4MUHA

Crystal structure of pantothenate synthetase in complex with 2-(2-(5-acetamido-1,3,4-thiadiazol-2-ylsulfonylcarbamoyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
286
structure length
286
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 97
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4muhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4muhA01
2A86A 4DDHA 1KAMA 1KR2A 1R6UA 5IHXA 4F4HA 1G8HA 1WXHA 2H2AA 4YP5A 3P0HA 4MW5A 3SZGA 3KT3A 2IJGX 2CV1A 1FYDA 4JFAA 1LW7A 1NUTA 3FG9A 1IQUA 4OJMX 1DNPA 1NSYA 2OV4A 4K0RA 1OWMA 2DEUA 4I6GA 4A91A 5H16A 2QJTA 3M5WA 3ZIUA 1XNHA 4NATA 3ND5A 3CVYA 1QNFA 3IMCA 2PZBA 3KFLA 1IRXA 1P7PA 3FOCA 1KQNA 4ZT2A 4MUJA 1TYDE 2PIDA 3E27A 4MUIA 1EFPB 4MUKA 1JECA 3KT0A 4EFKA 3AG6A 3SEQA 3ZJTA 4MW9A 1H3FA 1N2JA 1K4MA 3MLAA 3NBKA 4MW1A 3UK2A 3S3TA 1N2BA 4MAFA 3IMEA 2DXIA 1PFVA 3G6KA 2CYCA 3MXTA 3N05A 3SZ3A 3ISJA 4Q93A 1UFVA 1O96A 4CDMA 3TQOA 4Q16A 4MVCA 1WXIA 1GZUA 2WB2A 1JIIA 1VLHA 1H3EA 2E89A 1PG2A 3P0JA 3IUEA 3ND6A 1OWLA 3HGMA 1JGTA 1N75A 1M8FA 2O5RA 2A4MA 1MRZA 3QE4A 5TEWA 1WQ4A 3H99A 3RK1A 4MW2A 1SURA 2D54A 3CVVA 1U7XA 1YUMA 1J1ZA 3INNA 4GU5A 4OUDA 4AS1A 1Q11A 2HZ7A 1JIKA 3PNVA 1PG0A 2J09A 2QTMA 3U1VA 1YULA 1FFYA 1EFVB 2VTBB 1U3DA 1NUUA 4G6ZA 4UZEA 1MJHA 3CLSC 1EE1A 4RPIA 3D6UA 1QRTA 4QBTA 4J75A 4NAHA 1HYBA 2DERA 1EFVA 2VTBA 3G59A 2CUZA 1OBCA 2CSXA 1N2GA 4ARIA 2A1TS 1U0BB 2ZP1A 3GLVA 2X3FA 3CLTD 4ZCQA 5EKDA 1MB2A 1JZSA 4EG7A 5TEVA 1IFXA 2Z3VA 5DK4A 1NUSA 2QUIA 4PBSA 1U7DA 3H9BA 2WQ7A 5KHAA 4PBTA 3N2YA 2BTEA 3ELBA 2E0IA 1TYBE 3LOQA 4P2BA 4NDAA 3LCJA 1YIDA 1QU2A 3CLUC 3UY4A 5LFAA 1WXGA 2CYAA 1EXDA 4MVYA 2JANA 3QTTA 1I6KA 2D5BA 1OWPA 2NSYA 3UC5A 3N8HA 4CQNA 4G5YA 4DE5A 1TYCA 1N77A 4KPUB 1EUYA 1XJQA 1N1DA 1QJCA 2WQ6A 3L92A 1O95C 2B7LA 1WY5A 4U63A 1I6MA 1QQTA 2QUHA 2QTNA 5J5AA 1JIJA 4XSVA 3TZLA 3HMQA 4R2LA 4XFJA 1Q19A 1IQ0A 1NP7A 4ZT7A 2Z08A 5IJXA 1ZUNA 3IUBA 1PFUA 1I6LA 1G8GA 3BL5A 4G5FA 4JXZA 3DPIA 3VU8A 5J58A 3P0IA 3ZJUA 1O94D 3AG5A 4MVWA 2IELA 4MWCA 3RK0A 1ZH0A 2CFOA 3AKZA 3AIIA 3GUZA 4TS1A 1VBNA 3ZXSA 1O6BA 4MUEA 4MQ6A 3NBAA 3CVWA 1F7UA 1MC1A 1MOPA 1PFYA 1M8GA 1OD6A 2YWBA 4CDNA 5DASA 3G5AA 3ND7A 3I05A 4RUKA 4U7JA 2QUJA 5KWVA 4XFDA 5DB4A 1B6TA 5HG0A 2C5SA 1GPMA 1A8HA 3IOCA 1EFPA 2Z09A 3CLRD 4MW6A 1M8KA 4U8HA 3SEZA 5HUHA 2CV0A 1G8FA 1BS2A 1KP3A 2A1TR 3RBAA 1WXEA 2AZXA 2X1LA 4EG4A 1KAQA 2YY5A 1WQ3A 3KT6A 3FHJA 1JILA 3PNBA 1IH8A 4MW4A 1N78A 1WXFA 3D6VA 1ILEA 1O97D 3SDBA 1GLNA 1CT9A 1QTQA 2A1UB 1KKUA 1O5TA 3Q10A 1V47A 1VBMA 3SYTA 4DDMA 2PFSA 1MBZA 2X0KA 4BWVA 2E18A 1M8JA 2EL7A 2CV2A 5K0TA 1IQRA 1Q77A 1MAUA 5AHWA 3JXEA 1RQGA 3X1MA 1J09A 1D2RA 1R6XA 3F3MA 4ZCSA 2XRYA 2V0GA 4EF6A 4HJXA 3UOWA 1U3CA 3KT8A 1QRUA 3HFJA 1X8XA 3TZEA 3PNYA 2BYTA 2I1LA 2VXOA 3OP1A 4ND7A 1T9GS 2YWCA 2IP1A 1KH1A 2TS1A 4QREA 1LI7A 3P52A 2EJCA 3A4IA 4EG1A 3ILVA 2V0CA 4EG3A 2DUMA 4S1OA 5TS2A 3A2KA 1TFUA 5HUJA 3HL4A 4JYZA 2D13A 2J07A 4CT0A 5H7XA 1N2HA 5KCMA 2PZ8A 3DLAA 2H29A 1K4KA 2NZ2A 1JEDA 2OQ2A 2A88A 1KH2A 1NUPA 3IVCA 2QTRA 4WSOA 1V8FA 3IMGA 1I2DA 3K32A 4R2MA 1EUQA 1VL2A 1F9AA 4KR9A 1O0CA 1H1TA 3RHSA 1JZQA 4H3SA 4MUGA 1T6ZA 1K97A 4MLPA 3TS1A 4PY2A 3DV2A 1N2EA 1NI5A 2PXHA 3H97A 4L2IB 1ULHA 1Y42X 2PG3A 3CVXA 1J1UA 5FO1A 3IH5A 1IHOA 4MUFA 4R0NA 3CLTC 1JMVA 1YI8A 4ZCPA 5BNZA 4ZT6A 4JZYA 2HMAA 4ZT3A 3AL0C 4MVXA 3HV0A 2DPLA 4KPUA 1IVSA 2AG6A 3COWA 2PZAA 5F23A 3L93A 4EGAA 2GM3A 3MMXA 3FIUA 2DLCX 3C8ZA 4DLPA 4AQ7A 4KKVA 4J76A 4FZJA 4ZT4A 4KR7A 1M1ZA 3FDXA 4EG6A 4ND6A 3X1JA 1NZJA 1EJ2A 5JBNA 1G59A 4NZPA 5J59A 1WKBA 1J20A 3Q12A 5LM3A 2JAXA 1KQPA 3VGJA 4MW0A 2GKSA 2J4DA 1N2IA 2X1MA 1NYLA 1KP2A 1TQ8A 3ZGZA 5K0SA 1COZA 2AKEA 1KH3A 3TQIA 2R5WA 2QJFA 2YXNA 1GTSA 1T9GR 4PBRA 1OWNA 3LE8A 4NX2A 5DEOA 1NURA 4ZCRA 3HZRA 1XNJA 1VBKA 1O96B 1O94C 4WNYA 1MAWA 4YMIA 4EG5A 2RD2A 3N9IA 5FNZA 2DETA 5TGTA 2XRZA 3QTBA 1WZ2A 4DDKA 3IOEA 1F4LA 1H3NA 1KQOA 1JEEA 2CYBA 1M8PA 3OTWA 3RFFA 4DNXA 1M83A 1TEZA 3IDFA 4HPWA 3CLSD 1QU3A 1K92A 4I6JA 3SP1A 3MLBA 3IOBA 3PXUA 4DJAA 3FI0A 3DO8A 3H9CA 1NUQA 3Q4GA 2O8VA 4I6EA 1WJGA 4GRIA 2A1UA 4HJRA 2A7XA 4E1AA 5LLTA 3CLRC 3FETA 4OUDB 3CR8A 4ARCA 4MWDA 1GAXA 1JHDA 2WSIA 4HK4A 1X6VA 1YUNA 1OWOA 4QRDA 2J5BA 2J08A 4NAUA 3COYA 2QUKA 1MB9A 2ZUFA 4KR6A 3AFHA 1LI5A 4X0EA 1ZJWA 1R6TA 1TYAE 4YBRA 2HGZA 4YP6A 3A04A 3COZA 3FWKA 5FO0A 3CLUD 1O97C 1GTRA 2ZUEA 2G36A 1S4MA 1N3LA 3FH0A 4MW7A 4MUHA 2QJOA 4YP7A 2DR2A 3VRHA 2E21A 1YIAA 2RE8A 1T6XA 3IVXA 3ZXIA 3A05A 3MUEA 4ZCTA 1O95D 1ZH6A 1O0BA 1WOYA 4F3RA 4MUNA 1N2OA 3ZUGA 3UMVA 3CA8A 4MWEA 2A84A 1J21A 4MULA 3IODA 3TNJA 1J70A 3RJZA 1XNGA 1KORA 3K9WA 3X1KA 3GMIA 1Q15A 2JA2A 1T6YA 3COVA 4K03A 3CVUA 4UZFA 2CT8A 3FY4A 3PRHA 3FNRA 1GN8A 1PFWA 4MWBA 4ZT5A 4JXXA 2GOYA 3IVGA 1OBHA 3ZJVA 1F7VA 3H05A 4L2IA 3NV7A 4EG8A 1QRSA
chains in the Genus database with same CATH superfamily
3FYUB 1AUVA 3G88A 1GU7A 2XZPA 1V1MB 3KLPX 3AHFA 3L05A 3D6AA 4TTVA 3SVZA 2G2SA 2EKLA 3D7LA 2WBLC 2QE7D 1RYYA 1JQBA 1ZD9A 1GEEA 2RSLA 4YP5A 2RCNA 2NV2B 2WZDA 1IWOA 3SCZA 4RTOA 1LSJA 2V6BA 1ZWKA 2C4KA 4A10A 1XF9A 1F5NA 1ZN7A 3GUYA 3Q6MA 1OI3A 1RPJA 3QHQA 2P9TA 2VYND 3I1JA 4NS4A 3GAFA 4NU5A 5DPMA 5MFZA 1ZD3A 3MVEA 1G41A 1RKQA 1SN7A 1SVWA 4L22A 4V3CA 3I01A 1EXVA 1JG6A 4FWIB 5H16A 2CUNA 4GH5A 1FQKA 1PWXA 1A97A 1K0UA 2Z8YM 4IQ4A 4K9QA 2R6FA 3GFQA 3W7BA 4OQPA 4OQFA 4MB6A 5FOVA 3B1ZA 5EJ4A 2IEGA 4QBFA 3WMGA 2IYTA 1OV4A 2ZT8A 1H2FA 3BWVA 3KJFA 2ZYHA 4E5SA 3NYWA 3O4GA 2OCBA 3MWGA 3NBQA 1PJSA 3NP9A 3VNBA 1QYWA 3BHNA 5H81A 5LZ4A 1N0WA 1UM9B 4DBVO 4DL9A 4BLOA 5EJ7A 3FOCA 3M3DA 4MGKR 3WAJA 3QQ5A 1JH8A 3QJGA 2DWPA 4I99A 4D80A 5DIFA 4EFKA 3AG6A 2FMXA 3JW8A 1INLA 1N0UA 3FTDA 1QHHA 2QDXA 1WUTA 2H0AA 3FTCA 1RRGA 4EB0A 2EBUA 2GCNA 4TV9F 3OM1A 1XZQA 1Z4MA 2FMKA 3N58A 2B6HA 3IQEA 1A2OA 1M34B 3C4QA 5DLEA 4LJAA 5FX2A 4M86A 3S5JA 3QV1A 1GGNA 2Q1TA 2PEYA 4LRUA 1E3IA 2EV9A 5D01A 2QWXA 5FV4A 2JI9A 2KQUA 3I39X 4A0RA 2VWQA 3R5HA 5HVNA 1GZUA 3X3HA 1JQKA 4HZGA 3T7KA 2YOGA 3GT0A 3HU5A 3PXDA 5C1OA 3MGGA 2VJPA 1ZS9A 3L7BA 5LPNA 5AUPB 4NG5A 1PR1A 1TKRA 4HGQA 2GYVA 2J3KA 2Q7XA 3AQIA 1KIFA 1Z2NX 5ARCA 2DUWA 5DP2A 3M89A 4B3DA 1RVV1 3DB2A 1JLLB 3IP7A 1BHSA 3VVCA 4B45A 5JQGB 2LD4A 4EB6A 2QROA 4JEUA 2RB5A 1F1BA 3F49S 3A3PA 4RZ2A 5DU2A 4ZYXA 3E61A 4MW2A 5KQMA 2X0JA 1O58A 1FLVA 4YRJA 3T9EA 1Y7LA 2A5GA 3M3HA 5TF4A 2FPGB 3TAHA 2MYTA 1L1FA 1HFKA 2BOVA 2PZLA 4KK3A 2O8FB 5FPTA 1NLFA 3RFUA 1J0AA 3FGNA 4NEHB 5DXJA 5K51A 1ZRMA 3GZNA 1JWBB 3HZZA 4DUPA 1JE1A 2ABWA 2F9MA 3AKDA 4HDKB 3IYLW 5HF6A 3UW3A 1G64A 5COAA 3VSAA 2E82A 4JLAA 1VBFA 2JPDA 2Y67A 3ICPA 3EGDA 4KQKA 5F1PA 2UV8A 3UJ6A 1FP1D 3AEXA 4TQUS 1QAOA 3D6UA 4N5DA 3OURA 5I7OA 2PWYA 1WXXA 4YAWA 5FADA 3A6KA 3GPDG 2NSLA 5K01A 4I3GA 3G2QA 3IJEB 1LXCA 4WESA 4MMYB 3JYNA 2WVJA 2IF2A 1VE7A 4MGYR 4MHSA 2G9NA 3D0RA 3QF4A 1JR3D 2G9VA 5TEVA 1JBQA 3FUVA 1D4OA 4ARSA 4OI4A 1LB1B 3FSGA 1TMOA 2DQYA 3K5PA 1VKJA 2NO9A 1A2KC 1YB1A 1Z0JA 4PBTA 3WNCA 5EE1A 4HLCA 1Q0ZA 2FJPA 1EB8A 4KFSA 1N3YA 2PLRA 3TKYA 4KE6A 4YIHA 1QLWA 1T4MA 4B48A 2I8LA 2PE5A 5KNBH 4XVRA 2XUKA 1N8NA 3RC8A 2Q4TA 4GMDA 4CM9A 1GPNA 3EYWA 4BIMA 2ZRCA 3PC6A 2XKJE 1FFGA 1N2ZA 1OAKA 2HMVA 3E3MA 2OHOA 3OCJA 4JP8A 4LISA 1OWPA 1QR2A 2PCJA 4ZRDA 4FFDA 2DCUA 3RT9A 2JDIA 2FSUA 3PEVA 3A1SA 4DDVA 4Z7NB 5AH0A 1Y4SA 3W5HA 1D8TA 2REBA 1N77A 2BVNA 2GILA 1B0PA 1WULS 4LHEA 5CFLA 1AXGA 2LWIA 1EWRA 3VSDA 1J39A 1P7CA 2XYPA 4XYEA 1SU7A 2XQKA 5JZSA 3CX8A 1R9GA 3SY8A 3TTVA 1WHSA 4DREA 5EP4A 1X9GA 2Z4RA 1XPRA 3T7JA 2VRBA 1SPXA 3TIIA 3TKLA 3VH4A 3JARB 5SZIA 1Q14A 1PKEA 1U8FO 1Y1LA 4PYMA 2Y4OA 1Z8NA 3AJ8A 3KSAC 1IY2A 1I5OA 2JI6A 1EQAA 4DOMA 5CITA 1L8OA 4OFXA 3TRDA 3QELA 2BEVB 2IZ6A 3UG6A 2Q3JA 7MDHA 4KITB 1O94D 4MVWA 3STTA 3M5DA 3IOMA 1DXHA 1QGUB 1N57A 3GUCA 1N4DA 4IEEA 4OJNA 1KYWA 5CVJA 3W4KA 1VE9A 1GU0A 3WRVA 1BVUA 2OHXA 1AKTA 1SC4A 2AA3A 2HCJB 3QVLA 3TCKA 1K5PA 1NNSA 1I4TD 2HLDD 4OPMA 4LXGA 2WHPA 1IY8A 3D02A 2E4AA 1C4OA 2FSVC 4Q1BA 3DXZA 6GPBA 1F14A 1N6NA 1NUAA 3HABA 5A7HA 2YASA 4XVHA 3LWZA 4JUFA 4MTCA 4GZLA 1D6JA 1ZW6A 2WYIA 3IPCA 4TSFA 1UODA 2X4LA 4K05A 4U02A 4X3OA 3SOPA 4UXIA 1MX3A 2Q5QA 3C43A 3ZGYA 5KC9A 2C8VA 1KEEA 1PT6A 4MMXB 4F85A 4M9ZA 3GGOA 4U8HA 2CXSA 3TOZA 4KWHA 1PJ8A 2GRAA 2V7VA 4JD5A 2JJ1D 5DX0A 5A9TA 4N5LA 3U4DA 4K86A 4XIIA 1WXEA 2AZXA 3NFRA 1FNMA 3EFBA 1PT5A 2NPIA 2FYTA 3IBTA 5CBPB 1WP9A 2AOXA 5JYEA 1RZRA 6PFKA 1VKRA 1X8LA 4FJ2A 4REQA 5B36A 2E6KA 1U04A 1YRHA 4QXQA 3CX6A 5FQOA 2HBZA 3SBEA 2JFPA 2B0JA 4UE2A 4V39A 1GQFA 5COQA 5SZHB 4TVOA 1PNTA 1JIVA 1IPHA 1PK8A 1SCBA 4Y30A 3WFIA 4AP5A 4BKUA 1XA3A 1O97D 2W90A 2EOAA 2IE8A 2WDZA 3A1EA 4U39A 1VYTA 3IMFA 5CYGA 1VJ0A 3T61A 1P72A 4L4ZA 1XTJA 1PHPA 1WB4A 3KIPA 3HU3A 1V47A 5FBKA 4M49A 4X8HA 2EERA 3MTQA 4DDMA 4BMNA 1QFMA 1VRCA 4RV4A 3ZLJA 1OXMA 1E2FA 2WSBA 5AOBA 3ZV3A 2EL7A 3GBSA 1G0NA 2YJNA 2CV2A 4KC0A 3UHPA 3PQDA 3IKMB 4JMLA 4KAXA 2J9FA 1M6HA 4D9CA 3HM2A 3K05A 5EZYB 3OOJA 1A77A 1WABA 4I4CA 4Z0PA 4X1IB 5B7PA 3GLUA 4RNCA 3VC7A 1P4HA 1CUAA 4IDBA 3TZEA 1EVQA 1MEJA 4A5SA 3R2JA 4D99A 1CD5A 2WM3A 1SUFA 3B1YA 4R9NA 1K3FA 4B75A 5CHYA 4BV3A 4ND7A 4DMRA 1CWUA 2IP1A 2NXEA 3E7DA 5FV7A 1WUJS 2H4XA 1JTEA 1MDFA 1C1XA 2EKQA 3CNEA 4KAAA 4BKQA 4EABA 1JR4A 1PG5A 1Q92A 3EZ6A 4HMPA 3BD8A 2EKZA 2HK7A 4E4YA 5B4UA 2Q9CA 2O7RA 4TN5A 3B53X 3BJRA 2IPXA 1FS5A 3IBSA 4ZXPA 2WF7A 3PHHA 4W1SA 3G82C 3UQZA 2HK6A 4R2KA 5L3ZA 3SNKA 4HQNA 3KE8A 1Y8CA 3BTVA 3IKJA 3JWPA 1XZIA 2A14A 2Q5EA 3P2IA 4HY3A 4HQRA 2EEZA 1TYZA 3MTIA 4TTQA 1LPOA 1AJEA 3D2CA 3EUAA 4PC1A 1E2GA 5EWLB 4R83A 1W46A 5FL3A 2GJKA 1KDVA 5I47A 3ZGOA 2VRNA 1X1QA 2HEIA 4IOKA 1YWGO 4K81B 1FS6A 3DEJA 4MSUA 3M1IA 2NVWA 5CFMA 1U0GA 1FLNA 2QT1A 2Q7DA 3EPHA 1R8XA 3I0NA 3CF2A 4MLPA 2X2FA 1GU1A 3HB5X 2O14A 2OGZA 4I1IA 4F9EA 1IJFA 1N2EA 3KV1A 1U98A 4XIJA 4Q1FA 4C3ZA 1X77A 3QYFA 4QNNA 2A9RA 1Y42X 3LHKA 2B1QA 2PG3A 5K3FB 4PZDA 3ZWVA 1X7GA 3LCCA 3OZ7A 1CF9A 3F3YA 3RJ5A 5BY2A 2O05A 1T9DA 2HSJA 3UWMA 4WNAB 2P2LA 1B1AA 4A2PA 1UXHA 3HY4A 1LLQA 4JP5A 1DLIA 3P9NA 3GFPA 1YACA 4FDLA 4MVXA 4EY6A 3UWPA 3AL0C 2FE4A 1RBMA 4PLZA 4YRCA 2DGDA 2VH5R 2JCYA 1HDRA 4ZK2A 2PZAA 1QH1B 2VHYA 1I0IA 3KYDA 4TYYA 1YQ9A 2F3RA 1N9ZA 1XFAA 2TMGA 3AUTA 3COJA 8ADHA 1KY4A 3M6LA 3CXRA 3QITA 4G8JA 1MO2A 1S2OA 2Y1OA 3CX4A 5IMBA 3SZMA 2FXIA 1LD3A 3A1NA 3E2PA 4RIHA 2JFBA 2NNWB 3FHTA 1G59A 3F7OA 2H48A 4EVRA 5J59A 1CUXA 3Q12A 2AGVA 1G19A 3ZEIA 1ORHA 2QM3A 3BWDD 1D9XA 3DHVA 5DCWA 4JI8B 4CNBA 4I5DA 1P3Y1 1IBCA 5IJ0A 2ECKA 3BWYA 2GN0A 5HJ2A 1EFCA 4TWBA 4CKEA 3RVQA 2DSNA 1HTBA 1TZJA 2EJTA 1E20A 4DQVA 1OE0A 1UFOA 3D1JA 4D4KA 1PZHA 1WR8A 3DKKA 5AW8A 1AU9A 4OD0A 4AN1A 3KKPA 4EUHA 4M54A 3GFFA 2IX9A 3ZYCA 1VMDA 3KV3O 5TE9A 1K5GA 5ALUA 4C1BA 3RADC 2DUNA 5BQPA 1U8UA 3AR9A 4MVJM 4CE6A 4PG8A 2GF0A 3PT5A 5DCYA 2EQAA 5DEOA 3ACCA 5J2UF 4DLSA 1NY6A 3KB6A 1K08A 3GGPA 3NORA 3SNHA 3WWEA 3RAEC 3EMVA 1U8AA 2IHVA 4GPEA 3BFXA 1GZ4A 1SUCA 1DBRA 3CONA 1W96A 1ZYUA 4GKAA 4O4IB 4RD3A 1O94C 3JRNA 1J2EA 1YBFA 4ENTA 3O90A 4PQRA 2XWBF 3AP1A 5CJ2A 4KQWA 4M9SA 4V2IA 3PXAA 1KFJB 3TQFA 5C46F 5TGTA 1S3FA 1C30B 4FQ8A 2A92A 3QTBA 4ISCA 4ZEWA 2VDKB 3RVJA 3VM6A 4BECA 2KW5A 2WF9A 3QLEA 1L1QA 4LUCA 1C0LA 3L79A 1JEEA 2OOKA 3KQSA 4NWIA 1CUWA 2REQA 4HRYA 1M8PA 1QAQA 3KHSA 5ELMA 4E7OA 2WKPA 2O0KA 2QNIA 3Q7RA 1NP3A 3A31A 3DAPA 3UT5A 1L5HB 1PJ2A 1UP6A 1B14A 3MC1A 3R6WA 2JAUA 4GPAA 3SP1A 1XNQB 5H3HA 4KMMA 1H5QA 3OQHA 3ZZMA 4BGEA 2Q6VA 3DO8A 4OF4A 2E55A 2FEWB 4UUNA 1OX4A 3TZQA 3BORA 4PX9A 4XUGB 5A62A 3VH1A 1WDMA 4IDNA 2UKDA 4PHFA 1FFXA 4YREA 1ABBA 1PGOA 3NTVA 3R7FA 5IM4F 1X6VA 3L6DA 4GWGA 2HF9A 4QRDA 2YZKA 1SUAA 1WSBA 3B38A 1RYEA 4UM9D 3OQIA 4QOFA 4BBPA 5KQPA 1SXHA 3WRYC 1I3CA 1NXQA 3JQDA 3ZWMA 2HX1A 1BO6A 4OMDA 3SDSA 4WACA 2HA6A 1GL9B 1ZXXA 2RIRA 1E7MA 2VAVA 2VQ6A 1I3OA 1QQ5A 5FD8A 3R8FA 1W48A 1OILA 2PLAA 4F6CA 5ADWA 2R00C 1O97C 2DLCX 2X3YA 5I3ZA 1JS1X 3MMNA 2ILVA 1UBCA 3THYB 5DSZA 2BE9A 1JMKC 2MDTA 2EFJA 2XMCA 4UULA 3PQ3A 3L6OO 4F84A 4N49A 4ZVTA 5KVVA 3IAM6 5C7YA 3AY0A 4PLVA 4N3NA 4QBIA 4EPTA 4OHWA 5ITSA 2NYAA 2AOUB 2H9AA 2D5LA 2Y1KA 3GVIA 3D8BA 1Z5UA 1XQ6A 5ECDA 1OH6A 2WIAA 4UCXA 2FJUA 4DC1A 1O95D 3GWGA 2R11A 2YHBA 4O0LA 4WXPA 3SC2B 3K0FB 4W1PA 1A4XA 1Y6RA 4HBGA 4JWTA 3VC3A 1MC8A 4DWJA 3BRWA 1I1HA 1Q0HA 1X39A 3OEEA 4KQXA 1KFBB 4MJ3A 5DHUA 3PYMA 4NJEB 2CXTA 3CFIA 2Q07A 1WHTA 4OXXA 1OU4A 5CVTA 3C2QA 1J22A 3FPCA 4NU6A 3HRIA 1ZCFA 4U00A 3TNYA 5CA0B 3ZVMA 2D8AA 3T1HB 4AZSA 2PWPA 1XTPA 1DT5A 1QK3A 2IYWA 3QVSA 4AXXA 1M34E 1SVNA 3O0TA 1F48A 3SIXA 3VHLB 1NU6A 5BSWA 3K0AB 2WU4A 3GMDA 1WW3A 1YQDA 1XVTA 3HPQA 3KRTA 1VHQA 2YXEA 1HO3A 3ORSA 4MV1A 1KJQA 2F43A 1FQJA 3H87A 4IVQA 3H05A 2OK8A 3WWOA 4OX9B 2WJ3A 4M88A 1AS0A 4MIKA 2A86A 4DMLA 4IQ0A 1W0JA 1XU7A 3TVYA 3RYTC 3UO8B 3D7NA 2C04A 2IX3A 4LQ4A 2FPRA 2QZJA 3PLRA 4OXNA 4RQTA 2DKOA 4ZHQB 4PCUA 5T57A 4PX5A 3E8SA 3ELWA 2PO7A 2W2LA 1E1CB 1AHIA 1SRQA 2WJAA 3ECCA 2IV3A 2HPHA 3P0HA 3J81A 1TEVA 5GZ6A 3I73A 2DPMA 4PFJA 3B9QA 3O84A 3KPYA 3MT9A 4JFAA 2YH2A 2XLBA 4OJMX 5KYGA 5BN3A 1VLMA 2XOKD 4UCQA 1E1RD 5JQGF 3F96A 1TU0A 3VZQA 1U3GA 3UMJA 3INTA 4DNFA 4KVAA 2GJAA 2H4FA 4QGBA 1I0ZA 1Z16A 1IUOA 1UDWA 2UZ3A 4B7ZA 1U2DA 1B93A 2I0FA 1TA9A 3ANLA 3LDGA 1MGOA 3C6XA 4UDOA 1QHHB 1RM4A 1QNLA 2HRRA 2PZBA 3G1WA 3KUCA 4NNJA 4BBJA 1FLAA 4JQSA 4PW0A 3ZK7A 2Q1SA 3G17A 3G5MA 1K75A 4BMXA 1KEWA 1L2TA 3K1YA 2RJOA 1WNFA 3JS5A 1KTVA 3RUIA 2IXTA 3L8CA 1KRWA 1CW2B 2JFGA 1JAHA 4XWGA 2ILTA 3OJXA 4NH0A 3JR7A 4BOYA 4DLLA 4F56A 1XTTA 3KXDA 2BEUA 4WXEA 1ETHA 4KIGA 2GDJA 1KSHA 1N6KA 1KEVA 2DUJA 2P0AA 3MLAA 2NO5A 2CNDA 5HOEA 2Q6IA 3D3QA 4M1YA 4MAFA 1O2DA 3EB9A 1E2LA 1P6QA 1QS0A 2EDCA 3KOMA 4F86A 4ZFNA 2PBRA 1XLTA 4Q9KA 3L7YA 2C7QA 3HBNA 1VJRA 2P7IA 3G2LA 3L8HA 4Z51A 3LD9A 3TQOA 1ECJA 3DBLA 4YVFA 4MVCA 5GTDA 1NONA 2Z5LA 1UAGA 3NVMB 5KX5B 2VDJA 4QLAA 3T3NA 1EX1A 1CERA 1P0IA 1LZKA 2NO7A 3A11A 3D7RA 1U9YA 3CZCA 3GI1A 2OGWA 3IJ5A 3ND6A 4HYEA 4MWSA 1MV8A 4DIUA 1MEOA 3W3AA 3EEOA 5DWQA 1MIOA 1E2QA 3B1VA 4DT1A 2XUOA 2CCKA 3TR6A 1RWWA 3LX5A 4DR3B 4TZ6A 1W52X 3L7LA 3OIWA 3GRRA 1KF0A 1M8FA 2H2WA 1C3LA 1XL1A 2AJCA 2O5RA 2X5XA 3QF7A 4XWYA 5A4MS 1ZRSA 1MRZA 3AILA 4BNGA 4ZEVA 4JLSA 3IE2A 1DC7A 1WQ4A 1I33A 1Q57A 2C9YA 2NTJA 3KYCB 4G1CA 5KOHA 2X9GA 3TD9A 4PGFA 1G4UR 1ORDA 1U2GC 2W00A 1J1ZA 4L3WA 4ML3A 3PGA1 4FFPA 2PZJA 2C2XA 3DXYA 1NBOA 3EW7A 1PG0A 2D59A 3GYBA 2J7KA 1Q7RA 3IDZA 4JL5A 4GBED 4MQFB 4NONA 4X1OA 4Y2RA 1XVAA 3CO5A 4J0GA 1JEYA 5FNVA 1NBIA 2HK8A 5GPBA 2HM7A 1GPUA 2AX4A 1B4DA 4BE7B 4EHJA 4UEOA 1D1PA 3MYYA 4WZAE 4PONA 1L7OA 1JB9A 3B48A 4QBTA 3DAHA 3FPBA 1YGPA 2JJ8A 5CVCA 3EUFA 2IU3A 4WOCA 4DZZA 2PCLA 2YHIB 3A4NA 4JLWA 4WK4B 2GTIA 2FWAA 1HT3A 1BE6A 5ALFA 4PYJA 5BUCA 3CLTD 3P2JA 2PT9A 4GX2A 3S68A 3OKFA 4BAUA 4EG7A 4RHFA 3UM9A 3P4UA 2PSEA 5IARA 3N7AA 5DYIA 4B6OA 1TA0A 5JARA 4K0KB 1IPEA 3K8YA 4FSDA 3AM3A 5TQ0B 5JRZA 3EGXA 3M81A 4YH1A 2OBFA 5L40A 2P3SA 2J67A 3HXMA 1I9GA 1VHJA 4NDAA 2GDZA 2OLKA 3BD6A 5F3RA 3I9KA 1GDDA 4OAQA 4DJFC 4EIWA 1OT5A 1WXGA 2RH8A 3OG9A 5IKPA 5BV1A 3HCOA 3NQ41 2B25A 5BYAA 1XRRA 2UYYA 3A9UA 1H0SA 1YUBA 2OP0A 1NOIA 5KNDA 1KO4A 1QONA 4RGVA 4WZBB 5DGIA 4D8UA 3RIXA 4TM7A 3U3MA 5F78A 5KYUA 5EOVA 3UBMA 4OH7A 4EX7A 2ZTLA 3EVAA 1ZR4A 1O95C 1UIRA 3PYXA 2PGNA 1MW9X 4N4AA 2W8BB 4Q4JA 2V59A 1UPUA 2B69A 1DBQA 1W5TA 2QUHA 1WV0A 3T1QA 3VGPA 5JYBA 4IOMA 3LY5A 5DM4A 1U31A 3BN3A 2HBRA 2Q45A 2FZKA 2PFGA 2PV0A 1AQ6A 3MJVA 1FFBA 5CYPA 3TZLA 3ZWAA 1Q19A 3QUTA 1H5NA 3PPXA 3QK7A 3R3HA 3KQWA 5F21A 2ZXUA 3FTFA 2C7PA 5DRTA 1AGPA 5DCUA 3UA3A 4UUBA 3BL5A 1FYFA 1IB6A 4DQDA 5J1TB 1V6AA 3KM0A 4UHDA 1DIRA 2O2IA 3RLIA 1ZWLA 4UU0A 3RYFB 2NZXA 3FOEC 2BHTA 1TEHA 2VNAA 2CFOA 4WFQA 2R6GA 2PL3A 3AIIA 1U9CA 5JWOA 1J06A 5DM70 5AVWA 4W6QA 4GVPA 4I3HA 3BE6A 2HUPA 5KTTA 1K98A 3NNNA 4RBNA 3UFXB 1RWVA 1U4OA 5JAZA 1RM3A 3IDSA 1U1EA 4KPGA 3KE9A 5IYZF 5EZYF 2IIPA 4B0OA 5BSHA 3T3HA 3O4FA 3AVVA 2OCYC 1DX6A 4K9NA 1G291 2PQ2A 3SF0A 2OV3A 4MH0R 1WUYA 3G8AA 1BGXT 4PZZA 5JS6A 3CRQA 1IAQA 1LU9A 3IVAA 3BRCA 3QWFA 3SEZA 1I5RA 1TEXA 5F77A 5I8ZA 4NBLA 5LL6P 1T4DA 2JFYA 1W0KD 2ZATA 4WTOA 3L4KA 4RL6A 3A1UA 2NXJA 1L7BA 2W4QA 2VTDA 4LXHA 2VJMB 1BH6A 3AEQB 2C2BA 2VF2A 3R23A 3FW1A 4P4UA 3GDFA 4Z9FA 2YY5A 1TZKA 3FWYA 3KT6A 3WL7A 5HJ7A 1XZPA 3ZCTA 1BDIA 2FFJA 3BB4A 5K3AA 1G5HA 1G38A 2UU9B 1C7RA 3C6MA 4K40A 3RWBA 3T34A 4MI9A 1IH8A 1N78A 3FPLA 4ZO4A 3LQFA 2VHCA 4LC0A 4H6WA 1Y5MA 1DO2A 4UC0A 3U44A 3EXIA 5GGYA 4C4AA 2Z2ZA 4D0RA 2ODBA 2B8WA 4GUDA 2H7YA 2MINA 4DLKA 3G0HA 4ESVA 2JBAB 2IEIA 4UDXX 5AK5A 3CHYA 2P40A 3AVWA 4G0PA 3G68A 1NP6A 4OCZA 3GVHA 3LVQE 3I32A 3U80A 1RRCA 4BWVA 4LCJA 4IXMA 3O2JA 1JYSA 2B1JA 3EEFA 1UZLA 2IYUA 3IGFA 2WOJA 4HAUA 4HQOA 4WK0B 4Q9LA 2HCFA 5E4JA 4R3NA 3U0BA 1PYDA 5DBHX 4DM3A 1JU4A 4YXWD 1CYEA 4N47A 5FYQA 3OO1A 1SQFA 3BULA 3G8YA 3UOWA 1VL5A 3V6MA 2EATA 4MQUA 2CEAA 2WC1A 2XB6A 4BCDA 2QY6A 1FX1A 3G2OA 4CTKA 2FEPA 5B2ZA 3VYSB 3SG0A 1PU2A 1N1EA 4KO1S 4HB0A 3R7LA 1B41A 3GEMA 3ZDDA 1WZEA 3O1JC 4KXYA 3ESBA 4RJ2A 2IGTA 3HJGA 5CLLA 5C9ZA 3B20A 4YUVA 1ADGA 3IPAA 2Q49A 2NQTA 3ER9A 2I76A 3S2SA 5D3ZA 4UM9B 1CUUA 3IB3A 3RRNA 1PS9A 3HUDA 1A88A 1Y63A 1NAIA 2CCGA 1GTG1 2GN9A 2O3SA 1UIMA 1CTQA 2RHJA 2V7XA 4MKRA 4O2AB 5F9MA 4CEHB 1YB4A 3EFEA 4X84A 4X7RA 2FQQA 4E4RA 1SCJA 4QELA 1GAWA 3WP1B 2VAWA 3BJEA 4BEVA 3WZ2A 1Q1AA 3NT4A 2V7QD 1Z62A 1RYMA 4C9BA 3TLGB 5LZ7A 1SHZA 1P0MA 3K3PA 1KDZA 3A6EA 2AN3A 4EVQA 1LLFA 4I8IA 4NPCA 5ALZA 4QQFA 1LV8A 4TXNA 1VLQA 4XPIA 2HFKA 1DGQA 4WX2B 1SXJD 2R96A 4EQ6A 4FYWA 4ER3A 4TWAA 1R50A 4ZAXA 3RUPA 2I4NA 4C7XA 3D6HA 5LXTA 1G6KA 4QJ4A 3DV0A 4ETNA 1ESNA 4B3TB 1CHNA 3DV2A 5CYOA 5FOWA 5TB5A 2O3UA 3ETHA 3ZU3A 4II7A 4DIBA 3GJYA 5FO1A 2DECA 3M2TA 1KRHA 2VH1A 3CLTC 3GLHA 1DKQA 1KZ6A 1RXUA 2VT6A 1OKKD 3MCAA 4O4IF 1V4BA 5J40A 3PEEA 5H70A 1H0KA 3WGUA 5A4AA 1NM5A 4RVCA 1HSOA 4Z0NA 4WBXC 4KPUA 5FPKA 3ORHA 4QYTA 1EGQA 4PRZA 4LGCA 1LQTA 1VKNA 2OFOA 1Q3HA 1ZJ5A 1ZN2A 2YYSA 3DOHA 3OC0A 4RAQA 3RS3A 1DC3A 4P2GA 4FLEA 3M34A 1V11A 2D7JA 2GK7A 1XTZA 4RMGA 2RAUA 4UVHA 1KE1A 3ZLBA 4ZJPA 3FFWA 1U7WA 4DZRA 3ZD8A 1WBJB 5B1YA 2AE1A 3CRNA 1CETA 1WZCA 3OWOA 2HQSA 2JKYA 1TECE 4JJZA 4TT3D 2PYZA 1N2SA 5FOSA 5KYTA 2RGRA 1ZITA 4ENUA 2NUAB 2Z8XA 1Q7TA 2G4VA 2RGDA 2J0QA 2OHJA 2Z8YA 4HAVA 4MQ4A 1UK9A 2FZ5A 4D3SA 3CRW1 3PX2A 3VGJA 4CTOA 5IAKA 1WPXA 3FVTA 1VYHA 3O3MB 2P6MA 3QLVA 2AEFA 1HDGO 4C20A 3VKUA 1UKEA 2BFEB 3X0DA 4DIMA 2GEUA 2BFNA 2NZWA 5KNBD 3PEWA 2FA9A 4MRAA 3TCXB 1KH3A 3G0BA 3K4QA 4GPZA 4JT8A 5CA1B 1AZSC 1XDSA 1P81A 1PVOA 1OXTA 3UIEA 2AD1A 2IUTA 2ZI3A 4IQFA 4RA6A 3U60B 1L5WA 1NX6A 1XVLA 1ZMBA 2FUCA 5F2OA 3WO0A 3NS7A 4CMAA 3TTSA 1G8PA 4S0XA 2GO7A 2P9ZA 2FLVA 3LPDA 3P5BA 4LZZA 3C3WA 5D3KA 5DISB 3F47A 3GP5A 3T9BA 1P6XA 4QBKA 2Z6UA 1G9SA 1IEWA 4WY5A 1ZR2A 1TRHA 5LQRA 3EIUA 5M34A 1Z26A 1YMQA 2WFMA 3C0KA 2GEFA 3UB4A 3H5RA 3MNFA 3A6HA 1KYQA 4E5YA 5F64A 1J8VA 3TOVA 3WBJA 4A8TA 4DR7B 2BCEA 2D00A 3ZOKA 5KIAA 3DZ8A 1XZEA 4HS9A 1OGYA 3DKRA 4G97A 1D2MA 1UZUA 4BO9A 3WLQA 1M0WA 4AG5A 2O2DA 1ORWA 3AOGA 3V9PA 5FXMA 1FFXB 1MF7A 1XEFA 4K9OA 2KE5A 1JR3E 4Y6QA 3KQNA 3RYCA 3QI2A 4CR7A 1K92A 1J0BA 3QXGA 1ONBA 4G1UC 3TW0A 4QAJA 3L41A 1XAHA 4BV2A 2O8VA 5HJEA 1CQPA 1SXIA 4I4TA 4RY0A 4ZTUB 3IP1A 4DBZA 3JZFA 5CA0F 2VJKA 4I9GA 4BO3A 4FU0A 1VJCA 4RV5A 2HYIC 1HTTA 4MVJP 2XUJA 2FU5C 1TT5B 4X97A 1VDZA 2Z1MA 3IRUA 1NVFA 4DTCA 5BYKA 3DZCA 1C7IA 5JASA 3GLFB 4BMDA 3GGGA 2WZQA 5ALGA 5K6RA 3OKCA 1RPAA 2IYSA 4JITA 4BAGA 5F98A 4IHJA 2ZUFA 2BFFA 1SCAA 4TLMB 4WFKA 1ZP6A 4Q9AA 1I7SB 4MRSA 4QUEA 2JAWA 5BW4A 4RCZA 3I5MA 2JLSA 3WWCA 1FQOA 5HEKA 3USZA 3C5CA 2CNBA 2Y77A 4YCDA 3SLKA 2ZUEA 4EITA 2PLNA 4ZHQF 3SSOA 1AB6A 4RLQA 3NHLA 1SUDA 1S4MA 2XVMA 4P3XA 5I6DA 3NBYC 1T36B 4YFYA 3HFGA 1TAUA 3I9MA 1CF4A 3E18A 1HRKA 1ECFA 2ISCA 4WH0A 1NBMD 3EGEA 5JS8A 1NZFA 1ID1A 1Q7GA 1SUEA 2Q2OA 4JT9A 4IICA 4UDYX 2GHIA 4N3GA 5AO9A 2JGFA 3I52A 3ROKA 1ZH6A 3OIFA 5JR3A 1HZJA 2QJWA 3A9VA 4MRMA 2W71A 1BU8A 1KOJA 1PEKE 2BMEA 1NT2A 2FPWA 2PD6A 2VHZA 4K28A 2O7NA 3MS4A 4BLUA 1Z9BA 4G5SA 2Z1NA 2BJHA 1IJBA 4GLFA 1JH9A 1DEHA 4MULA 1BSVA 1G2IA 3O21A 3E2IA 3PGLA 3NANA 4QC2A 2ISSD 3GJTA 4JVNA 3DJYA 3NEAA 4N0MA 1NR7A 1FDRA 2ISQA 4QTXA 5BMVF 1RC1A 2HNKA 2VJAA 1LQUA 2EARA 2X8WA 3CKYA 3GJRA 2VS1A 4M9RA 1ZIPA 4RELA 1QHSA 4YEDA 3WE7A 4ZEOA 3NTXA 5LYJB 3UA4A 1RTTA 4ZT5A 1RIFA 2GOYA 3BXZA 1Q50A 3CUWA 3GEPA 3P26A 4BO1A 4Y2GA 5ICGA 2OV2A 3RC1A 2ZIXA 4Y1RB 3NW9A 3O3OB 1K27A 3VR0A 3WHPA 1BE0A 3NV7A 3ESAA 4IIVA 3E9DA 2NWQA 2O0LA 3ZC3A 2WYVA 3JAMA 1LRJA 3OP4A 3U5TA 4UMVA 2R6DA 1R6UA 3OJLA 4K6MA 1ODJA 1S8NA 3CRZA 1ZUNB 1NGSA 2COKA 5KX5F 4MRRA 4ZA2A 4KREA 5H5JA 2I6SA 2VXYA 5HIIA 5EJMA 1SXJC 2IEZA 4LGVA 3T5MA 2D3WA 2CV1A 2NP6A 3RS4A 2VSXA 4NFHA 2XDQA 1AT1A 4JOCA 1FW8A 4BS9A 2HSGA 2WF6A 4AG3A 1LLCA 3UATA 5FBLB 3AMVA 2W83A 4KQEA 2CWDA 4YMHA 2PGDA 5ED4A 1ZUIA 1V71A 4GPIB 4Q3OA 1YA4A 3NRBA 2WFLB 4NIMA 2DY0A 1Z2AA 3ES9A 1RBYA 3KHUA 3NC0C 1KQFA 1GG5A 3L77A 4S2UA 4X3CA 5AVOA 1WDWB 2IGBA 4M8SA 4YRPA 2NVUA 3BX1A 2M2IA 3NYQA 4MYTA 2BDEA 1L4MA 3ITKA 4MUKA 1IK4A 5DM60 5BN1A 5I51A 4RD2A 4D43A 1U7PA 1OXXK 3SEQA 1RQ2A 1QK4A 4J29A 2RKWA 4YAJA 3C3BA 5B3KA 1Y33E 4PF1A 2RGNA 1JXAA 2DMRA 3SEAA 1E2NA 4ZJUA 1AN0A 4HUTA 1RS0A 4ZXFA 2O2EA 1VCMA 1JHZA 3AB8A 1WM1A 1QCYA 3O93A 3KZXA 1LPMA 3GCGA 2F9FA 3CKMA 2ATXA 1MIOB 2VHVA 1M6EX 3RTBA 3IHTA 3TW6A 5CDFA 5KWSA 1NLUA 2I2WA 4PG7A 5DNYB 1YR3A 5LBUA 4ILEA 1AK1A 2AFVA 5KTRA 1J1IA 2WJHA 5FL7A 1ODCA 3FR8A 3ZDEA 3QENA 4X90A 4K1XA 5C52B 2E89A 4HWOA 2X8JA 3HGMA 2NXWA 3UJAA 1MTOA 4TL8A 4YRDA 2HIMA 1Z0KA 4MPDA 1S8FA 4W9NC 3H4TA 5KAMA 2WWHA 4U3JB 1TNDA 5BWCA 5FNVB 3VR3A 4G1EB 2PL1A 2IC5A 2WD7B 2D0OB 4IFEA 5K3OA 1P73A 2GF2A 4EUKA 3KQQA 3BMQA 2C92A 3DD1A 4RZXA 1PBNA 4RY8A 4CDRA 3QA9A 1M6YA 1T0BA 2N47A 2QNRA 1ZM2A 1ZL2A 1JQ3A 1JIUA 4BC0A 5CX1B 3DG9A 3O8QA 4R81A 1NIPA 5BWLA 5FBWB 4NYIQ 5J4LA 3R20A 1WCYA 1Y34E 2JEZA 4P5EA 5ALLA 4ZREA 4BMCA 3WLSA 3WOHA 2BUAA 3GFGA 4HAWA 4UU8A 5FJIA 3WISA 1N33B 1WU8A 1REQB 2MSEB 1RP7A 4AUEA 3EXEA 4A6EA 1DO8A 2CVQA 3I5UA 1S0UA 1FDTA 1X0XA 1Y48E 2R4UA 3G2NA 4GOLD 2GASA 2AJBA 4LBYA 4X60A 5FFMA 4YCLA 5FYDA 3NATA 4JVMA 1SOAA 3FLEA 4UEJA 4QUBA 4XM1A 4J0CA 2IUUA 3OZVA 2HT6A 2X0EA 4BASA 3PVZA 5E0KB 4DLBA 4EY3A 4YV2A 2BMDA 1DG1G 1MB2A 4J7CA 4L8LA 4Q3BA 1WMBA 2XMQA 4G1MB 1VE3A 1NUSA 2G06A 5HF5A 1OFUA 1TO6A 5AVQA 4FS8A 1U7TA 3BWBA 1DBSA 3SQXA 1NI4B 3H9BA 3ZY2A 4XQEA 2HL6A 4B6PA 5BWNA 2ZS7A 1DADA 2RH9B 2Y0CA 3H0CA 3HEAA 3JZIA 3V42A 5CT8A 2I52A 4GOJA 4YXFA 4QASA 3LAWA 3KWFA 1PL7A 5JDCC 1DSSG 1HNNA 3T3EA 3QVTA 3STYA 1QZ3A 3VPBA 1ZK3A 4ROSA 1DC5A 2QN7A 2V3CC 1T1EA 4JYAB 2GXQA 4GOKA 2Z9DA 1N92A 3UY4A 4R05A 1ISHA 2JH8A 5A4KA 4INJA 5A7FA 1JVBA 3X1ZA 1BMTA 3C39A 2HHHB 4Y8VA 4HEJA 4OY3A 3CZ5A 3L9XA 3IE0A 5I48A 2IYQA 1D04A 3NNDA 4YRBA 2UYCA 3O92A 3B3FA 3ZG6A 1JL3A 4CJXA 1G8AA 3L6EA 3ZOZA 1X2BA 5B2FA 4WK6A 1RCFA 1OJLA 4CIAA 2R25B 1SXJB 4P3KA 5K4HA 1OH7A 4NBKA 4GOOD 2O8BA 1CRPA 2V7UA 2VG8A 1RPNA 2J1LA 2JIDA 1PNQA 2BW0A 2WJ6A 3K2IA 5D3MA 3DOIA 2ZR9A 1GKLA 2JGRA 3A25A 3H86A 5H82A 3TMAA 4UVEA 4YHBA 3HMQA 1N5MA 2RJ3A 3DVLA 3PENA 4FHFA 5M3BA 2OYCA 3UCXA 3WXMA 2W93A 4OVKA 5L3RA 3SLRA 2GQ0A 2JFHA 1I6LA 1UJ5A 2FKAA 3L1HA 4QOEA 1QTIA 3NNSA 2WWVD 4C0SA 2X9NA 4KTVE 1K8YB 4C06A 5AQ1A 5ALRA 5TS3A 2WU0A 2UUOA 3NTOA 4XD7A 1GHTA 4JOQA 3GUZA 1JKFA 1VBNA 2WICA 3PGKA 5BR8B 1YQWA 3EPLA 1W88B 1OROA 3COSA 1YVPA 2HT1A 3MT8A 4IQ8A 2B1GA 4QXOA 4Q01A 5AJWA 3IPLA 4B4OA 2P9EA 4TYQA 4X8OA 2YV4A 1M8GA 1QR6A 3L1UA 4OHPA 1V7CA 1KMCA 3LDAA 3O8OB 5LCXA 3IHKA 1NXPA 2NSJA 2BTQB 3L1IA 1ZMXA 4MVJA 1P0QA 3MWJA 2HLHA 2J6IA 2SNIE 3NTLA 4XGKA 2OHHA 4YJFA 3I92A 3U7GA 2PHZA 2JC3A 1JW9B 1VL0A 2QE6A 4LOLA 5F2EA 2WHXA 1JQLB 3IOCA 2FPKA 1M2KA 3A4VA 3MCVA 5DSXA 3DLHA 4ZJZA 3T9CA 5C80A 4KIJA 3VYVA 5KNCH 2J3HA 1WSAA 4UUAA 2R4TA 2AUMA 2CMDA 1QE0A 4V1CA 5L3SB 2BSAA 3T7EA 4KN5A 1K7CA 2GKGA 4WLUA 3Q3EA 1OHHD 3AKEA 3AUJB 2O9JA 4O2AF 2BZGA 1E99A 3DMFA 3DM9B 3H5IA 1R18A 4JLVA 3U09A 3M5CA 3GELA 2HBYA 1C29B 2AWOA 4LOHA 2ZSIA 5JWRA 5EN4A 3PU6A 5L4SA 1FSPA 3NAMA 4M9QA 3QVGA 2MT9A 3OOYA 4O4HB 4AJPA 1ZONA 1E2PA 1ZKDA 3SQNA 1NDQA 3NBUA 5IVDA 1XCJA 1UMBB 2NO1A 1ISIA 4BVHA 1YKSA 5FB3A 2G0TA 3GWZA 5C0OE 1KDPA 2PUBA 2OO5A 2PBFA 4NL4H 3X43A 1W73A 3T1TA 5G0TA 1L5OA 2I7XA 4MQMA 4X6UA 1CNEA 3I45A 4KE8A 3EEQA 3Q0EA 3MLEA 3UCFA 2XT9A 2XCOA 1GZVA 1R0SA 4L5JA 3GOHA 3WYBA 2QRGA 1XD8A 2NZVG 1Q0TA 3J7AC 1YFJA 4RSHA 1MAUA 2XUDA 3EIOA 4IXTA 4RTPA 4B3SB 4FMBB 1W5AA 4LXXA 1TJNA 4WKCA 5REQB 3RSQA 3RYHB 3IO5A 3V7WA 4ZYLA 9ATCA 1PJAA 2HHLA 1CJCA 3ZDFA 3ASVA 5GV8A 3CUEF 4TVKA 1RYZA 1HKHA 1E63A 2GZ2A 4XM0A 5E6UB 4QQRA 2LMEA 3TW8B 3NTRA 5LOVB 5J3JA 2Y0EA 2YWCA 4UHKA 3UWKA 4GPBA 1DAOA 4MCJA 4F45A 3BGOS 4U9IS 1FY2A 5ALDA 1TD9A 5KOYA 4B3FX 1V41E 2EHJA 4TYPA 4UM8B 3HB1A 4EG1A 2V4UA 4MKHA 2CMFA 1I3KA 4P08A 2BLNA 4RNDB 5D00A 4S1OA 1Z39A 4EYEA 1TFUA 3EGWA 3QIAA 5FRDA 3SJBA 3HKBA 3H84A 3RC3A 1ORVA 2XMBA 5LQKA 1GPDG 2P1RA 4OP3A 1R4NB 4HAXA 4MI3A 4RMIA 3OAAA 3JYQA 2LTAA 3BMOA 5IUKC 4RVNA 1VPTA 2YWGA 1ECCA 1KKLA 2QN2A 3DOCA 4Y2HA 3TGLA 1NJ6A 4BCBA 4Z9BA 4EEZA 5A3RA 1I94B 1OREA 2GD6A 3GJSA 1T8PA 2YICA 2IV7A 4CF4A 5JBIA 4E51A 1VL8A 3R5KA 1QHNA 3EMBA 1FSFA 3GLIB 1T2VA 3FWHA 4O1MA 5B2EA 2IHZA 2IY8A 1RC8A 1LBSA 3FZNA 3LQ1A 3OBBA 1RE0A 1NLYA 5CA1F 2D1QA 2QPAA 2G0NA 3GLHB 5AJUA 5T4BA 3UMRA 4AW9A 2QDKA 4D41A 4K9MA 1EQ2A 2AR9A 1GDTA 3K0CA 3K0SA 1CUEA 1GM5A 1XRPA 3EG9A 1GRNA 1ANKA 4TS4A 3WK4A 1D9ZA 2ZYUX 3JASA 3M2PA 3WK9A 4LY0A 3WQHA 2G8NA 4Z4IA 4BNKA 4CI9A 3B5IA 1P9WA 1MFZA 1Z88A 1E94E 4J91A 3PFHA 2G5CA 1SU6A 4GI3A 3FCYA 2CJFA 2GEDA 4IW3B 3LA8A 4KXLA 2Q1YA 4CIDA 4RVUA 4G41A 1ODKA 1XX6A 2UZ0A 1MB4A 4G07A 4IUYA 4RMNA 1GVHA 3LUJA 2ZJ8A 3BGVA 3L93A 2NUBA 2GM3A 1IUKA 4G85A 4LYHA 3UYLA 2F8SA 1E9AA 2ZRLA 5GJCA 2H7VA 1JKJA 4Z7JA 5KJ6A 1ACJA 3CFAL 2WMDA 2IXDA 2H1RA 4Q9NA 4EG6A 1IBLB 1K7XB 5SV2A 3AETB 4B2IA 5C37A 1NIJA 3R3VA 1KQPA 3IAFA 3HFSA 3TLBA 3CCFA 3AF1A 4RA6B 1L4KA 1XZCA 4ZODA 1FMTA 1BXGA 5AVYA 2X1MA 2H2IA 2ZS9A 3JR3A 4HCJA 1YONA 2EP7A 2ZSEA 2ZUBA 3HHEA 4D3DA 1XNRB 1D6SA 3X2FA 4KZKA 2B82A 2P2GA 3HS3A 4GSYA 2QSYA 2LW7A 1W87A 5DYWA 3H2ZA 3OHSX 2R7LA 3VYUB 1E9FA 3JRWA 2OVFA 4OGWA 2CZCA 5D8DA 2P9YA 2V6FA 2VEOA 3JTMA 3M6UA 4BFXA 1ORRA 2K7FA 2VTVA 2QYOA 2VP0A 3FBGA 3G1UA 2QYSA 2I2FA 1RJ9A 3D43A 3A6DA 1F0PA 3UK6A 1CE8A 3VU9A 4AURA 4BFZA 2AOTA 5GIPE 3OZCA 4BJ6A 4BX3A 1D0VA 5G41A 5JAHA 3BXPA 2FFHA 2DPGA 1G7SA 1RYNA 1SCQA 1FFEA 1T2CA 1L5GB 5CAEA 2HJHA 3RS2A 3FJYA 1PE0A 3HG7A 4RLFA 7GPBA 1LFAA 2JFUA 3W7VA 3FXAA 4XX0A 2WKWA 4D3YA 3JRXA 5F9HA 3GJ3A 2XVAA 2EAUA 4WIAA 1LJ8A 4DMCA 2GVDC 2HAEA 2FN3A 3B3QA 3SZLA 4BVGA 4RDXA 2HB6A 4ASUD 2GWHA 4FC6A 3IDFA 3ZVKA 2JGMA 5A5DA 2ZRQA 3SMQA 1PD0A 1VDMA 2HIGA 3S2IA 2G7ZA 1Q1BA 5BSTA 3T0GA 4AAYA 1THGA 1V1RA 5A6SB 8OHMA 3A6PC 1KEZA 3CB4A 4G24A 3M4ZA 1RVDA 1M2HA 1LTQA 1V7ZA 3I9JA 4E11A 3DBRA 1V1JA 4MGZR 3T4UA 4ESOA 2Q9UA 4A2CA 5EP1A 3CZPA 4JGIA 4MR7A 2QYHA 1GAQA 3ZVRA 2J5BA 3BD9A 4LSMA 3KP1A 1ZINA 5LYJF 3QPAA 3VMMA 2OCXA 2Y9MB 3D3WB 4E5UA 3F7TA 5HWSA 3EVTA 3AJRA 2QM8A 2O1XA 4KQJA 4BNYA 4CN8A 3MJTA 3BFJA 3L46A 3NI2A 2PSSA 3KQOA 1CUFA 1C9MA 1BS9A 3CSSA 3H4VA 1TCVA 4YP6A 3ZU5A 5K0JA 3WZLA 4E08A 3NPAA 5CCEA 1N1MA 4HN9A 4DCCA 5A4DA 5JRJA 2B98A 1ZC3A 5DM1A 6Q21A 5HZMA 2UYGA 3KAJA 4BX0A 2DR2A 2ZVQX 2QAGC 3N0TA 4FOPA 2I2CA 1NVUQ 2NT4A 1RFGE 4L4SA 4QPZA 3WKBA 5FUXA 2ZQYA 3K5HA 4FEEA 4J43A 2BONA 1YA6A 3DEYX 4EUEA 5K0CA 3OWHA 4L7VA 1W36D 4ZCTA 3RVBA 5E2BA 9GPBA 4FR0A 4GO1A 1N5KA 4B3HA 1O0BA 4UMEA 3WC4A 4BUCA 1E1KA 1JQEA 4RANA 3LP6A 1RI4A 3W04A 1BU5A 2BH9A 1BVYF 1PZXA 2PKWA 4MKXA 1EAYA 2QW1A 2XXBA 3EEIA 2PM8A 4GP7A 3GFOA 4I1UA 5B3JA 3PQCA 3IVMA 4QATA 1RQ7A 5K7SA 2WILA 4YMGA 2ZWPA 4DW8A 2V55B 5JJLA 1X70A 2QD4A 3FKJA 2L17A 3QU4A 1ESEA 4ERNA 5HM8A 1RRFA 3BXHA 1P2DA 1AK9A 2VT2A 4D96A 1JQJC 5K03A 2O8DB 2NZUG 1GQYA 3MWEA 4OBXA 4WXHA 1XZNA 3DV9A 2ONZA 2R1TA 2P9FA 2VSYA 2DC1A 2AFHB 2CE2X 4CMIA 9LDBA 1QZXA 3QRWA 3HGQA 3OI7A 4K6KA 4Q1EA 4XDZA 3WBFA 2OHIA 4M89A 1T9KA 4FFLA 4DDHA 1L5SA 5C2JB 1PR6A 4BEBA 2O2HA 3OE5A 4LMBA 5I9BA 4P0QB 3ZCRA 3QY9A 1KR5A 1E2HA 4IDOA 4WECA 2GZDA 4MW5A 3DO6A 1V7QA 2HA7A 1SHTX 2GPWA 2XADA 4GGOA 1GY8A 2DG2A 1DQPA 1LW7A 1S2MA 1YR8A 2XNDA 4GP6A 4DPMA 1DNPA 5JNVA 1VG0B 2G5PA 3I72A 1ONNA 1PGPA 4DLWA 5JYDA 2GCOA 1SZCA 3VR2A 4LDPA 2ZDQA 4I1VA 3D8HA 3V2GA 1NG9A 3P2EA 2I1VB 5FNVF 3OQNA 2JLQA 3I30X 4RKRA 4Q1DA 4U8GA 3M4XA 3K8OE 1OGIA 1E96A 3UA0A 2EKPA 3OFJA 4BC1A 5BOSB 5BVGB 4MQ5A 2CKDA 5IHPA 1ZQ1A 1P7PA 4GGPA 3UC9A 2WA1A 1NHGA 2XKAA 5AIBA 2X1HA 4MUJA 5AW5A 4TYMA 3W6OA 3DMRA 2I65A 3UUWA 3DEAA 5JAIA 1FZQA 2GD2A 1CEXA 1CQWA 3PXBA 1YZHA 1RWMA 3PC8A 3RQSA 3B3AA 2A53A 1V5IA 1YGYA 1FRZA 3CEMA 1JLSA 1H3FA 3H5WA 1DC8A 3DWGA 1GG2A 3NBKA 2B8NA 3OHMA 4FJ0A 5JISA 3EGIA 4PZ0A 2NU8A 5DLPA 5TMBA 1IVYA 1P2FA 4Y2TA 4KI7A 4O4LA 1PJZA 2X8JB 3CIOA 4U6SA 4Q1VA 2DPHA 3B6ZA 3G89A 4F06A 1HDIA 3OOHA 2WUDA 3LY9A 2HXSA 1DRVA 2B7CA 4OQ4A 4KQCA 3KOXA 5HHTA 2WI8A 4KSYA 1WY7A 1KZ7B 1S2IA 2RONA 2HSZA 3MWDB 4PLYA 1NHWA 2PKQP 2WPDA 3WVNA 4PWZA 4BVJA 3BWCA 3GV0A 4KPFC 4TLAA 1G21A 2H5LA 1XMJA 3NAQA 5IZCA 2B4TO 1M2NA 2NZ8A 2VPYA 2Q5IA 1CQJA 1J25A 3PHLA 1LDYA 4ZGGA 2HRDA 2NO6A 2OP1A 5B7GA 3IPRA 1Y89A 2VH2A 1KJNA 2VP4A 3KLMX 5FAXA 1QH9A 1U5BA 5K3CA 3KZOA 2PDAA 3CH5A 2A4MA 3FA2A 4F11A 2MJLA 3BZWA 3QE4A 4RX1A 4AY4A 3U6KA 4AWXA 3F5QA 2EFHB 2CY0A 2RHLA 1N2CB 2ZJ6A 3K9QO 1ZNXA 4LA4A 1AY0A 1O5OA 1SXJE 1AK2A 2CJXA 3GF4A 4KACA 4O59O 4DSOA 3RSFA 1A71A 1XTUA 4E33A 5LMCA 1DOHA 4L85A 3RO7A 3GD7A 4TTTS 3FLBA 3ORYA 1Q6YA 4OHOA 4CFYA 2UDPA 2ZJ4A 5EA2A 1ZRNA 2XZDA 1RW4A 2FI1A 2QL7A 2AV6A 4BRZA 1GCAA 1E2JA 5EHGA 2D0DA 1CLUA 1J49A 1XDGA 2VTKA 3TOSA 4C05A 4DJJA 4Z4FA 3TLYA 1AKMA 4AMGA 4YQYA 2QAGB 1AKRA 3AY7A 3IAS6 3IT2A 3NIBA 4PNHA 4F92B 1UPCA 4B2PA 3SHWA 2QSZA 5EHQA 2JFWA 3NHAA 4F9GA 4QBGB 2Q3MA 2FX3A 4E30A 3ASYA 2A56A 4NULA 3DGFC 3BQMB 1WUIS 1E0JA 2J4CA 4C4PA 2B7BA 4EGSA 2LZ0A 3GG9A 1AQUA 1FRNA 3UXEA 3DMTA 4AY2A 1H1LA 1N6RA 2BD0A 1YR6A 4Y6RA 2OKCA 2X3FA 1DZ3A 1NNI1 3O4IA 3AESA 5FWXA 4HQLA 1DS6A 2WJ4A 2H1IA 1UDRA 3B1KA 5FI5A 2GM4A 1ODTC 3ZIDA 4H9GA 4LJSA 5JD3A 4DKJA 2IY7A 1SG9A 2IKSA 2IF0A 3BXGA 5AFSA 1UBGA 2C3OA 3CBQA 2AS0A 3BDVA 4MYHA 3TIXB 5I3CA 1J0XO 2WEKA 2EZ8A 4OSEA 4HRVA 4O33A 1KSFX 1CY6A 2CXRA 4ZKDA 1QU2A 3KXLA 3K0CC 1W9MA 2A5LA 3RSOA 3AF4A 2XZLA 1K6XA 3K8ZA 1EFLA 1I6KA 2R8ZA 3GGJA 2J31A 4A0SA 4NLLA 3SIRA 2G6BA 3UQYS 3KQMA 3UC5A 2XODA 4JNKA 4BMVA 5KDDA 2GNPA 1VGQA 2XY4A 3TECE 4H1HA 1JHQA 2BGMA 1JG4A 3C4VA 1TYCA 4IG4A 4MOWA 4F8EA 4HNUA 2QQ0A 4Q7JB 1JSLA 1L4HA 3IAAA 4RFVA 4W5HA 3WWZA 1IY9A 3ABIA 3R3XA 1EUCB 4IFTA 3HGTA 3V1NA 3I61A 3QX3A 3QE0A 5HS6A 2D0IA 1WY5A 2XH8A 5JC1A 3MBKA 3BFVA 4ZDJA 4LOKA 3FOAA 5BURA 3C3MA 2TYSB 1EH5A 3HNPA 1MPXA 2HNAA 2PQ6A 2QW8A 3DEZA 4LRTB 4S1PA 1JIJA 3IV6A 3T3GA 1WMAA 4AUKA 2IXAA 1DHRA 2ZYWX 2AB0A 5FTJA 4XDYA 4EVIA 4TPKA 4ZT7A 4KRFA 3O83A 2Z08A 4O4HF 4P7FA 1WU7A 2Y27A 3KZ1E 5E6SB 4GF5A 5GOZA 3USES 4MA4A 1U7ZA 4BNVA 4PRKA 4W5QA 2PAFA 3I3OA 3WYGA 3MWYW 2QUAA 2ONCA 1JI0A 2CNWA 4QFDA 3KTAA 1WE2A 2BZ1A 4RC9A 4MWCA 3RK0A 3Q9UA 3TK1A 3PSHA 3VTFA 4CM3A 3AKZA 3V4PB 4ZJYA 2D7CA 2HQBA 4YJFB 1JG1A 1RRMA 3IP9A 1KO5A 2AEJA 4NENA 4TWJA 3E22B 4L8YA 2PEZA 1F7UA 3AHHA 1YVDA 3FZEA 3PFNA 1KO7A 4I1RA 4R51A 1OD6A 1TKBA 3DKPA 4EA8A 1KI3A 1N6PA 2B8JA 1DAEA 2VPZA 3P2OA 4Z4HA 5C18A 5C8YB 2XXAA 4DV5B 2QVCA 5KWVA 2BKUA 3RANA 4WW0A 5LOVF 2GBLC 5LQSA 2JI4A 3ESCA 3CISA 4CKWA 1KO1A 2HMUA 5LVAA 5TXGA 1YFLA 3FCSB 3ONNA 2HRQA 4HWPA 4JDUA 1QHYA 2QNBA 4J0JA 3R9WA 1XDUA 3HNRA 3HFRA 1E7SA 4C4SA 4ODIA 1J2UA 4PAQA 4B7UA 1GIAA 3C7DB 4PAMA 1I5EA 4PWYA 3TQQA 3WP0A 3GLIE 2HTEA 2YIJA 3AZPA 2JFFA 4W5OA 2Y1XA 3CZQA 4N54A 3WQBA 5BNTA 2O7QA 1QPBA 2OORC 1R3DA 3L0ZA 1N34B 1QP4A 3GLHE 3AVXA 1B42A 3P71T 1IDOA 1NBME 2YTZA 4IIJF 1OB2A 3SZRA 3LQYA 5EE9A 5TNXA 1GLNA 4MR9A 2XE8A 4Q4DA 1XAIA 5DTMA 3EZXA 1QYRA 1T9CA 3Q10A 4G26A 4QHYA 3VI4B 1T9HA 5HFJA 3FOBA 2ZIAA 2A50A 3GRZA 1G9XA 1QRAA 4RA9B 3UT0A 1E3EA 1PK9A 1KARA 1P39A 2WE7A 2YOFA 4ID3A 1PR9A 4PLFA 5EXPA 5L53A 4JYPA 4GM0A 4LJKA 1M0EA 1YDHA 1K2WA 4M8LA 5BP7A 4KXXA 1OYVA 3BMNB 4OKNA 2FRXA 3DZIA 2H54A 4IX1A 2P35A 1U3CA 4L4UA 1QLHA 3A3YA 3MQFA 3VO2A 1C0IA 5HFAA 2GXUA 2ORED 4M1SA 4WDQA 2I1LA 2VJCA 3IQDB 5JY1A 1Z63A 4HTFA 1DV1A 4LYFA 1DJPA 4LVUA 3VNVA 4YROA 4UD2A 1N25A 1T9GS 4L0CA 5F7ZA 2ZE6A 3PCTA 4KLCA 2WHEA 2DBVO 2EJUA 2OOSA 2QIOA 5D1NA 3MB5A 4CF7A 3VO8A 4GIBA 1GXSA 1HY3A 2YJ3A 2EQBA 1ZJ6A 1J5PA 2DUMA 2HMWA 4KYVA 3A2KA 1ZHFA 1BWQA 3BEOA 1NU8A 3HCEA 3K0HA 5HRUA 3V1MA 3V8RA 3EHDA 3N5KA 1X80B 2YWFA 4K7JA 2D1SA 2Y99A 2ZRFA 5EIBD 4EFNA 4Z4QA 2ZB4A 4BHTA 1XWWA 1HURA 3HDTA 5CURA 4DJ5X 3FMVA 1NMEA 4FOTA 4MP3A 4BLVA 1HG0A 3M6IA 2H1OA 4E14A 1GUBA 1NV9A 4FNOA 1KMHA 5LQNA 3BK1A 3WX0A 2GPAA 4MYUA 3IELA 4KQMA 1S4QA 1EUQA 1FFCA 1Q0PA 3WB9A 3Q8WA 1T2EA 5A3SA 2PX8A 2YUTA 3W2IA 5CB4B 1YBAA 1KVUA 3LY7A 5GP1A 1O8BA 2OFFA 1VB5A 1SUIA 1XGKA 5IG2A 5DI9A 1MAVA 5JXIA 4YI3A 3CG0A 4F71A 2CNWD 1POWA 5IFKA 1W36B 3QXSA 3FPGA 2IIQA 2PQMA 1L7PA 3KJZA 4HDNA 1MIHA 1QV9A 4L2IB 1WCIB 3RROA 5I7SA 1AGXA 4DLAA 5JS7A 1KZ9A 3PC2A 3KQYA 1G6Q1 3DHWC 4HXYA 4BFCA 5BXYA 4QFMA 1RFLA 5T67A 1WPRA 3GCZA 4M7WA 5EIOA 3SFVA 1NMZA 1XQ1A 4EX6A 4D4MA 2GPYA 5E1DA 1FXWA 3PUIA 3UMFA 2HWWA 2JATA 1UZAA 1V95A 2H4HA 1K7FB 3AC0A 3LIIA 4WVFA 2JLUA 1OV6A 3PUXA 2ZBQA 2F55A 1Z7EA 1KY3A 4P5DA 5HZGA 1GNVA 1OI2A 3DJFA 3KPJA 2H2FA 3MMXA 4FMPA 4RK6A 3DUFB 1DJNA 3GFRA 1F5SA 5I4KA 1L4LA 1NW7A 2Y9PB 2OWDA 4HZIA 4QO7A 5F2KA 3WNBA 5JDIC 2AXPA 3LUGA 1Z73A 1BXGB 1G8JA 4NPHA 4TRJA 1RAEA 1W49A 5KC8A 3QU2A 3IL2A 1HH4A 2OGTA 1RPTA 1YL7A 2XGGA 3W8NA 3ZS9A 2C7OA 4Q9HA 3N2LA 3UAZA 4R6WA 5HGJA 3R75A 3TLKA 1UK7A 2AJ8A 3G2HA 4NBRA 1B0ZA 1M7HA 4MW0A 3AI3A 3E4CA 1VHLA 4E46A 4J3FA 2J4DA 3ASZA 1KGSA 1UBLS 4K46A 3UN1A 5DBEX 1EK5A 1HTWA 5K6TA 4I2NA 2F4VB 1KP2A 5I8WA 3WNVA 4U2BA 3K9HA 1A8PA 4IGFA 3UICA 2FQYA 1EFDN 5LBTA 2HQ1A 2QA5A 2AN4A 2R7MA 3IEXA 4NH4A 3EXG2 1SO8A 5CNJA 4QYMA 5FAKA 1QB7A 1BAPA 3PQ2A 1IOZA 4D8XA 1VB3A 1P4GA 1XQWA 5BPFA 3ILHA 4NX2A 4F5YA 5EGNA 3P9QA 3LH5A 4BKMA 4C2TA 3ZQJA 4FEYA 2FQXA 2QVZX 1J9GA 2QN6A 4UHFA 4TVBA 3UHFA 3NO4A 2PUJA 2QL6A 3CNQS 1EGHA 4MV4A 4OI2A 3ZQKA 1R6DA 4KIWA 1MCZA 2ERXA 4NZOA 4ALLA 4BQNA 4DCJA 1VIVA 2F59A 3S8MA 2OAP1 4E6EA 1WZ2A 5IT0A 2OZLB 5E7IA 4U4AA 2XBLA 3C1AA 3NM5A 4L57A 3SSMA 3WIOA 3C8MA 3Q2KA 4BVEA 4C5BA 3GCXA 3TSCA 5D86A 3PI6A 3THOA 2ZAGA 2CLEB 2XQIA 3O38A 4OHCA 2GVZC 2I91A 5TV2A 3TLJA 3OFND 4B8ZA 3D6NB 5F3WB 3AUUA 2VRCA 2XB9A 4FDTA 3H13A 5HF8A 1UM8A 1X7XA 3O8LA 1T4CB 1MH1A 1KQGA 1CBUA 1W4AA 2YV2A 3R3WA 1PLJA 1PNOA 2G1KA 2J08A 1H2WA 2PR2A 4HAZA 4QODA 4DGQA 3ADPA 3PJEA 2JHPA 2ZPTX 1ZFNA 1LJUA 1I30A 2DFDA 3D6JA 1MABA 4P4SA 3REQB 3HA5A 3OVMA 3WRWA 5IH3A 1OFTA 2E48A 4X0EA 4JVSB 3RBVA 4BNDA 1U3FA 3OMXA 2VDUE 4M1TA 5FBZA 2K2WA 3TSOA 5L51A 3I2KA 3P4YA 3GLTA 1WXQA 2AFRA 2WUVA 3D0QA 5KNCD 3EVFA 3UMSA 1HYGA 3NZEA 1ICEA 3UK1A 5TQ2A 4CMEC 1FU7A 4FMDB 5K0BA 5KU1A 4KGZA 4CI0B 2V8OA 2WT8A 4WHMA 5A06A 2BFPA 1PW7A 2E49A 3OETA 4MUHA 3WLJA 4NJMB 3ZXYA 1T9BA 3R5FA 4BN5A 4U9HS 3JQFC 3JQGA 2W6JA 3U1TA 3U62A 5C3MA 1NMQA 4NVRA 3EEBA 4H0NA 3AERA 1RAHA 4RJKA 2DH5A 4O4JB 5A0TA 1E7RA 4XVCA 2GYWA 4I8XA 1Y5LA 3MRTA 4CEJA 3G2IA 3KJIA 4L02A 1JA1A 1D6NA 2CHVA 2GZ3A 2FPOA 3CA8A 4LVNA 1BN7A 1UFQA 3EDYA 4JAVC 5CDFE 1QO0D 3AF0A 3C6ZA 4P4LA 4BQQA 1A8QA 3DL2A 3GG2A 4EDFA 2OSVA 1QFSA 1XNGA 4KSCA 4EFDA 4KE7A 4TUYB 2HCBA 3T3DA 4LXTA 2PT7A 1APBA 2IHJA 4EOGA 4OKSA 4CMIB 1ZD5A 1LV7A 5EWJA 5I4CA 2XR1A 2FHSA 3BPSA 5H68A 3WGKA 5AVUA 2AI3A 4DA8A 4PSKA 3RFCA 1LPAB 2CK3A 4MWBA 1F8FA 4MRNA 4Y2YA 5LWQA 2Q2QA 2PA0A 1J90A 2Z95A 4IGEA 4PAOA 4BV9A 3MTAA 1TI7A 1C1DB 4G37A 4UNPA 4DVJA 5EIBC 1CZUA 3GRPA 1P17A 2P9CA 2ZBVA 1HXHA 3JQPA 4NMMA 4Y6LA 3ZE8A 4B81A 3AOEA 3IR6A 3T5DA 3PF9A 1Y4UA 1YTUA 2GAIA 3G6WA 1ES9A 2Z4TA 3D5QA 3HC7A 2UXDB 2Z8ZA 1R0YA 5I7FA 4OQMA 1SEPA 4BNFA 2VATA 1XN4A 1ZC4A 2IFTA 3LHIA 2GZMA 1HQDA 1N2CE 2F64A 1L7MA 3I04M 1W35A 4IRMA 3DOOA 1XTBA 1FYDA 1TUBB 1KDYA 3F6YA 2GEBA 3GGCA 4FC7A 1BHO1 4NZZA 4D9EA 5JQWA 1XP8A 4EMTA 1OWMA 3WGNA 5JI2E 1VCNA 4PIPA 3JQBA 4PVDA 3PQEA 4ZU6X 3R6DA 4PC6A 4ENWA 3ITEA 3P97A 1XLUA 1IJEA 1EM6A 3R8CA 2RHRA 3M5WA 4FZ3A 3CJTA 3ZE1B 4TWIA 3C97A 3HYRA 4B09A 2J5XA 2O4CA 4RF5A 1NW4A 3LUDA 5COBA 3OUTA 3TMYA 3QGMA 3TOXA 2O8CA 4JBIA 3FJ1A 4J7AA 5ESDA 4IIXA 3RF7A 4B3MB 1CUCA 3BFPA 4CLRB 3KSDO 3EFOB 1EVZA 5JXJA 1I1QB 4JYMA 2J3MA 3LLUA 1A5AB 2QD5A 3RC2A 4AM8A 2PGJA 2VC2B 1HSZA 3Q3GE 1XYGA 4EHAA 2C03A 1BJKA 3HXQA 4O4LB 4EJSC 3HN6A 4H3KB 5KVQA 2BFBA 3TDMA 5IJ0B 2Q5LA 2H1HA 4G0ZA 2OQVA 2PD4A 1N5LA 5IXJA 2AHRA 2AYYA 3DH0A 1OBFO 3FWPA 4BQPA 4Y9RA 2C07A 1DTSA 2VOEA 3DBVO 4LEIA 3KWLA 2DWQA 4HG2A 1KI4A 2JLCA 4MEAA 3SPXA 1DOAA 3OEHA 3P9IA 2J33A 5DE3A 5TJHA 3SS9X 1UFVA 1O96A 2A3NA 4CDMA 3OQMA 3FCUB 4L3OA 4PLTA 1KYXA 1KZGB 1X8JA 4RQBA 3KKLA 3O82A 4L16A 1RWBA 4LF4B 2WJZB 1U8ZA 2YUIA 1UBSB 1Z8FA 1VIDA 3P0JA 4FYPA 5FBRB 2DJ5A 4BMSA 3PUJA 3ROQA 3NV9A 3ECSA 3QBEA 1YRBA 2ATVA 4LN1A 1N75A 3H3XA 1R64A 4AJKA 5DN6D 1B3RA 2DLDA 1N6HA 1R5NA 5TEWA 2X0DA 3THXA 5MHTA 2IHUA 1K88A 5T8KC 1EHIA 4X66B 1I4OA 2P2NA 3WV4A 4MCHA 1X7YA 3DTVD 3JQ7A 5IN4A 3R0JA 1H2EA 1Y8AA 5F76A 5EAIA 3UF0A 3BRSA 4MQEA 3SE7A 4OIMA 1QP8A 5IF3A 1CS0B 2POQX 4UQOA 3I23A 3AR5A 5DOZA 1OY1A 3CRMA 4FOSA 3EH2A 4HRXA 4ZICA 1QGED 4L6CA 4NCXA 3KPVA 3AZQA 3F4BA 5JPIA 1MJHA 5CXUA 4CODB 1NW8A 4ME6A 1OMOA 4D8YA 1RWKA 1TF5A 2QTAA 1DDOA 2IEAA 3ITDA 1HGXA 3P0FA 4J75A 4JI4B 3CGWA 1K7SN 3SKYA 5J2TB 3IV9A 1OBCA 1Q17A 2B83A 4MWZA 1IWBB 3EC7A 1NZDA 2Q3DA 2XWJI 3C5WP 3ZY4A 2FW1A 5TVKA 4JB3A 3D4PA 4LOJA 3HO8A 1NVTA 2QMOA 4XZ3A 1XXHB 2GJ8A 4II3A 1E5DA 4MR8B 4H7IA 1UZMA 4C87A 1OI7A 4ENRA 2YWJA 4XB1A 1CQIA 4OAPA 1NJSA 5CNMA 2XNKA 3L1VA 3AHIA 4NG4A 1FMFA 4LE1A 2PQ0A 5JLJA 1RLOA 4WN3A 2WTNA 2E0IA 1NVVR 1ZISA 1Y82A 1ZCJA 3RT1A 4AMZA 1ECBA 2P5UA 5J4KA 4L4RA 4UCWA 3TE6A 4ITRC 2IYYA 4P2BA 1RWPA 3BMCB 2NSHA 1UP4A 2XCQA 2G28A 4HSGA 2Z2KA 1L6RA 1PJRA 3W8FA 4B2LA 2XEDA 5C8YF 4K6OA 4QU9A 3HY3A 3QTTA 1MOSA 2BN4A 4KGVA 4RD0A 5EJ5A 2O7SA 3JAWB 2VDQB 2NPFA 4QTYA 5KYKA 1E6UA 4FCTA 1DI0A 1DQRA 4IMPA 4A0FA 1QX3A 1SBQA 1C81A 4LJ4A 3B52X 3JALB 3WKEA 1ZOOA 5C1DA 1UBEA 2WD9A 4WPGA 1DQYA 4DLTA 2C8JA 3N2EA 1QJCA 1ZH4A 3BC1A 3A4TA 4NFLA 4GDMA 3IP8A 2C59A 4PHHA 5HKKD 1KI6B 2E7ZA 4NI5A 1KA9H 2X41A 3KTAB 5JAQA 3S7TA 5KMGA 1IZ0A 2V97A 1T0IA 3VNAA 4QG3A 2A9OA 5JW6A 3KQKA 1D8AA 2ZWAA 3MGCA 4M0CA 1BFUA 4QD3A 1XWIA 1DQSA 1MMFB 3ILSA 3U2QA 4OI1A 3VU8A 3ZZ0A 3KOZA 2XDAA 3A1FA 3RREA 3TL6A 2BGUA 4OGFA 3KYBA 5DYNA 1Z4KA 2X7JA 4F4DA 4QDZA 4C0WA 2NO4A 4QKQA 4S04A 3H8VA 4DEYA 3CLHA 2KLHA 2JI7A 1ATZA 2PRZA 3FDZB 4O2BA 4TS1A 2IODA 3Q98A 4EJSB 3OKAA 5IAGA 4UCFA 1MC1A 3AVUA 3OJFA 2FW9A 4RQAA 1ZVMA 1FP6A 2OBXA 4YAOA 3DP7A 4IFIA 4N40A 3BICA 3T0IA 2CHQA 2Z9CA 3WICA 5C53B 3K9FC 5ALTA 1BNCA 1SKUA 1CF2O 4IDPA 3ZWCA 3FNEA 3BCUA 3FMOB 4P0PB 1I7PA 2YL2A 1G5QA 3DVAB 3NJRA 1JAYA 1OC2A 1Z7YA 3PL1A 4J0KA 5GM1A 3TQCA 3ZIAD 2PS1A 2V1XA 3QW2A 3KAPA 1PZEA 1XQYA 3R1IA 1X2EA 1QWOA 4LX8A 2EHDA 2XITA 4X63A 1GZDA 4Q3AA 1T1JA 4E3WA 4WKBA 2XX3A 4LRYA 5KDOA 5CGZA 3LQ2A 5EE0A 5B58C 2J9XB 2IQ5A 3UCEA 4MS4A 1NVBA 3NEYA 1A04A 4ND5A 3SHTA 4J94A 1VECA 4ZI5A 5HMLA 4MHOA 1V9SA 3HN2A 2VNIA 2VQDA 3E82A 4MW4A 3U9SA 4BAZA 1Q84A 2EFGA 3HXPA 1KO8A 1QFXA 3H6GA 4ICIA 3CS3A 3A7DA 2Y2VA 5EESA 3FGZA 2XRFA 3F7MA 5JO9A 3SU8A 5U9CA 3TG2A 1WIWA 1J8YF 2D62A 4IS2A 1PRYA 3VOTA 4YDSA 2XUIA 4C0HA 5CB4F 2BWJA 1PTJC 2PFSA 1MBZA 1V96A 2PLFA 5JROA 1OLUA 5F73A 3O4JA 3KTOA 4JUIA 2QMHA 3FUXA 2HH9A 4CF3A 1TIPA 7ADHA 1O6CA 1VTKA 4D79A 2HOQA 1ISMA 2W2QA 3QUSA 5I4IA 2YDXA 3ZBTA 1NN0A 2M6KA 4BX8A 3RKSA 1KYTA 3AWDA 4CKCA 2JASA 2OUKA 2B3TA 2GEVA 3UW1A 3Q41A 4PHGA 4UTPA 4YO7A 1QC5B 5E0OA 1DJLA 4JA2A 1LBIA 2WHYA 2AKYA 5EZ6B 4COKA 1I2AA 3TRHA 4DSAA 2TMKA 3DKIA 3NEPX 3YASA 3KQLA 1UXOA 2VSQA 5ALJA 4PNEA 1PJTA 4YBZA 3ZTYA 2GI4A 1F8YA 2WA2A 4TQAA 1Z6XA 2TS1A 4UHBA 5L3QA 3HP7A 3I6ZA 1IMOA 1OR8A 2E4WA 3BWMA 3QG1A 5I9IA 1PR3A 5HQJA 1WW8A 4TKUA 3LPLA 4CN9A 3SHVA 3OIYA 1RZUA 1KMHB 5EYPA 3RF6A 1EFHA 3TLAA 5CDTA 2J07A 2Q8QA 1TVKB 3D7KA 1ZD4A 4GL4A 5JYCA 2F1OA 3IR5A 3C6QA 3GK3A 3NGXA 4JJFA 1Z7WA 5AXBA 2RIPA 3K2EA 3T35A 4U2DA 4J9VA 3R7WB 3X1WA 1KETA 4CU5A 6REQB 1V8ZA 1USWA 3IBGA 1P5FA 4OYLA 4S3MA 5B57C 2X19A 1E32A 5E9WA 3SYNA 2GS9A 1EZZA 1PFQA 5G1NA 1L5ZA 1ORIA 4KR9A 5CFQA 4DEXA 4PC3A 1AA6A 3D6MA 3E23A 3ETDA 5ES4B 4RD1A 4CL3A 4KHPB 1HFWA 2JZNA 2XMRA 3MIIA 2G9ZA 4AG6A 3DTTA 7ABPA 1TL7C 3OMLA 4RSGA 2CJWA 4JJAA 1QE5A 1ISRA 1UUFA 4L50A 5IC4A 1NI5A 3JQRA 1QYIA 2PMFA 4W8OA 4YLYA 3L7OA 1W5BA 1AKWA 4R9RA 3U37A 2RC5A 1FPQA 2V0NA 5ALOA 4YCCA 1RP1A 2I7VA 2VF4X 4MUFA 4ZCPA 1EI9A 2XB4A 2J9RA 1E1MA 2YXDA 2DH6A 2JGLA 4R1MA 3KR2A 1ML3A 1Y6FA 4FYHA 4YN3A 3A9TA 5EJ2A 1HT2E 4KMSA