4MUHA

Crystal structure of pantothenate synthetase in complex with 2-(2-(5-acetamido-1,3,4-thiadiazol-2-ylsulfonylcarbamoyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
286
structure length
286
Chain Sequence
b'PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 97
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4muhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4muhA01
1F7VA 3Q12A 1H1TA 1JZQA 3IDFA 3A4IA 3IOCA 3P0IA 1K4MA 3L92A 4J76A 1J1ZA 1LW7A 1VL2A 1QQTA 2V0CA 1O0BA 1J20A 1F7UA 1VBKA 1PFUA 1WXEA 3TNJA 1Q77A 4RUKA 2Z08A 2YY5A 1ZUNA 3PNVA 1I6KA 2GKSA 3TQIA 4ZCRA 3M5WA 3ND5A 2O5RA 5IJXA 1N2BA 4KPUA 1M8FA 3A04A 1NUSA 3VRHA 2Z09A 4MLPA 1YULA 2OQ2A 4UZEA 3E27A 3RJZA 4MUFA 5TEWA 2DETA 2R5WA 3FHJA 3RBAA 2A88A 3P0HA 3JXEA 5K0TA 4KKVA 3SZGA 1N2EA 2PZAA 1BS2A 1N78A 1QRUA 3IMGA 3MMXA 2J08A 4J75A 1PG2A 4DLPA 5HUHA 1UFVA 3AIIA 3MXTA 1VBMA 1NI5A 4G6ZA 1O94D 1OWMA 1KAQA 4YP6A 4ZCQA 1Y42X 3VGJA 3D6UA 3N9IA 4DDKA 4JFAA 4U7JA 3FY4A 3KT3A 1KP2A 2QUHA 3KFLA 2QJOA 1Q11A 1WXIA 1EXDA 1IFXA 4ZT6A 4ZT7A 5LLTA 1F4LA 4I6EA 1KQNA 2X3FA 1QTQA 3UC5A 1WXHA 1WXGA 4KR9A 1GPMA 2GM3A 4YMIA 2VTBB 1KP3A 2DUMA 1EUQA 1KH3A 1N77A 3PXUA 2AKEA 1MB2A 3SZ3A 1H3NA 1O94C 1T9GR 4GRIA 4HPWA 3ZXIA 2WSIA 2DR2A 1QNFA 4XFDA 2EJCA 4OUDB 3RFFA 4PBRA 3RK1A 3HV0A 3IODA 3N2YA 1TFUA 3GUZA 2VTBA 2QUJA 2YWBA 4ZT2A 1U0BB 5FO1A 4MW6A 4UZFA 3ZJVA 1N2IA 1IH8A 1X6VA 3INNA 1TEZA 2CSXA 3MUEA 3ND6A 5FO0A 2AZXA 2QUKA 1PFVA 1H3EA 2JA2A 3ILVA 1H3FA 1PG0A 3ZXSA 5F23A 1Q15A 3UK2A 3HGMA 1KH1A 4ARCA 4BWVA 4MWCA 3CVVA 1JIKA 1EFVB 1NUQA 4ND6A 5KWVA 1O95C 2CYBA 2D54A 4U8HA 4JXXA 2G36A 2YWCA 5H7XA 4MW4A 2OV4A 3IVXA 1NZJA 2E89A 1NSYA 1TYCA 3AL0C 2RD2A 4KR7A 1RQGA 3FNRA 3IUEA 4KPUB 4MQ6A 1WY5A 3OP1A 3N8HA 1O6BA 1EFVA 1JHDA 5J5AA 5HG0A 4EG5A 1OBHA 5DASA 4DDHA 1A8HA 3TS1A 4F4HA 4G5FA 2CYAA 3IVCA 4XFJA 2A84A 1I2DA 1SURA 5FNZA 1T9GS 3ZIUA 4K0RA 3FOCA 1GN8A 2O8VA 3AFHA 4S1OA 3FH0A 2DEUA 1COZA 3P0JA 1WOYA 3S3TA 5BNZA 1YUNA 3QTBA 4MWBA 4OJMX 4P2BA 3CLRD 3NBAA 1GTSA 4A91A 2PG3A 1IQ0A 2ZUEA 4ZCPA 3QTTA 3KT6A 1EUYA 4Q16A 2B7LA 3LOQA 2WQ6A 1G59A 1ZH6A 3C8ZA 3ZGZA 1KR2A 1IHOA 3H99A 3UOWA 2GOYA 2A4MA 5TGTA 1EE1A 1JIIA 1NUUA 4ZT3A 1XNHA 3COZA 3GMIA 3ND7A 4AS1A 3G59A 3AG5A 1O0CA 1PFYA 1V47A 1OD6A 3CR8A 2WQ7A 1OWLA 1N2HA 1NYLA 4MW2A 3X1KA 2X1LA 2E18A 1NUTA 3FIUA 1G8GA 1B6TA 1MBZA 3U1VA 2QJFA 2H2AA 1VLHA 4X0EA 1YI8A 3CLRC 1YIAA 3IH5A 3LCJA 3ZUGA 4PY2A 3CA8A 4NAUA 3SEZA 4QREA 4ZT5A 1MAUA 2QTNA 3I05A 3K32A 4TS1A 4JZYA 4EG8A 2NZ2A 3BL5A 3DPIA 3ZJTA 4K03A 5KHAA 2NSYA 1YIDA 1OWOA 2HGZA 1WXFA 1EJ2A 2XRZA 3X1MA 1U3DA 4EG3A 5TEVA 4MW1A 5K0SA 4R2LA 1CT9A 4ZCSA 1O95D 4MULA 2VXOA 4EG6A 1MB9A 4NZPA 4F3RA 1KORA 4HK4A 4EG7A 1N2OA 2X1MA 2DLCX 4WSOA 4ZCTA 2JAXA 3FWKA 4Q93A 1QU2A 3SEQA 3COWA 1V8FA 1VBNA 1TYBE 1S4MA 1TYAE 1JILA 1U7DA 2CV2A 3OTWA 1GZUA 5DB4A 3SP1A 2DERA 3G5AA 2H29A 2Z3VA 1K4KA 5LFAA 4MVYA 1N2JA 4CQNA 1NURA 1T6XA 1OWPA 2CT8A 4L2IA 3LE8A 1R6UA 4U63A 2PZBA 2BTEA 4MVXA 4MWEA 2CUZA 4I6GA 1D2RA 3UMVA 3PRHA 5EKDA 3TZEA 1N3LA 1PFWA 1XNJA 4MW7A 2A1UB 2TS1A 3Q10A 1O96A 1TQ8A 3KT8A 1WZ2A 3X1JA 2JANA 3H9CA 4E1AA 3Q4GA 2D13A 4WNYA 1I6MA 3L93A 2X0KA 4PBSA 5H16A 1ZH0A 3FDXA 4HJXA 3AKZA 3ZJUA 5J58A 3F3MA 1JEEA 1N75A 4ZT4A 3CVYA 4DE5A 3D6VA 4NATA 4I6JA 5DK4A 3HZRA 4EFKA 3COVA 4GU5A 2A1UA 3IOEA 4R0NA 1MRZA 2ZUFA 1KH2A 4MUEA 2CV1A 1M8PA 4G5YA 4KR6A 3MLBA 5LM3A 1IQUA 1MAWA 3TZLA 4CT0A 1T6ZA 3HMQA 2PXHA 4YP7A 2J4DA 3IVGA 1XJQA 4DDMA 1M8KA 2HZ7A 1F9AA 1WKBA 2BYTA 2ZP1A 1EFPB 1ULHA 3CLTD 5IHXA 4MUIA 1MC1A 2QTMA 1IVSA 2CV0A 1G8HA 4MUJA 3H97A 1NUPA 3ELBA 2E0IA 1MOPA 2A86A 3N05A 1I6LA 1JGTA 1K97A 2AG6A 3RHSA 3SYTA 4EG1A 1QU3A 3COYA 1J09A 4QBTA 5JBNA 3CVUA 1EFPA 1M1ZA 4RPIA 4MWDA 3AG6A 1U3CA 1K92A 3IOBA 2DPLA 3DV2A 3QE4A 3CVXA 4H3SA 2A1TR 4R2MA 1M8GA 4DNXA 1JECA 4MUKA 2E21A 1JIJA 1HYBA 1LI5A 2HMAA 4HJRA 4MUHA 3CLTC 3IUBA 4NX2A 2J5BA 1GTRA 1R6TA 1KAMA 1KQOA 4PBTA 3GLVA 3H9BA 1ILEA 3HL4A 1GLNA 1JEDA 1O97D 4MAFA 2IP1A 4MVCA 4ND7A 1WQ4A 3DLAA 1N2GA 4CDMA 1XNGA 4NDAA 2J09A 5DEOA 3H05A 2J07A 2PIDA 3IMCA 4DJAA 1ZJWA 3NBKA 4JXZA 1KQPA 1FYDA 5J59A 3RK0A 2IELA 1FFYA 4MW0A 1U7XA 2RE8A 4EF6A 4L2IB 1WQ3A 1X8XA 1JZSA 4MUGA 3ISJA 3SDBA 3HFJA 3NV7A 1J21A 3A2KA 1J1UA 2QUIA 1M8JA 3DO8A 4FZJA 4MW9A 4XSVA 1M83A 3VU8A 4JYZA 2QTRA 2IJGX 2YXNA 1OBCA 3CLSD 5AHWA 3CVWA 1O96B 3PNBA 5TS2A 1R6XA 3CLUD 1QRTA 1DNPA 1O97C 3G6KA 2V0GA 3TQOA 1OWNA 3PNYA 4YP5A 5HUJA 4YBRA 2A1TS 4AQ7A 1O5TA 2QJTA 4MVWA 4MUNA 1J70A 4ARIA 4NAHA 1LI7A 3FG9A 1JMVA 2WB2A 1IRXA 2EL7A 1QRSA 2A7XA 2CFOA 1KKUA 3A05A 4CDNA 2XRYA 2PFSA 1MJHA 2D5BA 5KCMA 3MLAA 4OUDA 1Q19A 4MW5A 3KT0A 3P52A 1YUMA 1N1DA 1NP7A 1G8FA 1TYDE 3K9WA 4EGAA 1GAXA 1T6YA 2CYCA 4EG4A 3CLSC 3FETA 1IQRA 1P7PA 3UY4A 2C5SA 1QJCA 3CLUC 4QRDA 3IMEA 3FI0A 2DXIA 1WJGA 2I1LA 2PZ8A
chains in the Genus database with same CATH superfamily
4YJFB 4F93B 4UATA 5K8VA 3WKBA 3Q12A 2C3OA 2Z9BA 3HEMA 3JQ9C 4BNZA 3E8SA 4ESHA 3NEAA 4AL4A 4EQZA 1Q12A 1Y3DE 3AI3A 3CPEA 3L92A 1RBQA 3PEEA 2FZGA 2PUEA 3QG5A 2CWWA 3VPBA 5JS7A 4GE3A 1G1MA 1DQZA 1LRJA 1UJ6A 1T1GA 2CBXA 2C4MA 2IEYA 1E64A 4Y67A 1ODJA 2XNKA 3C7KA 5BWLA 4UTXA 3JQ8B 1I4TD 2XMPA 3N2EA 4IXNA 3O90A 3C3PA 2ZWIA 2ZKLA 1BU5A 3QLJA 5CDFA 3HCDA 1N6OA 3NS7A 2CNOA 1R5BA 2WHPB 5EHIA 4JI4B 3L1VA 2Q0XA 1C4WA 2IV7A 2R1TA 3WWZA 1XX6A 5FX2A 4D57A 1CQXA 4BHTA 4ZN6A 1WDMA 1QRRA 1DDIA 5F5LA 2XGGA 5GONB 3K1JA 3MWEA 4O4IB 1HFJA 2V3VA 2Z09A 6GPBA 2OQ2A 3HCAA 3PLNA 2RB5A 2DLDA 1UOEA 1J7JA 1JDUA 1XD8A 4BNFA 2I91A 3ZQKA 1S01A 1KI6A 2OSVA 3E5NA 1PF7E 1NM5C 3RVLA 2F9LA 2YYAA 3KSMA 5REQB 4TMFA 1Z6GA 1XAGA 3K70C 2OCBA 2Q1UA 1RP1A 2E1RA 2ZWOA 4JBWA 4Q4JB 1IN8A 3IMGA 1TCUA 3FROA 3LUJA 2IE8A 4A0HA 5BQFA 3TBKA 5A5GA 2A58A 3L4BA 3DBIA 2XWBF 5A1TA 2F00A 5K6AC 1QP7A 4PG7A 4OH7A 1EB9A 4G4IA 3QENA 4DLPA 1DUIA 4EBFA 3QJYA 2IEAA 3DBVO 1EPUA 3B36A 4DPLA 3NKFA 3C8MA 4J4BA 3M4ZA 2CMDA 3TJRA 4C7BA 1N5JA 2BJVA 4D42A 3S5JA 5SZIA 5GINE 1M34A 3F9CA 2I3BA 1L7DA 4RF5A 4JY7A 4PLWA 2IK8A 3TM4A 4UVHA 1E1NA 3NLLA 4LRTB 2PO5A 1N0UA 2HJHA 4KSYA 3C45A 1B76A 3GEDA 1LDGA 3GLUA 4ZI5A 5C4IA 2OLKA 1JV2B 3N9IA 3Q3CA 5JSFA 1PGOA 2EG5A 4TS4A 4AF6A 3DKRA 2I8AA 5T64A 1R27A 2HNBA 3TZHA 3QK7A 4JQZA 2NIPA 5DIZA 5TLSA 2C04A 4KTVE 2AMLA 4X92A 1EVJA 2PXCA 2YWJA 1HETA 1PEDA 3F90A 3RFCA 3SAJA 4V3CA 3RFTA 3F4KA 1VG8A 3Q5GA 1GPAA 1WXGA 1Y6JA 2V4ZA 4IDGA 4N0EA 4RJLA 3I6IA 2X22A 4JH0A 2JHCA 3II6X 3ZDCA 1SUAA 2H1CA 3UAVA 4R68A 4J3NA 1CR1A 2ZXUA 2JFVA 2CXSA 1Y9EA 1FSPA 1JALA 4LJ4A 5ITSA 1UK9A 1ZNQO 3QGMA 5DPMA 3BKXA 2VQFB 1OXXK 5JCPA 1IJKA 1FFHA 5I9NA 1YFJA 1N9ZA 1TYEB 3OOWA 2HTEA 4PV7A 4EZEA 3LUCA 4JLPA 1J0BA 1BCSA 1NL3A 2ZJZA 2VJCA 3W6OA 3H11A 1XA4A 3JARB 3LUHA 4F9FA 2BJHA 1DX6A 3RK1A 4BO9A 1QH0A 2KLBA 3EIWA 1IY0A 2ZDQA 4V0OA 3KB6A 4ALMA 4DXDA 1QH1B 1JPVA 2QAGC 2ZBDA 4PO3X 3OY2A 2DTDA 2GCIA 2GA9A 2I6XA 2I2DA 4HS9A 3TSCA 3P9KA 1W5FA 5THKA 1HV8A 4NK5A 1SOWA 5K2MA 2H54A 1M74A 3A9SA 4NBUA 2NU8B 4B3XA 1P2FA 1SZDA 2GF9A 4LJLA 4QASA 4YRKA 2AFRA 5DGDA 3U16A 5HTOA 3UN1A 5ER9A 3G23A 5BSFA 2ZIWB 1OLUA 4IQ0A 3AZPA 3VI3B 2BI8A 3QPAA 3ZEIA 2Z6AA 1X8JA 1B3RA 1C3VA 3CX4A 4Q3KA 1JR4A 3KXDA 4DMCA 3LPLA 3FIJA 1CZOA 2QVBA 2FOLA 4YV7A 4JEHA 1II9A 2FQWA 2M1ZA 3LBYA 2W22A 4TVOA 4AULA 2IUEA 4BS9A 1JIKA 2X9LA 5CFQA 5K05A 3CISA 4XWOA 3QU2A 5LIPA 3F5SA 3AESA 1DAGA 2PT6A 1NC3A 1ZOSA 2JAHA 2RBGA 3HJHA 3H75A 4LGYA 5E9QA 3TCNA 1SKMA 3QWAA 1YCHA 2FGJA 2I4OA 3A4LA 4U7PB 4GXTA 4V03A 5I5GA 3W3AD 3TR0A 3AX6A 4JCCA 2VZ9A 2G6BA 2JCGA 3AHEA 1ZOOA 4QA9A 2Z30A 1DAMA 5FYDA 1T5HX 4CM3A 1XCMA 4IVPA 3I8XA 1JHDA 4LVOA 3T7KA 3VVBA 1Y8ZA 1DG9A 3UHJA 2HLHA 3PC7A 1N6PA 2QSJA 4P84A 1UFKA 3KKKA 4L6AA 4QU9A 3V1YA 5G2FA 1I2DA 1Z08A 2VK4A 1T9GS 2H1SA 1VHDA 1DXHA 1EAMA 2NWQA 4WNAA 3VOAA 4YXFA 4TLMB 3O3NB 3NDBB 4HUQB 1QFZA 1RWMA 1Y1RA 4ENRA 4PAWA 4R40A 5I5EA 5L4SA 4LYHA 3V8QA 2JLWA 3CF0A 3L7MA 4EVIA 3QLUA 4XIFA 1DX9A 2NVUB 4YT2A 1X80B 1D04A 4OJMX 1AKTA 3BMCB 4B3DA 1E2PA 3G2OA 2RH9B 3CUSA 4GWGA 4ZYTA 5GOTA 1GPH1 5ENDA 3ZN2A 3D4OA 4OHVA 3VR0A 3EIHA 3LDAA 2NAFA 4IS2A 5CMLA 3AIOA 1SVOA 4ZQEA 2GPTA 1QDLB 3QFRA 4LK2A 3WB2A 3M6VA 4A23A 5DNDA 4MYSA 1OZHA 1U5BB 1W35A 5ESRA 1KR2A 5BMVF 3G88A 3QG1A 2DFNA 1ISHA 1LBHA 1YTLA 5H3LA 4BEBA 2Q7DA 3ETGA 4PX9A 2ZB8A 5CA1A 4DB4A 4LXQA 2G0NA 4YDQA 4IMJB 1YF3A 3H19A 4RTMA 1M66A 2RBEA 1M6YA 2EX1A 3MRTA 3A0RB 3N7UA 4O08A 5EKTA 1FB5A 3ZU6A 1QLHA 1NIPA 1Y1SA 2BFFA 2EF1A 2UZ3A 3U39A 1DAFA 3JD2A 2G0TA 4DMFA 5LQRA 1H65A 3TSYA 2E18A 3WKAA 2YV3A 3WX0A 2WYOA 1U9YA 1KFEB 3FIUA 4EHBA 5JCXA 1QQBA 3UCFA 2DKNA 1CQJB 1X1EA 3HRHA 2GYVA 3KZOA 4K6FA 5H70A 2IGTA 4DV4B 2WYVA 3ZD9A 3W3AA 2CBZA 1CB0A 2B6HA 5FADA 4PINA 2F62A 3CLRC 5FOTA 4JAVC 5H8WA 3BA1A 2YVKA 3AW9A 1TA0A 1I33A 3UHAA 4AZ0A 4HAVA 1T2AA 4YYZA 4GOKA 1V8DA 1XEWY 2PZKA 4MRRA 3WWEA 3GAFA 3IQHX 1P6UA 3ED1A 4HFRA 3ZDEA 4UAGA 1F2DA 5K0NA 5LXTB 4NBNA 4CM9D 5ESDA 3IUJA 4HUJA 4G9GA 1QFXA 1E1RD 2QM3A 3GEIA 3R6GA 1GGVA 1Z0UA 5D3MA 4CCYA 4OBWA 3G3EA 1OWOA 3OJCA 1XHEA 1W44A 3F6CA 3PGKA 1PGQA 4EG3A 3FCEA 1G9TA 1E3TA 2VSYA 4KSCA 1SXJB 4ZCSA 4NABA 3GGGA 3TK1A 3O93A 1CUEA 3U9SA 3KM0A 3OP4A 4FWBA 4AQYB 4B71A 4TL9A 3KETA 5LD2B 2WJPA 3BDAA 2VTDA 3KYIB 1NE2A 4DR3B 1ZO8A 1DCTA 1JEYA 4FMDB 3DOCA 3ANYB 2RDMA 3NHZA 5THQA 1GQQA 3DONA 1CQIA 1PBTA 1Y48E 2QRHA 4CW7A 4RTPA 1WLSA 2C0PA 5L7TA 1U7DA 2DT8A 5BOVA 1NJ6A 4FJ2A 3TG8A 1Z17A 4A5OA 1DEHA 4LRXA 2VPZA 2KBFA 3G13A 1JYEA 1AGPA 1N2JA 4L5BA 1ZM9A 3H9UA 4X61A 1OGJA 3IV7A 1LVUA 3GFOA 3N2GA 2XNDA 2WFAA 1NMEA 4HPJB 3I61A 1VIVA 3RKSA 5KOYA 1UDWA 3B1VA 3KKZA 3ZTYA 5K7SA 1X15A 2YWFA 3QELA 3JPYA 3TIVA 4F9GA 3VO9A 2N1MA 2JEYA 1TTHA 3DXYA 2Q46A 3QWFA 2JFZA 1JVSA 5ER6A 4CF4A 2W2MA 4QUKA 4E1AA 4D9IA 2WZQA 1QG0A 1O8BA 4PBSA 3UT5A 1P44A 3QVWA 4TMKA 1SG0A 1KJYA 4XWYA 2DPGA 5JPCA 1FUEA 2X42A 2R6JA 1KZ4A 1PGPA 1QIEA 3EDYA 1ADBA 3PEUA 4RVUA 4DADA 4ZT4A 3K1TA 4MARA 5K4AA 1E1RA 1QQ5A 5BN5B 2F59A 4IJMA 3VDNB 5A3JA 5IARA 5I01A 4KO2S 2XR1A 1JLKA 2H48A 5DISB 2D7DA 2KSQA 2PSFA 2IXTA 4RZUA 4L02A 3C1AA 4IEEA 2JIPA 2QM8A 4G0VA 3HRKA 3CZ5A 3DOOA 3G8CA 3QLEA 1MAWA 1PR5A 1HT0A 3GLFB 3L7LA 3PJRA 4CT0A 2O9JA 3GP8A 4LVUA 4KN5A 5ALHA 4INAA 1T2EA 1U9JA 1XMPA 4W5WA 4FNMA 5ALVA 5KNDH 1CEYA 1XWWA 4NZYA 5AICA 2R6DA 4EDFA 2YVAA 2BYTA 1JBQA 3U3ZA 4ANFA 3IBSA 4C0BA 3PLRA 5HIAA 3TPCA 1LV7A 2WA1A 2GBPA 4JSYA 3OT1A 4FGKA 5EGSA 4ITUA 1SC6A 2BOVA 2RC5A 4M8IA 1E1KA 1KDVA 3V5NA 4X7MA 3W34A 2FP4B 5CPBA 5E2BA 1XI2A 5JFGA 3E81A 3R7WB 3R5XA 3DO6A 1QVWA 5ICCA 1NAHA 4HI0E 1GTJ1 1BCRB 1D7OA 1VL6A 3HI4A 1XTTA 2WT8A 2C2OA 1M1ZA 2WYHA 4Y9TA 1FP7A 3P2IA 4RPIA 4E2YA 3THOA 4YRZA 2IPOA 3AOGA 3KYCB 3NC0C 3VTAA 4DHEA 4IRXA 1RM3A 5HCUA 3ZHCA 3Q3VA 1WBBA 4I9FA 5JCOC 2DPLA 3K8ZA 1E4EA 2AQIA 2ZRKA 1F51E 1USVA 4UUNA 1Q3KA 3WK7A 1PJSA 2Z4TA 1E5VA 1A82A 2E5FA 4BZZA 1PVOA 2CMKA 3ORSA 1JE0A 1UCFA 3AR5A 1D4OA 1LI5A 4DVGA 4MUHA 4PSDA 2B99A 2QGZA 1J0CA 3CLTC 4C07A 3AVXA 2O2HA 3EJ6A 2QL5A 3T41A 4C0XA 5L4LA 2FW1A 1HRKA 1BX1A 5HQ3B 4K5QA 1RKBA 4U9IS 3PR3A 4B3HA 4DZZA 1SC1A 4TQ9A 2I7TA 3O2SB 2WJYA 1K3UB 3IQXA 5LA6B 1WQ4A 1EHIA 4M1WA 1REQB 4FYHA 5DTJA 2J09A 2VN8A 3DQQA 3FNEA 2I6QA 1S0UA 5B7QA 2H3EA 5GVSA 2GUGA 2AFIB 2R9VA 3IHLA 3S1SA 2PGIA 4KE6A 3RSZA 5HDQA 1ZJWA 2OL4A 3SICE 4CLOB 3AF6A 1CHNA 2EFCB 4MS4A 5SZHB 3VM6A 3SQOA 4A6DA 3V4RA 1FS4A 5CA0F 1DELA 1NU6A 2VDQB 2RGEA 4I1UA 2PXAA 2XUAA 5AI9A 3M0EA 2C5GA 1JQDA 1TMYA 2J9XB 2XGOA 1SUDA 3AVOA 3D7SA 2RE8A 4OHCA 1PT7A 1ECBA 3GLHA 1E2UA 1PP4A 4M76B 2CXQA 2H00A 3N3BC 4JVMA 4NE7A 4N5MA 3K0KA 4HNHA 3BSWA 3OX3A 3CBQA 5NULA 2EKLA 2I6SA 4FSHA 5AWFC 5GGYA 3ODPA 3OOEA 3FOFC 1IWBB 4M46A 3L7CA 1E9CA 3UQZA 2CVQA 2PZFA 1BQEA 1O96B 1RWVA 2EJVA 2GKOA 3D54D 4QAQA 3TX6A 3ZV5A 4DA0A 1IATA 1PNVA 3ZV3A 2D1RA 1KARA 1CUFA 2F9FA 3P2YA 3DEJA 5DE3A 3UWSA 1W19A 1VCOA 2BN4A 3D7MA 1T8SA 4UUBA 3RG2A 3QVXA 3INTA 3FPAA 4RZXA 5HKOA 2XMBA 1CEQA 3OPYA 4QZVA 4B2IA 3GZNB 2ZYVX 1B0PA 3BCSA 4R1UA 1EFDN 1E69A 2VWGA 4RS4A 4JUDX 3LUAA 5CIQA 4F97A 1GKIA 4I4TB 1SHKA 3MCAA 4ND8A 5GY7A 2EL7A 3KKPA 2HCJB 2F1RA 3BG5A 1PK8A 4RIHA 2A7XA 3CY6A 5THXA 1ZRMA 4E12A 1HQKA 3UHFA 4EKDA 2OBLA 1JQ5A 4B2PA 1KJIA 4LJ8A 2G7MC 4OUDA 3WGKA 3AVVA 4MW5A 4Q3OA 4M1OA 5FULA 5F2EA 4N39A 4ZO9A 4LJ5A 1OUMA 3RF7A 4AROA 1P9OA 2YC4C 1QR6A 4TRMA 2DRIA 3DHWC 1FDTA 2ECOA 2NXNA 4YI5A 4N4AA 16PKA 2V3WA 3PJEA 4GQAA 4RDIA 2Z5LA 5AJUA 1XZBA 1TA9A 2QUBA 2F1KA 2OAQ1 3JQ7A 1VE5A 5DNYB 3GC6A 4HDMA 5CCBA 1TF5A 3R74A 4CLHA 3UG6A 1IYZA 2RCNA 5H83A 4BDTA 1Z63A 2F67A 3SIPA 1PSWA 4EK9A 5JHGB 4N0DA 1X7WA 1LRKA 3C3XA 4ZC8A 1JZQA 1C1YA 2FUKA 2H06A 1SQFA 3AEUA 1I2ZA 3D1JA 3DCIA 3PUXA 2OKCA 3GZTB 4TWZA 1JUDA 1TMGE 3UICA 4BLVA 5FOQA 1ODLA 1CR2A 4MJLA 4B4KA 2RG7A 4CLDA 4BQRA 1BKYA 3QBVA 1J1ZA 1E2MA 1H2HA 3MWEB 1GP2A 2ERYA 4JUFA 2D59A 4WJKB 2GSDA 3DS8A 3EXFB 4FCTA 4YK7A 1Q92A 2EIHA 1GTZA 4QNMA 3TNJA 2HBQA 4PCUA 4BLWA 2VLBA 1FP4A 4B45A 3LXXA 5CNIA 3MS4A 4MTLA 4F4UA 4YALA 2ZATA 5IJXA 2FJ0A 4GKKB 4PC7A 1I13A 1W34A 3N53A 5H68A 2QRNA 4EO9A 1AT1A 1KK1A 2R8PA 2YRFA 3T0GA 1T25A 4M0MA 3VRHA 4EKIA 5M04A 4PO9A 4BQPA 4N41A 2QXYA 3LF2A 2IZ1A 3EVAA 2D2FA 3A7EA 5U4XA 3H8VA 3EDCA 1NZFA 3FRHA 2DETA 4FC6A 1D6MA 4TM7A 1QF6A 3RYCA 3M34A 4REMA 1R9GA 1R5OA 4EJ2A 5I7OA 4QOJA 1M34B 2ID4A 2O1WA 3U60B 4TX1A 1Z39A 2E4AA 3JRXA 3C6ZA 5L3SA 4FEYA 5ES4B 1QAQA 1WHSB 2VJAA 1FJ2A 1VI6A 1G0OA 3LLSA 2WAAA 5JZBA 1CCWA 4XX0A 3DLBA 4XOUA 1KI1A 4KQXA 2ENUA 4RMGA 1FIUA 5EZQA 1GUBA 4BNTA 4L8GA 2FF5A 1UAYA 1RBMA 3HYNA 4HB2A 4EF4A 4TMXA 1WB5A 1WXXA 2PGJA 3LC1O 4LZWA 3GZ4A 2RH8A 1U8YA 3LY8A 2QSUA 3AO0B 3SM3A 4GLLA 3NNDA 1U0HC 2Y66A 3GFFA 1N4DA 1ZL0A 4M7PA 2GMWA 4FGJA 5E38A 1VIMA 5AP9A 1AGYA 2VATA 3USES 2WT9A 2O5CA 1QRAA 4CKEA 3GQBA 4O02B 4Y2XA 4LCEA 3FAKA 4QAJA 2P9YA 2ZE7A 5EE1A 1Q11A 3B6ZA 3TIXB 4IFIA 4TLCA 4ZT6A 2YL2A 1EBBA 1G5QA 3C97A 2BFCB 1BCSB 2X3FA 3CGGA 2I99A 1E6LA 4JOCA 1P45A 5T7BA 1G64A 4N3NA 1YVPA 1HH4A 2SBTA 1XYYA 2FFRA 3YASA 4DOMA 1RNLA 1Z4LA 2AE1A 3ZWCA 4XQ9A 4TTPA 2P2GA 1BWRA 1PD0A 4N7RA 2FUG6 2HFKA 2RARA 3G8DA 1SELA 4DQUA 1FDVA 3PXUA 3N0TA 4Y2YA 3O3MB 4J9VA 2CFSA 3WQHA 3H42B 4Q3BA 1GZ7A 1G5RA 4BPBA 2G5TA 5D5PA 3TQTA 3ZXIA 4O59O 4KOEC 4R31A 2RBKA 2YRXA 4QBFA 3HKDB 3HBLA 5G0VA 2EEZA 2E6KA 2W2QA 4MXDA 2C8KA 3MPUA 5AVOA 4L0MA 2BSXA 4ECEA 4UBOA 4PPGA 4PEVA 1U1CA 4OQXA 3R2JA 1RI1A 4BAGA 4N6OA 3R3JA 1P73A 4LGVA 1OFVA 3AR7A 1I10A 3P9NA 4IRUB 2QUKA 1GL6A 3UWPA 4IQFA 1H3EA 4PSKA 3U3DA 3AESB 2AJBA 4L3VA 2REBA 4KO1S 4BKRA 1VE6A 1G3UA 2O0JA 3AJ8A 2DH6A 1HC7A 3JQGB 4OM7A 2PTGA 4X7PA 5I7UA 3K4PA 3LVFO 1Y5MA 3UK2A 1SOUA 1DJOA 1IOLA 3GLRA 1E8NA 1GY8A 3GCWA 1UBEA 4WADA 3WGNA 4C20A 1X8LA 2QTFA 2ZS8A 3AOEA 4K8OA 1YV9A 4P5DA 5SICE 1YZGA 1RLMA 1R0KA 3KUDA 3LYAA 3MJRA 1JQJC 1XRRA 1XO1A 2EARA 3AF5A 4MV4A 3KKEA 4FYMA 1PJ3A 3F2VA 5CFRA 1B93A 1DKQA 2IYAA 3QEJA 1WF3A 4TUYF 4U2EA 4AJIA 4X6XA 4KAJA 5BMVA 1TYCA 3P9IA 4WNAB 2OHXA 3BXGA 3AL0C 3IJPA 1YIOA 4LJ6A 1PZGA 3MVEA 1V3UA 4RK5A 2HA7A 1U7WA 4Y9RA 1EA5A 3VR6H 1WHTB 2JLQA 1A4IA 3EOZA 5KYYA 5IRCD 4C05A 4B3SB 2Q3LA 4HVCA 1GN9A 5DP1A 1UKEA 2OCIA 1FY2A 2XWJI 3L7JA 3P27A 3PZBA 1NUHA 1DPGA 3RJTA 3NT2A 2JAUA 1M2GA 1BVRA 1T26A 4I1SA 4AP6A 5P21A 2VAVA 4H4CA 5ADUS 4RESA 2X5OA 2QMOA 4UCWA 3A3PA 3L8ZA 3RLFA 5FQOA 3STUA 3HZHA 4URFA 3OT5A 2A0FA 4JJ8A 1YJ8A 3IYLW 4MVJE 4BMYA 3OLZA 4LVNA 3NTRA 4M49A 3A26A 3ZGOA 1DMRA 4JL5A 1YC2A 3PITA 5H80A 1YZQA 4HQOA 3T7EA 1JFFA 1QR2A 4KFSA 1ZMOA 2BFFB 3HGTA 3ASZA 2ZUEA 3OZCA 2Z5FA 4QXMA 3OQ1A 4RDXA 1KYWA 4V0QA 4E3WA 3HBMA 1A72A 1NW3A 1JKIA 3PNOA 2Z2XA 5EE9A 4XQ0A 3Q9LA 4CMEC 4XJXA 1NJFA 2X1HA 1M54A 2IPLA 5J4KA 2H9AA 1IPEA 3B9PA 5GZ3A 1XNHA 4D82A 1CQWA 1XK7A 3HEBA 3JVEA 4I3FA 4QUAA 2GZMA 4G86A 1N5OX 2I03A 2LRHA 1ORDA 3AG5A 1T4CA 5JLAA 1L5NA 1WCYA 2QPLA 4ZTUB 4O0LA 4QEZA 3KZXA 3EZGA 3ANNA 3EVDA 1YBFA 1HMPA 4G0XA 1NF2A 4RIFA 4AIRA 1IHDA 3REQA 3EOBI 1A98A 1NP3A 3I3OA 2OYCA 2P5YA 3ETDA 1G8GA 1D1TA 1R8XA 3RGWS 2Y8EA 4JJZA 3VKWA 4IUYA 3S8EA 2VXCA 1VCHA 1CULC 4JP8A 1GFIA 4FFMA 4CCYB 4BUZA 3AFIA 1NF8A 4X84A 4EG0A 3VYSB 1MPTA 4OJYA 3RSQA 1YI8A 3BQMB 1KRXA 1ACMA 3TDMA 3LCJA 3R5SA 5CCXA 4XYMA 1ITZA 5JSUA 2PUBA 3DO5A 3MTAA 5CT9A 1IU9A 2OMKA 2ORIA 3KLOA 1ZI9A 5DGIA 4OMCA 1A27A 2R1VB 5KBYA 4J8PA 4QREA 4QVGA 3BTSA 1AK1A 1BVUA 2Q3CA 3I05A 1OHHD 4HSEA 1FTNA 1D8AA 1K6IA 1UJMA 3BE8A 4JN6B 4LBVA 4M2LA 1JEYB 5AXBA 5KHAA 3IJ5A 2HK6A 1CQIB 1GG8A 4R7ZA 2YX1A 2XB6A 3WBJA 5ALOA 3DDCA 4PZEA 3VTZA 3DFIA 3WBFA 4UHKA 3A9UA 2NT4A 2WJGA 4R2LA 2Z9CA 2UZ0A 5HUJA 3O4IA 1IJBA 2OZPA 2ZUTA 1KORA 1RMTA 1ECFA 3H83A 3I09A 3LSTA 3JAMA 3FWKA 3N2GB 4Q93A 3R0ZA 3OZTA 4D5EA 3U4MA 1PT8A 5G3ZA 1U0RA 1DJLA 4R41A 2AOTB 1BVYF 1WULS 1F0YA 3FNQA 5H02A 4PS0A 5CNJA 1ZCZA 3FYSA 3I9V6 4RSHA 1JILA 4RF2A 2H31A 3IUMA 4JJAA 5DGCA 5H4HA 1CF9A 1RT9A 4YAKA 2WUDA 4HX5A 2DFDA 1AQLA 2PQ6A 4JB3A 3I72A 3DZBA 4PYQA 1MT3A 4HBGA 4BWFB 1YQWA 4P34A 5E8JA 3IGFA 1E5TA 4DUZB 1IUOA 3WG9A 4KH1A 4A1OA 3UT5B 1VG9B 2V8BA 4ACBA 3SN6A 1O3YA 2FJUA 1SG6A 3MIIA 4MVXA 4WFJA 3UV6A 1T10A 4ETIA 4TVKA 2C4VA 3PXXA 1MQAA 2ZU6A 2BEWA 3UMVA 3WDSA 2R68A 1JPJA 3IUPA 2O19A 3VH4A 3L0SA 8ATCA 3HXTA 4K9OA 5EIAA 4ZDKA 2PX8A 5ALDA 2YZ2A 4MW7A 3RYFA 4CTOA 4BLRA 2HHCA 5D87A 3GGSA 2PEZA 3QWHA 5CEEA 3OMXA 2WP8J 1B6RA 4JR2A 5INTA 3MC1A 2GBLA 5JSKA 2Q27A 4WRRA 4NCKA 1ZPDA 1KOFA 3IALA 3TTWA 2XUDA 4MRMA 3OIDA 4HJXA 3C16C 4C0HA 4ESVA 2RAPA 4NJEA 1LLDA 2IGBA 1KETA 1OHHA 2QQEA 3GMSA 2HSJA 2OBBA 2DGDA 3U31A 4IIVA 1ZGBA 3OCUA 5A3SA 4D79A 1DIHA 1W85A 4JBYA 4EYGA 3HYTA 4EI7A 1TZMA 1RYDA 4TYPA 2GN1A 3A3OA 5IMBA 2GEFA 4ZALA 5BQ3A 1TK9A 1YBMA 2WMNB 1ATIA 3OT1B 1C1DA 3R7SA 4YYEA 1E7RA 1CERA 3K0CC 4DV1B 4MV7A 4Q7QA 5K20A 4J9UE 2IYLD 2R5FA 3BT7A 2K2WA 2JGFA 1QF9A 3GPCA 3Q0EA 4U2BA 5GZ1A 3FHOA 5IVPA 2D3TA 1Q7GA 1A1VA 3P9XA 1DAIA 2QSZA 4HDAA 3ZE6A 5LOVF 1F9AA 1RJGA 3PPXA 4MKGA 1U0OC 3CJRA 2C31A 4YHHB 3LA8A 2J45A 4DLYA 5IHXA 1PJTA 4TZTA 3D8HA 4ZREA 5TT1A 4E5PA 3QIAA 5DOVA 1T9KA 3HWWA 1CZHA 3RKRA 1KI4A 1EDDA 3JQDA 3ELBA 4UHJA 2E0IA 2IXFA 5EJ8A 4K9MA 5JQWA 4OL0A 1H85A 1VSTA 2R00C 3RHSA 4P38A 3VOTA 1VHJA 1HEYA 2W98A 3KE8A 3HV2A 3LPDA 4HQ6A 4RK4A 2ZAOA 1T5SA 3HCRA 1Z29A 1HZZC 2ZTUA 3LJKA 1L4UA 1ZC3A 4DANA 5KJ6A 1NNEA 4EO7A 5KNCD 2ZITA 4HNAB 2BRUA 5CA0A 3ET4A 2XRMA 1TMOA 5AKKA 3KV3O 3UUEA 5EIEA 5K0ZA 4IIJF 4Y2JA 3S68A 4JS0A 3RVBA 3S7ZA 3A3YA 4D9CA 5LNK6 4RULA 2JAOA 5LP6C 3BTVA 4FFBA 4H3SA 4P98A 1Y4AE 2CXXA 3OPXA 3WR5A 1JQEA 4HADA 5D01A 5ENZA 4D97A 1TU4A 1NXPA 1W0JD 4JVSB 1Y82A 2O1EA 1QG2A 5FWNA 1E79D 3ZCVA 4MS4B 4JT9A 3TOSA 2Y1WA 1TM2A 4M38A 4C78A 5AESA 4ZDIA 3GJTA 4KE9A 5G40A 3RI3A 4DIBA 4EW6A 3OCVA 3W5BA 1JXAA 4FBGA 4D9MA 2Z8YA 2NZWA 2F55A 1JEDA 1N6IA 3OLXA 4E88A 5EP1A 4F85A 1CX9B 1N3BA 1G291 1QYCA 3D3WA 2I2BA 3ABSB 3FCXA 3GLHB 1G3QA 1D09A 2VHZA 1EVLA 3ICVA 4DZTA 1APBA 4DA4A 3KZ1E 1LBEA 4I1PA 5JYBA 3H05A 3ORRA 5DHQA 3J7AC 1X92A 1RP7A 5ALKA 2EYQA 2OCDA 5CLGA 2VLIA 4BX9A 3RUIA 3G1TA 3BS4A 1LLCA 3QI2A 3IUNA 1E7YA 3PL5A 1JAIA 3ZDXB 4P3OA 3WLPA 2R6HA 3S81A 2IELA 3TDNA 3ZE0B 3ZHOA 2GJAA 2OK7A 1WQ3A 1QF7A 2R60A 3WLQA 2B8EA 3M7IA 5DEIA 3SDBA 1E1CA 3ZH9B 4RTKA 3A2KA 1QAMA 2QUIA 2ZUDA 2IZ7A 3W5DA 2YMPA 2BFNA 4DLVA 5LZ5A 1YMQA 3I9JA 1BFKA 2CNLA 5HYVA 4K6HA 3TTTA 4KBYA 5C8DA 1H6DA 2FZ4A 4XASA 4M1KA 1NLMA 3W79A 5KNCA 2V1UA 3PNBA 1B73A 1HZJA 2LXNA 4RMHA 3CLUD 2Y0CA 4IJKA 4YCAA 1B74A 2A3RA 1JG1A 5JBQA 2OORC 4DMMA 5TMDA 1OWNA 1N7JA 5FORA 2RAUA 3WDKA 5K2OA 4GW3A 3WS7A 4UPEA 1RPNA 1QHIA 3ZZ1A 5GOZA 4BV8A 4NV0A 3SQWA 3IQWA 4B0OA 4YA6A 3EFBA 3EPRA 3NU1A 4RORA 2HDNB 4X6LA 5EIWA 3RUHA 4DSAA 4YCCA 2H1IA 1W0JA 3JQ7B 1P6QA 3F47A 4HDMB 3A2LA 5GMOA 2NYRA 1ICEA 3SPXA 5IBCA 3EPHA 3VNRA 2BEJA 1GT6A 1CUIA 1HNNA 2C7BA 1AIPA 1F60A 1WV0A 2ILVA 3LRTA 3N1UA 1WUHS 2VTVA 5JVDF 1TZCA 5FYQA 1Z4PX 2FPXA 1P2BA 3A6DA 2XTJA 4OAOA 5AKIA 5ARDA 4E15A 2GAAA 2PUCA 1ND5A 3PX7A 4HZUB 4P53A 2AC4A 2YMMA 5CG1A 3HM9A 5LMUB 2JBWA 2X2EA 5B1HA 3CLSC 4AC9A 2NO1A 3A14A 3USZA 3DT9A 3GDWA 3RS7A 4L74A 1Z4IA 4HATA 5CVTA 4C7XA 3O8BA 1DC5A 1F2UA 2RHWA 3H6GA 3QPWA 3KC2A 1COWD 1PS9A 1G18A 4NMMA 2VQSA 2XUPA 4D6YA 3LY7A 3ROZA 3K70D 1Y5LA 1NVWQ 5JZSA 1NYQA 5FBKA 1JWLA 2PX5A 4PGGA 4HYEA 4OOEA 4ZVRA 1ADJA 3GJ5A 1T3GA 1GSHA 2FZKA 4KXFB 1NOJA 4GPIB 2JH3A 1WBDA 3QFCA 1B0AA 1ST3A 5F21A 1SBQA 4MDHA 1QP4A 2O1XA 2VHXA 2OXIA 5COAA 3G8AA 2Y9PB 2WWYA 4G24A 721PA 2Z95A 4KLCA 3RYCB 1KKMA 2Z08A 3KQSA 2OGWA 2AN9A 1KTIA 3ETLA 4I55F 1BYUA 4GWKA 3Q7TA 3ZNNA 1E5LA 3GV0A 1WXWA 2GXSA 4GYJA 2ODBA 1YDEA 2CJXA 3H5NA 5AVQA 4HB3A 1LF0A 3BRSA 2WWXA 3W8FA 1EB8A 1CVRA 4NYMQ 3F78A 4UU0A 1N36B 1L2TA 1VIYA 3JQ9A 3O1HB 4DPKA 4EAAA 5DNAA 5HM6A 5AW9A 4CKCA 5C4MA 2C4NA 4XX0B 2JGDA 3V46A 1W52X 3KJZA 5KVSA 4A4DA 2WU1A 3PSHA 2H4HA 1DXQA 4NMHA 4X8HA 3TR5A 5EZ6B 2HHJA 3CH7A 5B57C 1SRQA 2C2HA 4JLUA 2HO4A 4DCTA 4P6VF 2VXBA 4P3NA 4BJ5A 4DYVA 3ZDRA 3QWIA 4ZCIA 5A7HA 1OW3B 3F4BA 1UPTA 1XTJA 2ZR9A 3EWNA 3Q98A 4FN4A 3IQDB 1GCOA 1XVTA 2GEDA 5DM2A 4KXWA 4F2WA 3GLGE 4X54A 3GEHA 3RSHA 3RRMA 4AF8A 2QL6A 4J0KA 2OV2A 5G4KA 2ZZNA 3CIFA 4G0PA 3LMKA 1P2UA 2YHSA 3T5TA 4RXUA 4B3TB 7ABPA 1UINA 1XN4A 4XB2A 3QMVA 4G41A 4CKEB 3KYBA 2I8LA 2YWDA 4U2DA 4JT4A 1EK1A 1UMBB 1HDEA 1UDXA 2VHEA 2XCTB 1HYEA 2G04A 2B5WA 4JLKA 3U4HA 3GBVA 4GYWA 3PHGA 5FBVB 3G5TA 3TLYA 5A0VA 2JRCA 2P8JA 3O8NA 3ECAA 5F76A 4FHGA 4X1YA 1U8UA 4J91A 4WK4B 3M4NA 4MR9A 3RTAA 1C50A 1NM5A 3RSFA 1YKSA 4CZ2A 1VPWA 4TTSA 5BPHA 4H3KB 3FY4A 4GM0A 4EITA 1K5HA 1AS0A 2QUHA 3LQ2A 5A7GA 5K6AA 1DJPA 2QT1A 4KRXA 4LXGA 1Z0AA 4AZVA 1O0SA 1WXIA 2YIJA 1CZUA 1W47A 2QXTA 3H4MA 5LLSA 4LBYA 1UR5A 2GAIA 2QEQA 1AKEA 2QPOA 1UT5A 4EGFA 4QKQA 4IJ5A 1I36A 1KAOA 1XZJA 4PG5A 1IEXA 1IHYA 2WVJA 3OAAD 3O4FA 3QX9A 3RV3A 3TI9A 3ZWOA 3UCEA 5CTJA 3KOZA 4BMSA 1P61B 4BNNA 2CBGA 4L4UA 5CX1A 1ISFA 3BEDA 1OA1A 1KP3A 2DUMA 1GARA 2EHDA 2ZYDA 3C8DA 4X6UA 5AW3A 5L7WA 3LYUA 4XWGA 2ZTMA 3EQ9A 1P2GA 2P0EA 3OI7A 2CJYA 4J3JA 4DIEA 5KQSA 2IZ6A 3BQNB 1X3LA 1XCLA 5LLDA 3V8VA 3TGLA 2VIIA 2QR3A 3DE7X 4GRIA 2RGUA 3LQ4A 4TUYA 5AO9A 1CLEA 3FW1A 1VYHA 1BFUA 1U02A 4OP1A 4DIMA 1V9LA 2D5CA 3FJYA 3AV3A 3K1AA 2HA4A 3AKDA 3NTQA 4OQQA 2Q1WA 4YDRA 2E4VA 1IZ9A 1PGNA 4LOLA 4NICA 1W8DA 4EECA 2NYUA 1IN1A 5L51A 1N6NA 5D5QA 3K09C 2WM9B 5JXJA 3VU0A 4DNFA 3B1WA 2PUWA 3CRRA 3NGMA 3HJNA 2AYXA 1KY4A 2FKAA 3VHXA 1O6GA 3O8DA 3INNA 4Q01A 1WUYA 4BGUA 5BWBA 1C1XA 3ND6A 4QYTA 4A2PA 3RM3A 3O8LA 4Y9DA 2C5AA 5ALIA 1KIFA 2BGRA 4A6PA 4A3SA 1C80A 3GEPA 4IZ6A 1WBJB 2P68A 2QVCA 1T8UA 2VZ0A 3WLJA 3LDHA 3H0KA 2G4LA 1BEZA 1ZRNA 5BMVB 2H1HA 3U48A 3AUJB 5I7FA 5IG2A 3EHEA 4F8JA 1UBGA 3RJMA 3O4HA 1BX0A 1T2NA 5F7JA 2IYPA 3GUYA 4MWCA 3KALA 2FZEA 4QTZA 4AICA 1DQPA 1M6HA 2CDAA 5HIMA 2AZMA 4D0RA 2QAGA 1NTOA 2H0RA 2PH1A 2QX7A 2VP5A 1G3RA 3CU5A 4LKRA 4ND6A 1QHGA 4B3FX 3BGWA 5JU6A 3MELA 3UAZA 1MA3A 1AM4D 2YWCA 2X5XA 4NPHA 1YH3A 3T3IA 4GR5A 2NTEA 2E89A 1JIQA 3BH7A 5LZ7A 3ZI4A 2QE7D 1HORA 2I1WA 4C0QC 2CLKB 3PNPA 1L7QA 3H6HA 4QWMA 2F2TA 3OAAA 2WC1A 1FTSA 5BW8A 4ZJZA 4MI9A 5F2KA 4M53A 6REQA 3X1ZA 1O6BA 2HCBA 2RGWA 3E48A 1Z5GA 1I9CA 1T36A 2H6EA 3EW9A 1FLVA 4JP1A 1SBNE 3R6TA 4IR7A 4HT3B 3ADCA 2QTTA 1RXVA 4MEBA 1OH6A 3EB9A 2R0QC 5FWDA 3ZIUA 3JYQA 3L1JA 5EXEA 2VH5R 4YAWA 1WX1A 3ABQB 5JNWA 1QOZA 3JQCA 1CU1A 1JS1X 2JHPA 1BE8A 2H1RA 4Y2GA 4G0UA 2X5NA 3OHSX 4QNNA 4WY8A 3K53A 4JEIA 1MO6A 3DFKA 1YUNA 5E1OA 4MWBA 1E0SA 3CLRD 3S70A 3ZZNA 2HKIA 4J0IA 1KZGB 4QO8A 1T4CB 4KX3A 1DKMA 4RVHA 4F4IA 1X19A 1TVCA 1XMQB 4S1NA 3OQMA 3KT6A 3Q5DA 5DJ5A 3ZY4A 3PHBE 4GH5A 5FUVA 3NUZA 3REQB 5AVWA 1ZH6A 2FK8A 4MIOA 2IEDA 1GO2A 3DTYA 3RUFA 1IQPA 2HF8A 2Q49A 5CYGA 5HKBA 5FLEX 5IKMA 1IHOA 2B1RA 4IHQA 1ISSA 5CFLA 5K8CA 1KF0A 1GILA 4LBWA 4MVJF 4QFDA 3PQ6A 3Q3JB 2GQ0A 1FTGA 4L8FA 4KYUA 4N49A 4C29A 4FEEA 4CG2A 3RBXA 2F48A 3BE4A 5ERGB 3W8NA 4QJ4A 3WJ2A 4J0JA 4EB6B 3THXA 2LKCA 1DADA 4H7HA 2AGVA 3CFAL 2X1LA 4B0PA 1JQAA 2O5EA 1VJCA 4LEIA 3FPEA 4PZDA 5B12A 2I6UA 4Q3DA 3DT8A 3E22A 3RHTA 1Q5PA 2W6ZA 1MBZA 4QU8A 5DNCA 3E9EA 4YS6A 3R7NA 4BMDA 5A04A 4TROA 1NBAA 2QE7A 3CF2A 2YFHA 2I0FA 3OD1A 2PQ0A 4F2GA 1UDRA 4YWHA 5JZMA 1NMSA 5DNUA 2HX1A 3CI0K 4UQPA 1R8JA 1PAUA 2JASA 2VCHA 3TR6A 4XDGA 5IVKA 2QENA 4KR3A 3MIZA 3T35A 2Q41A 2X9NA 5JNSA 2DZDA 4Q34A 2X77A 3AEXA 4RHTA 1UZNA 3ISTA 3GLFE 3C98A 2QTNA 3BBLA 3MTJA 2QZPA 4PHTA 2J4CA 4XVRA 5FWAA 3SR3A 2ST1A 5L45A 1UPBA 2GF2A 4Q3NA 3HVHA 4RWZA 2UXCB 2QN6A 4BC1A 3OM1A 4RX1A 1IBMB 4R8SA 4TRJA 5J23A 5B58C 1KJ8A 1NPTO 4E2XA 2XRZA 1M9NA 1WS6A 3B7WA 3IILA 1PU2A 1J0EA 4IUDS 2R7AA 5T67A 3X1MA 4DCMA 4H1VA 3RADC 2WWTA 3GA5A 4U1RA 5DX0A 3GBPA 1J7KA 3S40A 3KRTA 4CUKA 1XVIA 5BNIA 1DFHA 4ADSG 1N2OA 1PDWA 1JJFA 2FFAA 3ZE1B 3RUCA 5C0OE 5DLEA 2GASA 2R84A 4TYQA 3COWA 4UNPA 2BEWB 4OQLA 3B1JA 2FA9A 3G5UA 3V7WA 2D3WA 2DM6A 1AS3A 4QQ8A 1X1AA 2DC1A 2NUPB 3MGAA 4JT8A 4EHHA 3LWBA 1MXFA 2Z3VA 1A3CA 1H2EA 3IPXA 5H5JA 4M0PA 4LZZA 4BU0A 4B5KA 2Q99A 1AN0A 3BMQA 4GP6A 1L7VC 1YDHA 2J8ZA 4ZPJA 1AZWA 4ARAA 4C14A 4B83A 3OZIA 4HDSA 3TXAA 2J30A 3ZXXA 1J8QA 3OZGA 1XTZA 4G5RA 5KQPA 4XUCA 1S3FA 5LOVA 1ETUA 5B5SA 1OGYA 2X14A 1BHO1 3SLGA 1VLJA 5KO2A 1ND6A 1H0HA 2G28A 3FGZA 1CY1A 3RTBA 1QIKA 3HCEA 1KOJA 5FTMA 1WZ2A 2IYNA 4L28A 2QD2A 4S1PA 3QZUA 2D13A 1I6MA 1J9EA 1C1DB 1SU7A 2P1DA 1E3SA 3D6HA 1DEKA 3F98A 3IESA 4G0YA 521PA 3S29A 3T06B 5AW1A 2BFBA 1RPZA 2J6CA 2CGEA 4BBZA 4EG5A 1E8DA 1KMMA 4YV1A 5HRAA 2PL1A 1JFTA 4MJ3A 4JYAB 2KM1A 2AXPA 1ZW1A 4FUQA 5DK4A 3ZPXA 5A9SA 3EZ9A 4RJIA 4AY5A 3EA5A 1E2HA 2IH2A 4BXOB 1JHYA 4ZMRA 4EGQA 2R96A 2B4YA 3U7HB 1JXOA 2GCPA 2VNKA 3CN7A 1IZ0A 1OBFO 1M8PA 1YRHA 4IIJA 3C6MA 5EWMA 3T9AA 1GZVA 1RRCA 5D1HA 1CRPA 5T6MA 1POWA 1P0IA 4W5TA 2Q50A 1WPGA 1JLLA 3H3XA 5ALLA 5JD3A 3AFMA 3UW1A 3C1UA 2V98A 4AO6A 4Z4IA 2J4DA 2PUJA 3LDUA 3TB4A 3U7GA 1XDBA 3H0CA 4UTPA 3I04A 2ZK7A 1CY6A 1GCUA 2C42A 5DYIA 3J81A 3OQNA 2D4HA 2V6IA 3F6RA 3MBIA 3NNNA 4OBBA 3M8KA 1R0LA 4TMYA 4YRDA 3CLTD 4H4DA 5CA0B 1C9MA 1OA0A 4I1YA 4QELA 5BRJA 5BV0A 1AKYA 2CVHA 5JQGA 1V41E 1RLTA 2GR9A 1OZAA 2DFVA 3H86A 1EVKA 1IVSA 1I3LA 1GLGA 3DXZA 4YBZA 1V2HE 1IN4A 5IEJA 1K97A 4WLUA 1CY8A 3ZUPA 2GN6A 1JDBC 3RC9A 1S4QA 2IY9A 1AV7A 1CDOA 1LPPA 3WWYA 2FN3A 2COEA 3L77A 4YMLA 3LC7O 2YFKA 3PICA 2JLRA 3LCMA 2IZ5A 2JA1A 3ADOA 1IEVA 1PUXA 4FDLA 4G0ZA 4H4EA 4UEWA 4C88A 4WBXC 3OLVA 3NMUF 1U0GA 3DV2A 3A11A 3KVYA 1ZD9A 4BNKA 1ID8A 2DT5A 5LBTA 1GYQA 4PPFA 4LZPA 5I9BA 3D3WB 1M8GA 1NAIA 2VWHA 1IY1A 1Y1QA 1MAAA 1MEEA 1JA1A 1E2JA 3KELA 4L4RA 3CWZA 1EDZA 4ZFNA 3K9LA 4EL5A 3I28A 3AF4A 5K6RA 1X7GA 2ZTHA 3QXGA 2ISSD 3R5FA 3NWBA 2K7FA 4Q6WA 5ECGC 2VP9A 2YJGA 4CTJA 3HUEA 5MGNA 1EX7A 3GLVA 1PS0A 3QKTA 5EUCA 3WY9A 3B1FA 4KQ1A 4FHCA 3HL4A 3ZQ4A 4R1OA 4MS1B 3O1JC 5C9ZA 1N1MA 2WD7A 5KJ1A 4G0WA 3ZNPA 2WIDA 1MB3A 4EPWA 3F49S 1NU8A 1UMDA 1E1CB 3ZS9A 2RK6A 3R77A 3EUFA 3HUTA 3RS8A 1HDGO 1KJ9A 2VYFA 4C30A 4OHOA 3D5QA 3ZWXA 1R0SA 3LRPA 1D3AA 1N25A 1II8A 3LCUA 3F73A 1B1AA 3BF8A 1ZL2A 3PI6A 2ILTA 3D7KA 4JMPA 1FW6A 4C0AC 5JYCA 2QQ0A 1AO0A 3CF6R 2GZ1A 1GEEA 1OV4A 3SBDA 4UQOA 5JVDA 3OECA 4O4JA 2P7HA 4NQZA 3AY7A 4Z9YA 4MUGA 2QRQA 2IUYA 5IT0A 3T3NA 4BYMA 1LSOA 3V6LA 4JBNA 1P60A 1O03A 4Q4DA 4XSVA 4CQLB 3MWFA 5KNBD 3P94A 2ZM5A 2IW1A 4GAEA 1K86A 4M4SA 4BCBA 4Z54A 4LY3A 2PKRA 1R6XA 4BGIA 3KQKA 2V4UA 3LT1A 3GPDG 3ZGYA 5EHZA 4QPJC 1QHHA 4H0FA 2VCYA 3QX8A 3FDZB 3BK7A 1KVQA 4AXBA 2H18A 1C3LA 2WFZA 4PFKA 2PMCA 1ZJZA 1H2BA 1XDGA 3B3QA 4XXHA 3FUXA 2WJVA 3LX4A 2PS0A 4FB4A 2IX9A 1YFKA 1YS9A 2QDXA 1YOVB 4OXIA 1XLTC 5P8WA 4B2LA 1DWOA 2H5LA 1HLDA 3F6PA 4L4ZA 3NIWA 2AUTA 4BV9A 5KQRA 5LP6F 4JYBA 1KPGA 4ZVTA 5L6MB 4F06A 3UJ7A 2P9ZA 3PE6A 4OXKA 2DWPA 3G9ZA 2AG0A 3GYBA 1IL0A 1B8VA 1T5TA 1MX9A 3THWA 2PKXA 1B8PA 2X2FA 4RW0A 5FT9A 4LFAB 3AUYA 1TA4A 5HPYB 4AG3A 4DM4A 1RXEA 3SX2A 1VGQA 4BJHB 3M1AA 1NOKA 5BQ5A 2PRSA 3AGPA 1AKNA 5DWVA 5FI1B 3DZHA 5CPFA 2N47A 2WK1A 1H2AS 1Z38A 1XVUA 2QROA 2ZI7A 4LGCA 4TTIA 5AW7A 4QC2A 3HGQA 4JLNA 2AX4A 4UBIA 3LYLA 2B4QA 1C5KA 1GU7A 2BEVA 3MTEA 3FAZA 3AR6A 1N7GA 1P7PA 1V35A 2ZDHA 2QTZA 3AF3A 3UY4A 3H2YA 3NBUA 4LDJA 2X13A 4RMNA 4UBLA 4ZRNA 4NNPA 3RAPR 5K6TA 4D25A 2R6AA 4MI3A 5HF9A 1MJ5A 1OT5A 4QPDA 1PVDA 3W06A 4LMBA 4BVLA 3GP5A 2VNSA 4ECAA 4X41A 5FLYA 3K6KA 2BAGA 1Z3CA 5DHPA 5FOVA 5KYVA 2NPFA 4ZU1X 5JQGF 2ZREA 1T0IA 3SC6A 4DDUA 3UOAB 3L6DA 4ISCA 2EQBA 3IBFA 3HB0A 2PMFA 3TZKA 3OKPA 3QLVA 1EGMB 2H2FA 5CJJA 3TCXB 4BKQA 1H0SA 1VSVA 5ALJA 2CHUA 2BDUA 3ZV7A 4CKCB 2JGDB 1TJPB 2WIGA 4DN6A 5CFOA 2LIVA 1J20A 5KVQA 2FQQA 1N4AA 5KNBA 1PCXA 1VBKA 1NI4B 3FKQA 2GK3A 3FF1A 4FFVA 4XA8A 4DS3A 1U0JA 3U7QA 4DMKA 1JPUA 4PRZA 4LA4A 2BKAA 4BFYA 5BP7A 3D31A 2Q3JA 4OXXA 1UXGA 4DLLA 2H2IA 4BE4A 4EFDA 3H4VA 4TYMA 2H1FA 4LYJA 2IT1A 4X00A 1Q7TA 2VDLB 3IPRA 1LBSA 3M33A 3M5PA 4AI6A 4D96A 3MCUA 3ESQA 4PQEA 2QW1A 2JS7A 5E3HA 4QO7A 1XROA 2PANA 4UVDA 3F96A 2PM8A 5T5QA 3IXQA 2G9NA 3H9JA 1QIGA 4B6QA 2CEKA 3VZPA 1QBKC 3V8NA 4CFYA 4EMUA 5IYZB 2Q9UA 4BFCA 1NY5A 2IFTA 5KI6A 4KKVA 4H59A 1SKQA 3L18A 3UAOA 5DTQA 5AXCA 1OZ0A 3K7EA 1GAJA 4MR9B 3ZDFA 4K1LA 4RPHA 4BO8A 4E5VA 4MP3A 3SHFA 5I8WA 2RH5A 4ME6A 3K70B 3FTFA 1JSXA 5FBZA 1FRZA 1WMAA 2AOVA 4MR8A 4NG5A 2HCFA 1PG2A 1UP4A 4HFJA 4NQRA 5F51A 4QTUB 3ZXYA 1BMFA 5JZVA 2G8NA 4DWOA 3BHIA 1LPOA 2P3OA 3WLHA 2A5JA 2JVJA 2OM6A 2YZMA 3LQYA 1KBZA 3OU7A 3HJUA 1XAHA 4X20A 1JJVA 1NI5A 3Q7SA 2GF0A 3U81A 4FW8A 3V1MA 3NIBA 3BWDD 3A2MA 3R41A 3Q7EA 4IJVA 4MKRA 4WERA 1XVAA 5GM1A 5ICSA 4TZKA 1QGZA 2QV0A 4M99A 2C03A 1DARA 2WWVD 3T7CA 3TBHA 1YB7A 4B4UA 3DZCA 1KE1A 5B4UA 1L6IA 4L9RA 1XMSA 4OU4A 5FWXA 4AN1A 3NONA 2XVAA 4M87A 4U7JA 1O58A 4PCLA 3FMVA 1O9BA 2EKZA 3MILA 4TYWA 2Y92A 3URMA 4X71A 1DHRA 5DYYA 4UXJA 3RK4A 1ZK0A 2GR8A 3UGJA 2H4WA 3H1BA 4BO1A 1NRXA 2ZUWA 3K0FA 1EJBA 1KXJA 4TUYB 2Z9DA 2G63A 4IGEA 3BXXA 4AX4A 3KKQA 4I6EA 3EQZA 4PLPA 4QGAA 1QTQA 3UXMA 1N32B 4MVJD 1Q57A 3LQ1A 3LC2O 5CIYA 4PWYA 1ZJ4A 1EG7A 1NFQA 5DSXA 3TSZA 2FFQA 4A8TA 3IP3A 4RANA 2Q1SA 2NP6A 3TINA 4W5HA 3CBGA 3L40A 4K9LA 5J5VA 2HLDD 1N77A 1AF7A 2GJKA 2Y93A 1U3FA 3SY8A 2VBGA 2ODQA 1Z4JA 4LX8A 2BTOA 2HCTA 4KV7A 1YR1A 2TSYB 1G41A 2ZWVA 1W87A 3DMRA 4UQLA 3RFXA 5BW4A 1WZIA 1H4TA 3Q7PA 3N2YA 4QUGA 4BBJA 4ALJA 3LHDA 3TOXA 4X90A 3ZWNA 2JIZD 4MITA 3H5TA 2W5UA 4ZT2A 3UNXA 2X0IA 4JC5A 3SYKA 1YD7A 5K0CA 2JRLA 4KYVA 4WK0B 3A9TA 2AZ4A 1E2QA 2B4KA 2RI1A 2R2AA 2I87A 4QJ5A 3TM5A 3D2BA 2OBXA 4IXDA 2IVZA 3HJTA 4F8EA 1FYEA 5D6NA 1IRIA 2EKBA 3EOAI 3PC2A 2LV8A 2QLLA 2SCUA 4HNQA 5GAJA 2REQA 1AGXA 3D64A 1LJ8A 4EHIA 5DYTA 4EO4A 1ORIA 3PQDA 1OFUX 2M2IA 5HTKA 4KEAA 4PRLA 3G82C 2ZIFA 3BGSA 1JKJB 3WNBA 1XIVA 2I7XA 4Q19A 4KL8S 4RPCA 4RY9A 3ZYCA 2FSIA 1GTG1 5DMXA 4A8JC 4Q24A 4DYHA 1V43A 2ZIZA 4PYJA 5DLDA 4B6PA 4JXXA 2Q3DA 3ZVMA 4CL2A 1FUYB 1I3NA 4K81B 4MW4A 2YYYA 4GYYA 1GQFA 2QDKA 3AETA 3WV4A 3ACDA 4V0LA 4GMHA 4ZO8A 5BURA 6NULA 3GYGA 2UU9B 4LF9B 4L73A 1FLAA 3VJMA 1JN0A 1YZNA 3MRVA 1BA3A 2Q5OA 4Q9JA 1Z34A 4WFKA 3LUBA 3OZDA 4Q12A 5EIBC 2HLDA 2ZSBA 3PQ7A 3VO8A 3ERCA 1H6AA 2C3UA 3DQPA 3PVSA 1K68A 4ZAZA 1WMBA 1Z0FA 1ZCFA 1Q1BA 3EXAA 5FIUA 3UATA 1USKA 1KAHA 2C82A 2K87A 3FOCA 4RFSB 4HTFB 4TV9F 4RH3A 4WEOA 3AHHA 5AK6A 5TRTA 3KJFA 4S3MA 1KKLA 4J0FA 5A1JA 3IEMA 2M9MA 4PLYA 2FPGA 4H2DA 2VNHA 4IJ6A 3OZXA 1DBQA 1U63A 3A7DA 3GF4A 3S3TA 3EEFA 5BNZA 1GQRA 1PV1A 2JD1A 2JCSA 3SXUA 2Q29A 3K2IA 2QLTA 2QIOA 5LQNA 2XX3A 1D1QA 1IQ0A 2X4LA 5TC4A 1E2IA 4NHOA 1YK0A 4TSFD 3THXB 4PNPA 3M1IA 1N2CE 1LDMA 4NMLA 4CM8A 3LPCA 4Q02A 4Q16A 4FR0A 1CBUA 1CVLA 5CXQA 1HO3A 2O3QA 4PPYA 1G59A 5ALEA 2Y0EA 1EXWA 3E22B 2I78A 1Y98A 3H99A 2QR2A 3QBJA 4FIDA 4IPTA 1GPLA 1DC6A 1KR5A 2YVQA 3CW9A 4KWEA 4MWSA 1X8KA 4TQGA 1PVVA 1QJ4A 1S2NA 3AONB 3GAMA 5HZKA 3G02A 1P1IA 1S2GA 5ALSA 1U0NA 4H60A 3G59A 2X5KO 5JHHB 2XWPA 4OBEA 1W76A 4LDRA 1A71A 1OT3A 2J3JA 1QOQB 3F1KA 3RDPA 5BSWA 2WQ7A 3BORA 1GYRA 3FFWA 1PR6A 4M55A 1SWVA 4U7GA 4HMPA 3DE3X 3VXKA 1LPNA 4NFLA 5B1DA 4UOZA 2CFIA 4O5AA 3T7IA 3ZVRA 3OSZA 3LOPA 3PHJA 2B30A 5CURA 5E6UB 2Y1EA 4C0SA 2PPLA 1CZLA 2W9XA 2XDAA 4NZMA 3V1LA 3VHLB 4CMEA 1N6RA 1QVAA 4BRUA 1L5SA 3T12A 2A2ZA 3ZWQA 3HC7A 3NB0A 4FZ3A 1SVIA 5KSWB 3HXMA 1P39A 3DV0B 5DHSA 5FV4A 5KDDA 3RTGA 1U8CB 1I3OA 2W6IA 3V32A 2VPPA 3QUCA 1KZYC 4NKRA 1OJLA 2WV7A 2ZSHA 3HP1A 1L7AA 4GZ5A 1QDUA 3ABZA 2YBDA 2IITA 1XRMA 1K8RA 2OZEA 3UANA 5KX5B 3TX2A 3V4SA 1CUHA 3QW2A 1ZD2P 5DHFA 4BN0A 1SEPA 4IYRA 1K9SA 1KFBB 2Q5QA 2HJRA 3EIQA 3K16A 4RL4A 4ENWA 4EYSA 4UMVA 4L8LA 2AKYA 1ZM2A 3BMQB 2XEDA 4TSFA 4FXOA 4X63A 4ZCTA 2VPYA 1A9SA 3VNAA 4AY6A 4PX3A 4HDSB 1PEYA 2BKUA 2PCJA 3QUAA 1AA9A 1P7ZA 4JB0A 3CNOA 2GPYA 5I9MA 3WTCA 4I99A 1V7PC 4CMIB 5TGDA 4ETNA 4ZEVA 1XNRB 1P1RA 3HTXA 3B1XA 2YV2A 1IB0A 2BVNA 3ZDQA 2ORED 2Q0QA 4EGSA 3ANLA 1HPLA 2GESA 4KCGA 1YZVA 1XZCA 1QKKA 2MJLA 2JFBA 3EMBA 1IIBA 1N0VC 1NVXQ 1T5IA 2QLMA 1KPIA 2RCYA 2HDHA 3AJRA 3OESA 1L5HA 5KKNB 3KSDO 1WRBA 3LE8A 5ARCA 3P45A 2CL6X 2BFBB 1QGYA 3SM9A 1Z6TA 4WASA 1U2DC 5JSYA 2N3ZA 2OGSA 2CJWA 4B44A 1RAEA 3N8DA 1V95A 3V4FA 2AD5A 3F7OA 3FSRA 3GK3A 4R2WA 2V9ZA 3RAGA 5I4KA 4HD8A 2JC3A 1R5JA 5AW2A 1TQ8A 3GVPA 4UPVA 1N6KA 5AHRA 3OZAA 4IIJB 2A30A 5CIWA 5EWMB 1X7YB 5HW0A 3MD0A 3LGAA 4TT3D 3UIEA 2H1VA 4QICA 1JEAA 3TL3A 4EW1A 1JLLB 3T9DA 4AY3A 4BC0A 1L5KA 1NRWA 1OH5A 1XCJA 3UYKA 1I2BA 2GPSA 4Z0TA 4F38A 1T4BA 2O8EB 1YI1A 4URUR 1FTYA 4M1SA 4D9HA 3V3TA 2X8BA 3K0HA 2B37A 3N8GA 4N8DA 2GBCA 3HBAA 3SU8A 3VOSA 4B31A 4E31A 1DE0A 4B6GA 1ZD4A 1TAGA 2PU7A 1M0EA 2VZLA 1L4GA 1F6BA 5LM3A 3B1YA 5JYDA 5CDSA 1RRMA 1UKCA 3HMQA 1BEUB 5I9IA 2GR7A 4KQJA 2HDOA 3L8DA 4EY3A 4GMGA 4YP7A 5FJIA 1NZDA 3ST7A 2A94A 3UJ9A 2R1ZA 5IXSA 2Y4NA 1DCKA 4OK5A 1I1QB 9GPBA 4MCJA 2PH5A 1K2WA 5T4EA 4Z4EA 2AWNA 2OV8A 1GNVA 2UYQA 4LTMA 2G16A 1LNQA 1BWSA 1P1CA 2P2DA 1C2TA 3L7YA 4JUAA 3UUWA 2O2IA 2JCYA 5DNWA 3SF8B 2BY4A 3S2YA 1Q2XA 5JAPA 3IDOA 1JHAA 2P5SA 1RKXA 1KJJA 2OO7A 1NJ8A 3KOWA 3WC4A 5K0JA 2W48A 4LYFA 2PMKA 2G9QA 3JTEA 2GXQA 3T1HB 2DLCX 3K0CA 3NO4A 4IFBA 2ZWAA 3QV1A 5IPFA 2ECKA 4OI0A 3W8RA 3ECSA 3QXXA 3O9MA 1N0WA 3NGXA 4IICA 2O52A 4B17A 1W0KD 2WWHA 3BIJA 2HOQA 3LF1A 3EIUA 1U3CA 4ZO4A 2A5DA 5KU1A 1E3IA 1KC3A 3E7FA 4BJ3A 2WUGA 3U7IA 1GPNA 3IERA 5LJLA 2BSQA 4PM4A 3TTYA 3OUZA 5I7EA 4OHRA 1R7RA 4P92A 4TT3A 4UHHA 4QSHA 3B38A 2HJSA 3SE7A 3A1TA 1WP4A 4UAJA 4OI4A 3W1EA 4IIXA 1JECA 2O20A 2AG8A 1Y7TA 4MKIA 3TTSA 3G2QA 4BFVA 2R00A 3MWGA 5EERA 3FYCA 1JVBA 1JJAA 5AOCA 4LHVA 1IDN1 1HZZA 4LY9A 1UQTA 3MGKA 4Q3EA 1B15A 4QGGA 2ZRDA 1GCAA 5G0WA 4B73A 1FSGA 2H9YA 1ILEA 5FTLA 5KC8A 5JVDB 1OYOA 2JF0A 3VZRA 1PR9A 3PQCA 4PG4A 3EPPA 4IO0A 2HF7A 1IWPB 1PL8A 4ZHSA 1RCUA 1C41A 4G01B 4GC5A 1KZ7B 4M60A 5CJ2A 4ZYZA 5LP6A 1PWEA 3A06A 4WBSA 2XCLA 1E2FA 2PIDA 3JWIA 1P81A 1E2LA 4FIZA 4WLNA 5A02A 4RTOA 2RHRA 3M6AA 2V6MA 3G2LA 1UKBA 4R1MA 3K94A 3MTGA 1V8BA 2PKCA 5C8YB 4K86A 3CZCA 3E3AA 5KC9A 4QXPA 2EDCA 1LTHR 1E3EA 1Z7GA 2ZIXA 3DZDA 2N42A 2HXSA 3JZFA 4UMEA 4GKJB 2W6JD 4F0JA 3GLIA 3ZE7A 1UDCA 2ZQZA 1QO9A 4P5EA 3FTEA 3M4JA 1V8PA 3CUVA 2FDCA 4PC1A 1XRNA 1Q6ZA 3E4DA 4Q48A 2WW8A 2WF8A 3UCXA 2YXNA 2QD5A 4KNYA 3IJEB 4WUVA 2CK3D 2O0KA 2OOKA 2Q1YA 3CLSD 4EOGA 4XM1A 4PIVA 1JNYA 2WYUA 3QFHA 1TU0A 3TAXA 4EHNA 4YT5A 1W0KA 1CDEA 3K72B 4I55B 4LQ4A 3THWB 1G2IA 4AQDA 4UASA 3DVAB 1OAOC 2OMEA 1P62B 1IZ7A 3MB8A 4JJFA 3DZIA 5B37A 3ZLTA 2NOAA 3E9ZA 4NL4H 3PU6A 2JJQA 3EZ2A 4Q9KA 2NXJA 1KDYA 1XYGA 2AZDA 5IZ4A 3FDIA 2QJTA 2F43B 3LHIA 4MV6A 1UC4B 4QG7A 3WFZA 5TIIA 1ZGCA 3LO5A 4FFOA 4U5XA 4V1CA 1E7MA 1N92A 1YZHA 2JLUA 1JMVA 1Q7RA 1Y5NA 3GJQA 2GO7A 2W2KB 5IJWA 2WKPA 1Q2UA 3A05A 4CDNA 3BIXA 2P79A 3IL2A 4CT5A 4F5YA 4FCVA 3U49A 3W5HA 2PPVA 3KJQA 3LY5A 1L4NA 1TQDA 2XQGA 2P6MA 4YP9A 1TYDE 4CM1A 5CDHA 2OORA 1G4UR 5EFOA 3NP9A 1LD3A 1HDRA 1N57A 3VNSA 2QK4A 4Z51A 2VYVD 3FM9A 3L8CA 3VR1A 3VPHA 5E7QA 1FMJA 2P77A 2PUTA 3PA6A 1H8ED 3OG9A 1Y80A 2Z1NA 3CPSA 1DT5A 2OAP1 2Z3ZA 2K6GA 3ETCA 1C9NA 1YRBA 1XZAA 3HYLA 2GKGA 3E58A 4Y6SA 3G0IA 2DULA 3G79A 2Q9BA 1B2LA 1YZUA 3SC3A 1N6HA 3D3QA 3FKSA 3AB3A 2MCFA 4DNOA 4LWPA 5JJBA 3BFKA 1U7TA 1PO7A 5K3DA 1HKHA 4QLOA 2VP3A 3PQ2A 4E07A 1KK3A 2FMHA 3U3KA 2HRDA 3IDFA 4UXIA 2JGRA 2O4CA 1BGXT 5KSOA 3DE6X 2UAGA 1Z12A 4R1LA 1QE5A 5IU6A 2P4QA 3KYDA 4N0QA 4HHEA 3I9OA 2XE8A 1FYVA 2I67A 1FPMA 2ZAIA 3LXMA 3IEVA 2GH1A 2Y27A 1D6NA 5K3FA 1TGYA 2XDYA 3FPGA 2CK3A 2XA1A 5JD4A 5IDWA 3QXHA 1EBUA 2B82A 3GPBA 1Q77A 4AMGA 2CLHB 4KH0A 4IBOA 4UW9A 2LD4A 2NVWA 4IEFB 3UFBA 1MZPA 2CFCA 2XMGA 4U2CA 2Q5FA 2QI9F 4BASA 3U9LA 2PK3A 1M8FA 1QGOA 3B6KA 1ZMTA 3NOQA 4UUAA 2VYQA 3CR7A 4ZAFA 4PSVA 2ZS9A 1NMXA 1H8HD 2EFEB 3FFXA 4QJ3A 1PT5A 1K1EA 3L0OA 4X60A 1GGMA 3V7UA 3KQUA 3E35A 1SCAA 1TZKA 2A88A 3NYWA 1VPLA 2NSDA 4I36A 4X20B 5EVCA 2V7BA 4BWGA 5HZGA 4UNIA 1Q0HA 2AOWA 3L0ZA 1X1BA 3O83A 1LLUA 4ZVUA 5GTDA 3LL7A 1J2YA 5ERYA 4W9RA 5FWXB 5LR6A 3ZZ0A 1EDOA 3KEMA 1GDHA 4QPPA 4E32A 3SCZA 3AIIA 2ZTSA 5J4HA 4R9SA 4KG7A 3NIFB 4H6PA 4EJ6A 1GEGA 2E4ZA 2QYOA 3WLAA 1H8EA 4PAOA 3IXLA 1E7QA 3EXG1 4M83A 1CE8A 3K0FB 1LSUA 2JNWA 2V6BA 3HU5A 1CQZA 1Z73A 1UBJS 1KGDA 2BFOA 2Y9MB 3BICA 4FE3A 4M8NE 3UUFA 3W2IA 4WXMA 2EFYA 1GPJA 2J3LA 1JB9A 4OV6B 3WHLA 2BZGA 1DAEA 2QT9A 1WZNA 2CB9A 3OX1A 4ESOA 5FH9A 1NV8A 2FLWA 1ENYA 4ZVMA 4A1FA 1I4EB 1WB4A 1NKSA 3ZU2A 1Q0PA 2O4UX 3LNTA 3KFLA 3C85A 1S7CA 1V37A 5CHYA 1MQ8B 4FB5A 3B3FA 3N6VA 3QXCA 3ED5A 1EXDA 3HDHA 1IFXA 3DH0A 5JW6A 4DARA 1XFAA 3LV8A 2I29A 3H1FA 4QEKA 1AGNA 2R79A 4Q0MA 5CVEA 1LV8A 1V3QE 1E66A 5I3CA 1XCGB 4YHBA 1WVGA 1LH0A 2F1OA 3EWSA 2Y1CA 1RCTE 1LTQA 1YVUA 2ZBEA 1XMIA 2JJ8A 1JYFA 3C3DA 1FQWA 4IG4A 3OA2A 4IIDA 1GA1A 4RM3A 4DRXB 4M9SA 5I51A 4DTIA 4RLSA 5KYUA 4QDZA 2XUIA 2VI5A 3K1ZA 4ZVLA 3RCBA 1WF6A 3I1YA 4KNWA 1OROA 3I34X 1NN0A 1NR5A 2QVZX 3SZ3A 1E7WA 1DG3A 3EVNA 1NBMD 4FYYA 4XSHA 1U99A 5DX8A 4OAPA 5IAJA 3HUUA 4PAGA 3CHYA 3VISA 3TD2A 4DVJA 4HDOB 4MA5A 3WDMA 5EE0A 1YHYA 1CEEA 4AKTA 3EYAA 1M6WA 2VTBA 2AG5A 1RE0A 3LDGA 2XUFA 1CYDA 1OSNA 1XU7A 1EWYA 3OC0A 3OKAA 3UTDA 5JD5A 3H8JA 1JTEA 4J6FA 5DBHX 1A8SA 1X0VA 1U2RA 2C5BA 1QCDA 4M8LA 3IX7A 3DGFC 4R05A 4CTNA 1OFUA 2ETVA 4QOSA 1E3WB 3ELUA 5AW4A 4TV9A 4I1RA 2X7HA 3HXLA 1BOFA 2C1EA 3VDMA 1JI0A 4J16C 1NVKA 4BAUA 2LIPA 1KFCB 4MI1A 1H2RS 2ZSAA 5IM4F 4OHZA 1LUAA 1NA5A 2QTVA 2PKQO 2RFLA 1YJBA 2JHGA 4I4NA 5LDDC 4L72A 1YR3A 1YU9A 4A27A 4XRRA 1CEXA 1OXUA 1RIIA 1WKVA 1EG2A 3K09A 2P35A 1QTIA 1QC5B 2JGAA 2W4MA 3SHOA 4TKLA 3UA4A 2RK3A 4I46A 1MVLA 4LNAA 1NYRA 1Q0UA 2KJQA 4KFUA 2C8JA 1GZ3A 4WN3A 1IPFA 3KCNA 3PHHA 3SZUA 3T4UA 5H7XA 4UOEA 3AQ4A 1PX2A 4CMJA 3MJTA 3IVXA 4I2NA 2TECE 2PD6A 1BMTA 2E4YA 1IHXA 5MFPA 1BMDA 2GNOA 1RQ7A 4KPUB 1HOTA 3BERA 1UBUS 4FE4A 2GYUA 3CNBA 3SQNA 4D0NA 4H7EA 1URPA 3FFBA 3OE1A 1BJRE 4ZEWA 5B3LA 1LNZA 2VHTA 1M6VB 3MPOA 1DGQA 5AVSA 4AKGA 5JJLA 1WTAA 2W2LA 3CTPA 1DBSA 2IYXA 1GXSA 4B3IA 2YIMA 1M2HA 3ZWWA 1Z5VA 4CM8B 4IDEA 4ZRMA 1NN5A 1DO8A 1WMFA 1W6RA 3BILA 2Z58A 4H35A 3T5DA 2GLXA 4EQ6A 2RHDA 2V7QD 3PRYA 2UUPA 4KVGA 4ZQFA 1GGNA 3C74A 4D6PA 1DWPA 4EY5A 1KQFA 2HK8A 1SOMA 1WD5A 4KXLA 1ZHFA 3GJZA 3K96A 1CJSA 2V7VA 4LQDA 2PGXA 3SWWA 1SR8A 1BDBA 4JP3A 3HDVA 3A36A 4YP1A 2PG3A 4C08A 2XKKA 4NBSA 4FFPA 3FNHA 4ZCPA 10MHA 2GUWA 1ICIA 5F3DA 5IAEA 3R9KA 2BGJA 1KHHA 2VBIA 3ZGZA 1CD5A 4A0GA 4IXJA 3MTQA 3DAFA 3OF5A 1E4VA 1S89A 1B0ZA 4AJOA 3VJKA 1FXUA 2HMSA 2LTAA 4ZOCA 4HH0A 3S55A 1FFWA 1K7EB 1Y7IA 1CDDA 3N3AC 4YWJA 4MWZA 1OX4A 2OVFA 2EWMA 3Q7RA 3UK7A 3WICA 4I9NA 4MPPA 1SPBS 5YASA 1I24A 1OXMA 3WQSB 1PLJA 1ZMXA 3CR8A 2PR2A 5B2ZA 4MHSA 3O38A 4WJLA 1BA2A 1MZVA 1MW8X 3C3WA 2PGOA 3W3AH 4DCSA 1K5PA 1KHTA 2VHWA 3NHKA 1RYBA 2FEXA 3LP6A 4HX9A 5CLJA 4C6HA 2FJPA 1FP1D 3TKYA 2Q4TA 4KZPA 1QPZA 3AVPA 2EQAA 3P4XA 4GNRA 4KVAA 5F5XA 4X0EA 1VL1A 1YIAA 2KB0A 5HE9A 4ZO6A 4G9EA 3EARA 3JAWB 4DCOA 5JJIA 1PZMA 5BW0B 1KNXA 5A0FA 5FUQA 3QPDA 5FA8A 3CUKA 4OHPA 3N2LA 1P0FA 4K8RB 4QU0A 4R6WA 1MAUA 5DI3B 4G4GA 1XMXA 4PWZA 4YLYA 3WWPA 3X3HA 3WBBA 5F98A 1W4RA 1WP9A 3ASUA 3MM4A 2R6GA 1CK4A 2EW8A 1P80A 3BJRA 3ZCTA 2V7QA 5FV7A 1UANA 4E5UA 5B64A 1U6KA 4KBGA 1OFIA 3DMGA 1N9GA 2C77A 3RAFC 2HGZA 3H3JA 1OC4A 2ZSKA 3HHEA 1QHFA 1WXFA 4TSKA 1EJ2A 2WD9A 3RF6A 3RO7A 4BO7A 3K5HA 1GKLA 4E30A 3AR2A 4KGVA 5TEVA 2FKNA 2QZ9A 4QUEA 1FS6A 4XCVA 4H7IA 2G4VA 4JHXA 4RH1A 1UEJA 3K9QO 1TJ3A 2X1MA 1E3JA 1KY2A 4ERXA 2XBUA 1T15A 1VDMA 3X2EA 3ZVKA 3JD3A 4AG5A 3E9DA 4IEIA 3LKVA 1H93A 4P32A 1HURA 2PA0A 3O91A 3T7RA 3TB6A 1Z4QA 3TWOA 4CF5A 1V8FA 1UBNA 4DLBA 2FQ1A 3CVOA 1D6JA 1XLVA 2IYUA 3H1AA 3JWEA 2BGUA 3KAJA 2A0UA 1R0RE 5FPQA 1V5GA 2A1IA 1TLTA 2C8LA 1RYYA 4P2GA 2TMYA 4DUGD 3E6AA 5JATA 2QRGA 3ZE8A 3QIVA 4CQNA 4IDDA 5A62A 3W2HA 4TWIA 3D1LA 1FX0B 4ZPXA 3W04A 1SWWA 1KU0A 3JZDA 1TQ6A 4F21A 5HIKA 4U63A 1MW9X 1VJTA 2AX3A 4BO2A 2ZVPX 4EI2A 1X2EA 2IUSA 2CNBA 4KQ9A 4FMBB 5IH3A 3C15C 4ZVQA 3PFWO 3FR7A 3PUVA 4M7OA 4MMXB 4FGWA 5BSRA 3EIXA 1P91A 2ZJ1A 2FUEA 4U6NA 1QIFA 2AFIE 5CB0A 2GEUA 1MT0A 1XQ6A 1SC4A 1XNJA 1YDFA 2HH9A 2Y2VA 1C7ZA 5JPIA 3WL3A 5B3JC 4KN8A 4JDUA 2SHKA 4LHZA 3GNTA 4URYR 1H05A 1XPJA 1V7ZA 3H9CA 4PR3A 4UM9D 3R4VA 7REQB 2I5PO