3IVG A;  4FZJ A;  4MQ6 A;  1UFV A;  4MUL A;  4G5F A;  2A53 A;  2A7X A;  3Q10 A;  3ISJ A;  3CFA L;  3UA0 A;  4MUK A;  2EJC A;  1N2J A;  3LE8 A;  5G2F A;  2A84 A;  3IOC A;  3MUE A;  4MUF A;  3CFH L;  3IVX A;  5HG0 A;  2A88 A;  3COZ A;  3CFF L;  4EF6 A;  3IUB A;  1N2B A;  3HL6 A;  2A50 A;  2G3D A;  3IVC A;  3IOE A;  3INN A;  3IMC A;  5EXC A;  1V8F A;  3IOB A;  1N2E A;  3IMG A;  2A54 A;  4MUE A;  1N2G A;  3IUE A;  3COV A;  1N2H A;  4MUJ A;  4DDK A;  1MOP A;  5KWV A;  3LF4 A;  3AG5 A;  4MUH A;  3Q12 A;  2G5Z A;  4MUN A;  3N8H A;  3UK2 A;  4DDH A;  2G16 A;  3COY A;  2A86 A;  2G2S A;  3COW A;  1N2O A;  4MUG A;  3UY4 A;  2X3F A;  4DDM A;  4G5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...