4MUHA

Crystal structure of pantothenate synthetase in complex with 2-(2-(5-acetamido-1,3,4-thiadiazol-2-ylsulfonylcarbamoyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
286
structure length
286
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 97
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4muhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4muhA01
4J75A 4OJMX 4QREA 5FO1A 4YP7A 4OUDB 1V47A 4MWEA 1MAWA 3FH0A 1NSYA 2E18A 2VTBA 3COWA 3HMQA 2H2AA 3N05A 3CVXA 2HGZA 4EG3A 1X8XA 3ZUGA 4PBSA 4KKVA 1MB9A 1O96B 1YIDA 3IOEA 3FY4A 2AKEA 3PNBA 1F9AA 3FDXA 1EE1A 5FO0A 4EG7A 3ZJVA 1EFVB 4QRDA 4K03A 1KH3A 3ZJTA 3N2YA 4NX2A 1GAXA 1M8GA 5LM3A 3Q10A 1WOYA 4MVCA 1QU2A 1JZSA 2D13A 2WB2A 1N2GA 1TYCA 4I6GA 2O5RA 4PY2A 5J59A 1WXGA 1PG2A 2Z09A 3CLTD 1GTRA 3IMEA 1D2RA 2QUKA 2A4MA 4ARIA 1KP3A 3IUEA 3IVCA 1NI5A 4XFJA 2DETA 3H99A 1H1TA 3CLUD 3FWKA 3GMIA 2C5SA 1NUSA 5K0SA 2A1UB 1OWPA 4Q16A 4MUNA 2RE8A 1RQGA 1NUTA 3CLRD 1VBKA 1WJGA 1WXFA 1O0BA 4XSVA 4I6JA 1IVSA 3ZIUA 1SURA 2YWCA 4YMIA 4MWCA 3L93A 1K92A 1M8JA 4MLPA 2A86A 1K4MA 2D54A 1IQRA 1I6MA 1JEEA 1O97D 3MXTA 1O0CA 3RK0A 2DR2A 1JHDA 4MUKA 5H7XA 2D5BA 3Q4GA 3RK1A 2JA2A 2HZ7A 3MLAA 3P52A 1WXHA 1TQ8A 2A7XA 3DO8A 3SEQA 2WSIA 4KPUB 1KKUA 2J09A 3TZEA 1M8PA 4MUGA 1M83A 1ZH6A 4MW6A 1OWLA 2YXNA 4UZFA 3UOWA 3D6VA 1WQ3A 3DLAA 3ILVA 2OQ2A 5IHXA 2PZ8A 5HG0A 3FIUA 3FHJA 1GTSA 3ISJA 4X0EA 1EXDA 3N8HA 2J5BA 2V0GA 2CYCA 1XNGA 4GRIA 1TFUA 4EG6A 5KHAA 4WSOA 1G8GA 4HJRA 3PNVA 1TYDE 3UC5A 4P2BA 4ZT2A 1F7UA 3U1VA 4L2IB 4AQ7A 4EG5A 2BYTA 3IOBA 3TS1A 1NURA 2QJFA 2R5WA 3JXEA 1KP2A 4NAHA 3FOCA 5HUHA 1I6KA 3A04A 4J76A 2QUJA 3CVUA 4NZPA 4MQ6A 2X1MA 1J1ZA 1NYLA 3AIIA 3ELBA 3OTWA 2YWBA 4RUKA 2J07A 1K4KA 1ILEA 4JXZA 3FG9A 1KAQA 3ZGZA 4MW1A 2WQ6A 1G59A 1ZUNA 1CT9A 4K0RA 4R0NA 1XNJA 3SEZA 1VBMA 1EFPA 3CLSD 4NATA 2DXIA 1J09A 1LW7A 1N2EA 1TYAE 4ND6A 4E1AA 1TYBE 1WQ4A 1A8HA 3HL4A 4MUJA 1PFYA 1U3CA 3UMVA 5KWVA 4MW9A 4MVXA 1J70A 1M8KA 3CLTC 3PXUA 4JFAA 3IODA 2ZUFA 3CVVA 3CA8A 1DNPA 2EL7A 1FYDA 2Z3VA 3CLUC 1ZJWA 1J21A 2CUZA 3SP1A 1OWOA 2CV1A 2X3FA 4RPIA 5HUJA 2PZBA 3CLRC 2I1LA 4CT0A 1BS2A 3ND7A 2PIDA 4FZJA 1N1DA 4ZT3A 3AG6A 1H3FA 1QU3A 1T6YA 3HV0A 2QTMA 4JXXA 1J1UA 1O97C 1VL2A 2EJCA 4MUIA 5J58A 1N77A 3A2KA 3HZRA 1JZQA 4UZEA 1OBHA 1GN8A 2CT8A 2GKSA 3KT3A 3IVGA 3IH5A 4Q93A 1QRTA 3ND6A 5DEOA 2NZ2A 1HYBA 2IP1A 3X1KA 1JILA 1PFWA 3AFHA 3RHSA 2GOYA 3K9WA 1XNHA 1PFUA 3LE8A 3TZLA 1GPMA 3IVXA 3COZA 3X1MA 1B6TA 1KH1A 4CDMA 2CV2A 1T6ZA 4MW2A 2E21A 4OUDA 1JGTA 2DLCX 1VLHA 3FNRA 4EG1A 4DDMA 1U7XA 1O94D 4HPWA 4MULA 1PG0A 1ULHA 3UY4A 4HK4A 1UFVA 1T9GR 5DK4A 5TEWA 5DASA 3TQIA 3UK2A 3G6KA 2CV0A 1O96A 3NBAA 3SYTA 3H9BA 1EFVA 3AG5A 2AG6A 3GUZA 3LCJA 3NBKA 3A05A 2V0CA 2A1TS 2VTBB 4YP6A 3H97A 3F3MA 1IFXA 3L92A 3CLSC 2QJOA 3CR8A 1N3LA 2ZP1A 1TEZA 3VRHA 3X1JA 1O6BA 1GZUA 1N78A 4TS1A 1I6LA 1MBZA 4MW5A 3G59A 1P7PA 3MLBA 1X6VA 1Y42X 3DPIA 1NZJA 1NUQA 1WY5A 2QUHA 2CYBA 3KFLA 5TEVA 3RFFA 2A1UA 1WXIA 4PBTA 3BL5A 3N9IA 2PG3A 5LLTA 3SZ3A 1QQTA 1O95D 2HMAA 3INNA 5F23A 1U7DA 1N2IA 1LI5A 4ZCSA 4HJXA 3H05A 3C8ZA 2IELA 4H3SA 2B7LA 1MJHA 4F4HA 1WZ2A 4QBTA 2J4DA 1JIIA 1IQUA 2QTNA 4MW4A 4CDNA 2XRZA 4ZT4A 1FFYA 1LI7A 1WKBA 2RD2A 3COYA 2Z08A 3NV7A 4YP5A 4ZT5A 1JMVA 1NP7A 3AL0C 4MVYA 1OD6A 1Q77A 4GU5A 3IMGA 1GLNA 3KT8A 2PZAA 4EF6A 1K97A 3M5WA 1KORA 4G6ZA 4F3RA 3SDBA 4YBRA 1F4LA 4JYZA 1XJQA 3MUEA 3H9CA 3MMXA 4CQNA 3IMCA 3AKZA 4S1OA 3K32A 4NDAA 1IQ0A 1PFVA 5TGTA 2DUMA 4DDHA 3IDFA 4MWBA 4MW7A 1R6UA 4MWDA 5JBNA 4EG8A 2JANA 5EKDA 1EUQA 4U63A 2X1LA 5DB4A 4L2IA 1JIKA 1H3EA 1OWMA 4ZT6A 2JAXA 1O5TA 1OWNA 3OP1A 2H29A 3P0IA 1MC1A 1I2DA 1VBNA 1YULA 1KH2A 1S4MA 4R2LA 1MOPA 3COVA 3ZJUA 1O94C 3QTBA 1U3DA 4NAUA 1MB2A 2XRYA 2IJGX 4EG4A 4KR6A 4ZT7A 4MUEA 1KR2A 5BNZA 2DERA 3LOQA 2A84A 4U7JA 4ZCQA 4DDKA 1R6TA 3ZXIA 2WQ7A 2CFOA 1EJ2A 3KT0A 1JECA 4U8HA 1T9GS 4MW0A 5KCMA 1M8FA 4AS1A 4KR9A 3KT6A 3IUBA 1Q19A 5LFAA 5K0TA 3I05A 2DPLA 1NUPA 1R6XA 3QTTA 3RJZA 4I6EA 4KR7A 1M1ZA 2CYAA 2NSYA 1KAMA 4ZCTA 4ARCA 4A91A 1YI8A 1QTQA 4MAFA 4WNYA 4ZCPA 3SZGA 1U0BB 1EFPB 1JIJA 1MAUA 2PFSA 2YY5A 4DE5A 2AZXA 2E89A 3A4IA 3Q12A 2TS1A 5AHWA 4DJAA 2QJTA 2QTRA 3P0JA 1QRSA 1YUMA 2E0IA 2OV4A 2VXOA 4MVWA 3RBAA 1QRUA 3G5AA 1F7VA 1G8HA 1O95C 1Q15A 1KQPA 4EFKA 2J08A 5FNZA 1YUNA 2A88A 3IOCA 4MUFA 1MRZA 2PXHA 3ND5A 4BWVA 3CVYA 3TQOA 3FETA 3HFJA 1G8FA 4R2MA 1ZH0A 2ZUEA 4ZCRA 1N75A 2G36A 1QNFA 2QUIA 5H16A 3PNYA 3VGJA 4PBRA 4G5YA 4XFDA 4DNXA 3CVWA 1Q11A 3QE4A 3S3TA 1N2BA 1H3NA 5J5AA 4JZYA 3ZXSA 1N2OA 1COZA 4MUHA 3HGMA 2BTEA 1N2JA 1T6XA 2O8VA 1EUYA 1IH8A 4ND7A 1WXEA 4G5FA 2X0KA 3GLVA 2A1TR 3PRHA 3E27A 3TNJA 2DEUA 2GM3A 1N2HA 1OBCA 3D6UA 3DV2A 2CSXA 1NUUA 1KQNA 3FI0A 4DLPA 1IRXA 5IJXA 4EGAA 4KPUA 1KQOA 1YIAA 1V8FA 1JEDA 5TS2A 1IHOA 1J20A 3P0HA 1QJCA 3VU8A
chains in the Genus database with same CATH superfamily
2D74A 2VSYA 3BA6A 3NIBA 3O4RA 4RA9B 2H54A 4BGEA 3VKGA 1W6UA 3OZUA 4M1QA 1P4HA 3FMGA 2D62A 4F93B 2GF0A 4C3VA 1XTVA 1NDQA 2Z83A 2O8DB 1E9FA 1GT6A 2OV8A 4IJ5A 5LQNA 3ONFA 1SD5A 1Y9AA 3KD2A 3TLMA 4URUR 5F2EA 3PHHA 1F2VA 5EJ9A 3PJFA 2PZMA 5BN3A 2FFBA 2OP1A 2WICA 1X8XA 4M9XA 5TGDA 4JSRA 4GOMD 3TL2A 2FMIA 4DB4A 4Z49A 1DAEA 3FY4A 4PPYA 5C5EA 3GLIE 4LHYA 4U1RA 1YHYA 5DGCA 1JEQA 1SZDA 5AKXA 1CJKC 3L7LA 4C7OB 1ACMA 4OQDA 1LBTA 3GZJA 3SC2B 2D8AA 3U9LA 2I33A 1XKXA 3TSCA 1GPUA 4A82A 5K0JA 1EIZA 1WMAA 4MVCA 5J4HA 4LGCA 5KYYB 1PGPA 3RREA 2C78A 4L8FA 3KLNA 1H9BA 2JIZD 4FQ7A 3QSGA 4PX9A 4Z99A 4DSZA 3ANXA 1O4WA 5KYNA 1JMYA 3GEBA 2IC5A 2QAIA 2XMRA 1PW5A 3HEAA 1CJTC 3IDQA 3SNKA 3V8BA 2E1RA 2R65A 1EM6A 2FEMA 4I5EA 4Y2SA 1PL6A 3MAJA 1QRDA 2A1UB 4WY8A 3SZMA 4LRTB 1AUQA 3NUQA 3T9AA 4R98A 3VAYA 4A4DA 3WLSA 1WJGA 1O0BA 4TN5A 2Z1MA 4E33A 2XYHA 2P5YA 1CVIA 2HA6A 1ISHA 3BIJA 4PICA 3GFTA 3IP7A 3BAZA 3GJ5A 3LLUA 4G24A 4HDMA 1OA0A 5L7YA 2BF7A 4GLOA 2PIAA 1PTJA 1NLZA 2B35A 3FGPA 4DG9A 2NVUB 3E9ZA 1W0JD 4C6HA 2GHTA 4X66B 1XNQB 2IOFK 2Q8NA 3U7EB 4B2LA 4HL6A 3LUFA 1XVUA 4EDHA 2ZYRA 2L17A 1OIVA 1XYVA 1I13A 2PE5A 5KU1A 1HDCA 3KXPA 3OFVA 3Q4GA 1XTTA 2PMBA 4HYEA 4DM7A 1ZA1A 2DWUA 2YBDA 4OGLA 2EF0A 5FTNA 3B1FA 2GTPA 4Y9DA 2I6XA 3M6WA 4LFAB 3PQ4A 3DO8A 2X0FA 4KIJA 4K81B 3CNQS 4M22A 2TMDA 4IJKA 4C20A 4F8YA 3VR0A 3WLNA 5D3QA 3KLMX 1VZ2A 3LQ2A 1RJDA 3OQ1A 2YZNA 3VR5A 3IBFA 3IR5A 2XUAA 2OO7A 1WUIS 5JQGA 4TV9B 1QCDA 2VTVA 5EZ5A 4DILA 2NZ8A 5TVGA 5CITA 1H2ZA 1SVOA 3E35A 1A97A 1KKMA 1HETA 3AKYA 4KE9A 1AKNA 2FZCA 2ZZNA 2AQHA 1GZVA 3G9TA 3GAZA 3PNVA 2ASEA 3ZHYA 2XT9A 1U81A 1ZHFA 5DEIA 1H6DA 2JATA 4I55F 1JDPA 2B1IA 1NJSA 3TJZA 3I6ZA 3KQLA 2R5WA 4TT3A 4CKBB 2O8BA 1NT4A 2Y99A 2GNPA 3JTEA 3TBHA 2I6FA 3FOCA 5BSUA 4OGGA 3CVUA 4JU9A 3OT4A 2VJKA 2C20A 2Z6VA 1M2VB 4KJXA 1QFMA 5JAQA 3IA7A 1IJKA 2BGLA 4IMPA 5LYYA 2W83A 4LJ6A 2CXUA 3E9EA 3D8RA 1NXTA 1SVIA 3EWSA 3ST7A 2QRLA 1XZIA 3N7UA 1VSQA 4J6FA 1TK9A 3FDIA 3DEZA 3LC7O 2PO5A 1YI1A 1EVZA 3AVXA 4M8SA 3BZWA 3HB1A 3K9GA 3BF8A 4D02A 4XYMA 3U7GA 1NV8A 4FWIB 1II8B 5DN6A 4CG3A 3PUVA 4KGXA 1A0OA 1BDMA 2CXTA 1T36A 2ID8A 4ND6A 5BVHB 3QMVA 1NN3A 2M2IA 1G64A 2C84A 2GTHA 4GRAA 1GSAA 4ZVSA 2VRWA 2A3RA 3Q8LA 4TLLB 3HL4A 3O95A 5JE8A 5KJCA 3TAXA 2VJAA 3FWPA 1Y7TA 1NKSA 5I7AA 3T4EA 3PENA 1ABFA 1EFDN 2ECKA 4RNCA 4W9RA 5FL7A 3IE1A 4M4SA 3IYLW 3M5DA 4LK3A 1W85B 4AN0A 3CLTC 4DHWA 1NN0A 1C1HA 2V0NA 2C5GA 2V6BA 3O2JA 4XGIA 3GZTB 4WK4B 3BGWA 2PGAA 2SKCA 3L6OO 1KC3A 3ANNA 1OLOA 5B37A 1HXHA 2HPZA 3HDTA 5HMLA 1FYFA 5KJ6A 1ACJA 2ZI6A 3O75A 3OOYA 4ZTBA 5JFOA 3NT4A 5B36A 1J21A 1W0CA 4PLZA 5DTJA 5LJIA 5KTRA 2KHZA 3PBKA 3H11A 2PX6A 1ZZGA 1TKRA 3AINA 1EWKA 4GLBA 3E7WA 1JTEA 1QGZA 1VPEA 5IUJC 3RJTA 4BJ3A 5E9QA 1CSEE 2R8OA 16PKA 3L8ZA 1CZOA 1NU6A 2KQUA 2NO1A 4Y1FA 5CLIA 4P4GA 5C81A 1HH4A 4IRXA 1FVHA 3I6MA 2WHRA 5AUNB 2P9CA 1WETA 4RYLA 1USGA 5FFFA 2D2VA 3GV0A 3K73O 4GI5A 2N46A 3BM5A 3TVDA 3ZH9B 5I7FA 5D5QA 2YHIA 3IOMA 3LGXA 1K7CA 2B20A 4OQLA 5ECYA 1OASA 1X9HA 4RQTA 5TT1A 2ZDHA 1QQ7A 1LBQA 4P3YA 4MTLA 3ZWCA 2ADMA 3PJRA 1TJPB 1YBAA 4TTSA 4FYXA 1PI3A 1W4CA 2GKSA 4G4SO 2CT8A 2PCLA 1DIRA 2A8YA 5DBFA 4C1NA 1B3RA 3IH5A 4D9JA 1RRCA 4MEBA 3BGDA 1W5BA 3PC8C 4DIOA 1AKMA 1H4TA 1T1IA 1SVNA 1ZQ9A 2TMYA 2TYSB 2XMGA 1G291 3QLEA 4J6EA 1KSHA 1LPNA 1ORTA 4BTEA 5MFPA 2G9ZA 2GEDA 3KQNA 1DIOB 2FPRA 2ZWVA 3HCPA 4YAOA 5U4QA 1PDWA 3TLJA 1Q17A 1IM5A 2IGTA 1KIFA 4IQ0A 4XTRA 1AM4D 5HDBB 2BELA 4CV2A 1ZN9A 1LWNA 1D2CA 4H7PA 1EAYA 3KC2A 3KYBA 3QUQA 5EKXA 3OQ6A 3OY2A 3VKWA 4BJHB 4N6OA 4CDMA 4EA7A 2X1VA 3NATA 1IB6A 2OEPA 3QBJA 4IL5A 1JYSA 4YJ3B 4IHJF 4MULA 3I4LA 2IXBA 2FSGA 2NZVG 4Q3DA 1RWNA 3UUWA 2HBZA 1Q7BA 4KP7A 3OM1A 4WCVA 3AKDA 2RIRA 1G17A 5FI1B 5HIMA 3K9QO 3TGWA 2DECA 1O4VA 1ODSA 5JUWA 2RC6A 3WV4A 2HDOA 2YICA 3RS0A 4J0QA 4AF6A 1U1FA 2RHMA 3STVA 4AP6A 5IZCA 1O96A 2W8BA 1BD4A 4WASA 5CLFA 3EUFA 2QENA 2FEAA 3ES9A 3FZYA 1P5ZB 3R3ZA 3SSOA 2ZAMA 3SYTA 5JC1A 4WCFA 1KPHA 1W29A 4KH0A 3MTIA 4ZCMA 3NBKA 1VKOA 3D7KA 1IBCA 4E88A 1VHTA 2OVBA 1T9ZA 3O4IA 3OZFA 1ZUWA 3HN6A 3USZA 1M3SA 4LWQA 4EF4A 1QM5A 3Q3JB 4YQYA 2QM0A 4AQDA 4CGZA 2F4VB 3AI3A 4QXQA 3L92A 1ZK2A 4CDRA 4RTJA 3ITNA 4JA0A 3RRXA 4G1CA 3WBBA 2PBFA 2R1UA 1L7EA 1EB8A 4YH1A 1XMVA 1TEZA 1DL5A 1LNZA 3OCVA 3VKVA 1TJ5A 2WHQA 4HVLA 4OHPA 4PO9A 2BDUA 1QR2A 2YWGA 4JBNA 3ICPA 1WO8A 2NU6B 2QRKA 2TECE 4MVJG 1HDRA 3K8QA 3VHLB 1XEWX 1MC4A 2CHVA 3HWWA 2XHZA 4KO4S 5LKAA 1OZ0A 5J1SB 2OORC 2ZXUA 2JLZA 3BCUA 1JHVA 1YFJA 3N59A 2R6GA 3MRTA 4PG6A 4ZD6A 1B2RA 1Z6AA 2RI1A 3KPJA 1EU1A 1I5OA 3N2IA 2C98A 3VXKA 5ICSA 3RRJA 4LTMA 1GGKA 4D74A 4RDXA 3WGGA 1D09A 1DPFA 2HSGA 4K6FA 4LGMA 4EUSA 1Q50A 3KVNA 4BV9A 1D4OA 1C0LA 1W88B 1M6EX 1WUKS 1AC5A 2O4CA 4FEYA 1X1RA 4ZPJA 5HKOA 1BDHA 4QOFA 3HKEB 4LMRA 5ECGC 5CUQA 3V48A 1T2CA 2C3OA 3A1FA 1A96A 4RKWA 2IHYA 1XAGA 4IX9A 3JZDA 3GGPA 4HJXA 4ZYZA 1X74A 1JH9A 4F4CA 3NMUF 4HB0A 4F4HA 1ZK4A 3WL5A 2LCQA 4A0RA 3QENA 4JK3A 1EDDA 2DC1A 2XCSB 1JLHA 2AW5A 3A2MA 3I6IA 2VBCA 3OFND 4MZXA 2JI4A 2JGKA 1QC5A 2BGWA 1WPGA 4HAOA 5AJVB 5LBIA 4MV9A 3R0ZA 4NPHA 3RH0A 5DHQA 5D3ZA 4LHXA 3MAGA 2H92A 2I78A 2P9EA 4DV4B 2B8TA 3M6UA 4KLRA 4TSKA 3AF4A 2TMKA 3QNUA 3IELA 2GN4A 3GUHA 3D3WA 4JUDX 4L76A 2PRJA 2O2ZA 5DYIA 4AY3A 3G2HA 5DNYB 3S2YA 2WM2A 1C8LA 2NPIA 2W6OA 4OLHA 3L4BC 4XW2A 3TN7A 3M3PA 1CBUA 5F21A 3E1KA 4V2IA 4A2WA 3OZTA 1J9EA 3VX4A 4KR2A 4DDHA 3PQ5A 5KPDA 2HT6A 3R7BA 4KRYA 1MEJA 1NVWQ 2LE0A 5J1TB 4JP2A 4D6YA 1RLJA 4FGWA 1MRNA 2F59A 2IITA 2Q45A 3IPYA 4M0EA 4OBXA 2OZPA 1AOXA 3D4OA 3N2GA 2CNNA 1CQZA 3LPMA 2FG5A 3EQ9A 1KEEB 1H3EA 2QLMA 5TMBA 2BR5A 4KHPB 1B6RA 1OUMA 4E1BA 3DF9A 1NJGA 4BEWA 1F12A 2XNDA 5CR9A 1FVOA 4DV0B 5PGMA 1MIHA 3K71B 2QRVB 3JQAA 4NFHA 2P40A 1ULTA 4WXYB 5ALZA 4NY1A 3TFOA 3RG2A 5CNJA 1C7EA 1H5NA 5JD4A 2M6RA 3GEGA 2V8OA 1X7ZB 4DLBA 3O8QB 1FXSA 4EYKA 4DJEC 2BM0A 3W8FA 3ZE0B 5FQOA 4FB4A 1YI0A 3BRQA 3H3JA 3Q9NA 4GZMA 4KR6A 1CF4A 5IX8A 4XYLA 4MUEA 1YQGA 1XRSB 3O21A 3CX3A 4HPXB 3TGPA 3NBXX 2FVXA 1JALA 2IU0A 4INOA 2NZYA 1PUXA 3KJHA 1AV6A 3DE1X 7REQA 1OX5A 4FGJA 4TRRA 1OYOA 2VQ6A 1YFLA 1NG1A 2DQSA 2QPLA 2OE2A 1ZMRA 3CLHA 3K0BA 4DSNA 1PNVA 4WN9A 2R25B 4IDDA 5K0TA 1QHHB 3TPFA 1RFGE 1DBVO 3QU9A 3Q3CA 4HN9A 4LYHA 1XTKA 3CH7A 3FPFA 1GSHA 3WADA 4EARA 1M1ZA 2VR1A 4OU5A 4NDZA 1D8AA 1UM8A 3V8QA 1K63A 1SK9A 4WNYA 4XGNA 3VC1A 1HZZA 4J1QA 3C8HA 1SFRA 1RDFA 2PUTA 1OROA 5I9MA 4R54A 1BRMA 5C8YB 2AZXA 3M4XA 3QVKA 4G2TA 3M2PA 1GRVA 4HT3B 5A0VA 1BG6A 1XMIA 3I73A 4RPGA 2CNKA 2QJTA 4FXPA 4WNAA 1CNEA 4FKBA 3REQB 4AKGA 1ADYA 1LVHA 2E0IA 4HF7A 1UFOA 4GC9A 1JI3A 1BCRB 3ACDA 5JNVA 5JVDF 1CEYA 1FS5A 5THXA 3C3YA 5SY4A 2QSZA 1RXYA 2VJMB 5GJCA 3K0AB 1WCIA 4BWVA 3LP8A 2PXHA 4HN4B 2GH1A 4A2CA 1MTZA 2GZHA 2HFJA 3W9UA 1UOQA 1Z7GA 2C31A 3DTNA 4XOIA 1HFKA 3PQ8A 4IXNA 4UQOA 3S7TA 4J2HA 1Q2UA 4XYEA 2AYXA 3W4KA 1G9XA 3QWFA 3V34A 5T3YA 4K88A 4IZOA 3RJ9A 3HLKA 4PC6A 4RTSA 1SB9A 4FBMA 4WA7A 2JD1A 3DL4A 1V2HE 1YQUA 1C5KA 3LYHA 4KBGA 4BFVA 5JLAA 4BJ6A 4AUMA 2OAGA 3UJ6A 5T67A 1ZU5A 4IUDS 1CUVA 4F2HA 2DUUA 5ALSA 2QEQA 3B20A 4TSFD 4ROSA 3I37X 2RGRA 4NH4A 4PNPA 5GWXA 5EJ5A 3MD9A 1X9IA 4AIRA 1I3CA 4I4IA 4PO3X 4W1PA 3TXAA 3WGYA 2XOEA 4RDCA 2RH4A 3DW1X 4BO3A 4UU1A 5T4BA 4NEHB 3DMTA 1N8NA 1I1NA 1KIAA 3DDHA 4AX4A 1SHLA 3W2IA 2ZETA 1UBSB 3ICQB 1M76A 2ISQA 2ATCA 3H2GA 4R8VA 3ZZTA 1TAUA 3DFMA 4YAFA 3RDPA 1N2HA 3H18A 3JV7A 2A58A 3CV3A 4F60A 3BE4A 1NNI1 4KO8A 3KE9A 1U5AA 2GX6A 3AR3A 4O2AA 4CEIB 1FTNA 3G5TA 5EWMB 6NULA 3WGJA 3GJQA 3F4LA 2NLOA 2PMWB 4HZIA 4KEAA 4QDKA 1ZD9A 2GYWA 2PWBA 1I7QB 1E0JA 3IR7A 1E62A 4HXGA 5HILA 1E59A 5I9SA 3UC9A 4BLVA 5B4UA 2JLSA 1WVMA 2JFBA 3BD8A 4RIGA 5JJ5A 3HP1A 1NXXA 4KB5A 3FCUB 4LZNA 4G36A 4A0QA 2IS1A 2BGUA 2FTKE 3CZRA 4ZCLA 3D8SA 2V1UA 2GVZC 1IBRA 1FVFA 4FDVA 4MWEA 1HWYA 5KTNA 2ZU0C 1F5SA 1I9GA 2W2LA 4NDNE 3TAHA 1MU0A 1WW2A 2WU1A 5ICFA 4D82A 4M0UA 3GN2A 4Y9UA 4HYYA 4MRPA 4EDFA 2UYYA 1TPZA 1SCJA 2VP3A 5ADUS 3N05A 4RVDA 1PJRA 4FFLA 1RLTA 4ZAWA 1H66A 4Y9SA 1Z5PA 3PXXA 1BWPA 4NMLA 4PBSA 3BTSA 2QW1A 3K31A 5EYPB 2VVTA 5EMJA 3V6LA 2CFTA 4X90A 1J24A 3ZOZA 1QLJA 3LZDA 2HMUA 4XFKA 4KN5A 3WLRA 2O59A 3QTLA 3CNBA 2J30A 3ABIA 1JG1A 2JCGA 3N39C 4K1LA 5BSGA 3QF4B 4R69A 1JQ5A 3N2YA 2AI1A 3KZVA 1E2PA 3OI7A 5FUWA 4WERA 2NZUG 3TRJA 1PN3A 3G7NA 4F9FA 1SK8A 1SUWA 2Q28A 2E4VA 4BMOB 1LQTA 3PFWO 1MV5A 3C5EA 2ETXA 3A2NA 4C01A 4ZJPA 2HHHB 4G0VA 1YZ3A 2YIMA 4FYMA 1BXGA 3D4NA 2IZZA 3B1VA 4GH5A 1F20A 4OAOA 3I39X 2ZVQX 2BF4A 2BMWA 1E0SA 3H99A 3QPDA 4H7JA 2IF2A 3O83A 5EJ7A 4KDCA 4E2WA 5FPSA 4ZIRB 1E3LA 1MJFA 3DTTA 4CETA 2PUEA 3RC7A 3C3MA 2OZEA 4L50A 5BPHA 2BVNA 3F9CA 4LWZA 3ZGXA 3SU8A 1OLSB 3CLRD 1A9YA 1NBMA 1WXFA 4MQ4A 4I6JA 2Y0CA 2A67A 1PIWA 3WJAA 1JQDA 2ZM5A 5DLEA 2YWCA 3M2TA 3NXSA 4L0QA 1SXHA 4RHFA 2GLTA 4MLPA 1TKBA 4MP8A 4OY3A 3RYCB 3H9EO 3WTBA 2KWIA 1RABA 2O2GA 4LXQA 3E3OA 5B1HA 1W36D 1SIOA 1W6RA 2WB4A 3N6RA 2NUTB 2P6OA 3PS9A 3QWBA 4UTXA 3V8MA 3STYA 1AKUA 2OK8A 4KQJA 3O9VA 5BMVF 2CXXA 4PCLA 2H1VA 1A7UA 2EWWA 3UAYA 4HEQA 4S0XA 1MB4A 3VR4D 2IYRA 2PD3A 4R7ZA 3X44A 1V71A 4M53A 3WIVA 1JR6A 2C3MA 2IXAA 4IOLA 5IAJA 2G70A 3QY0A 2AXEA 1L8LA 1R9MA 1FUEA 2A0XA 4OP3A 5G4LA 5IYZA 1E3IA 5KVAA 5M29A 3ZCQA 1VG1A 3MJFA 1TCUA 1KYXA 5ERXA 3LPLA 1GGEA 2GNOA 4BO0A 1G19A 3TFQA 3LT0A 3FTFA 1RLOA 4X61A 1FK8A 3EH2A 4MMYB 1P2SA 3I32A 1SUIA 1E0KA 3ISJA 4HTFB 4NBTA 1BDJA 2B37A 4QO7A 1R0WA 2PSJA 3V4RA 2V0GA 3NX4A 3A9SA 3JATA 2V7QA 4GKBA 4ZOLB 4EA9A 3P2IA 1XMSA 2EATA 2YL2A 5JPDA 1VRVA 1DUIA 2RGUA 4UBMA 5MF6A 1JSXA 1F7UA 3VR6D 1DCMA 2GFIA 2X0JA 1E79A 2YS6A 1TUEA 3C1UA 1ONBA 4TUYF 1EFKA 4OQYA 3N8GA 1Z6YA 1SU6A 4CN9A 1I3KA 4D56A 2ORYA 2FKAA 3VDMA 3OLYA 2B8EA 2Y1LA 1AV7A 3BSWA 4CFYA 2Z95A 1F38A 1FTSA 2X1MA 1G1AA 4BN0A 4EHIA 3HCNA 3GRFA 3N86A 2X9LA 2VHCA 4TXMA 3L6BA 2IE0A 3HCRA 4B0OA 1E2LA 2BHNA 2DVMA 3BIXA 1SC6A 2C59A 2HPAA 5CGQB 1DKPA 2VQSA 1IMJA 1P8AA 1EH5A 2Q0XA 3FWZA 6REQB 4JI2B 2WQ6A 1IWOA 4GKJB 3CWZA 1TD1A 4QQRA 2WSYB 4TKUA 4TTTS 1BEUB 2H57A 1LDNA 4Q24A 1VC2A 2WMOB 5DX8A 3DYIA 1TAQA 2RK3A 2WAMA 3UK0A 4MRMB 1J39A 1KC1A 2Z5VA 3R77A 3FNHA 4HEHA 3VSBA 3VKHA 2GFHA 4H6PA 2O5CA 4F2PA 4LF4B 1IWBB 4ER0A 4P93A 2GBLC 4GM1A 3UF0A 2HHCA 1OOEA 2P2CA 4HGYA 4RQUA 3GR6A 5TQ2A 1MQ8B 3JAKB 4LG1A 1H1DA 2UZIR 1E1RA 3BMOA 4KUGA 5HX7A 3T3HA 2XXAB 5FFMA 4BXOA 2C54A 2OFPA 1ZM7A 4LHZA 4P34A 1XDZA 1AD2A 2VF8A 4M9RA 1JKFA 4Z5XA 3OJXA 3VZSA 1R9GA 4ECEA 1PAUA 1ZICA 4R31A 3F8WA 1JDBC 2EFJA 4MIYA 1JF8A 3UHJA 5B7NA 3MB5A 4AMGA 4GE3A 4PHGA 3UATA 1JKXA 1FNSA 3DMNA 3GLHB 1UM9B 4PFSA 1MFZA 4RL4A 4E14A 5L40A 1KOLA 2UKDA 3L0OA 3QNMA 3T5AA 3PVCA 2AFRA 3C4QA 1PEKE 1Y63A 2Z6QA 3O8RA 3TQTA 4JI7B 4QU9A 1IN8A 5IC6A 1VB5A 3AJRA 2M6SA 2W6CX 5KNDA 3RIYA 3QLUC 5ALWA 2D0IA 2XYGA 2XLBA 3AI2A 2W48A 1H3FA 1NYRA 1DARA 1QK3A 1W75A 4KAAA 4RY2A 1MA3A 2Q5FA 3KVYA 3NNDA 3I09A 4OJKA 4TWIA 1E1LA 1G98A 1CRQA 1A4RA 1YE5A 3NETA 4M38A 3RUFA 1VL2A 1UPFA 4ZI7F 5CG2A 1SUEA 2BRUC 3VR4H 1DVRA 5HRCA 1DUVG 3NC4A 3LKDA 2Q3BA 1FDWA 2AXQA 4WFQA 2BMFA 1UKAA 1Z5GA 2CCKA 3QXGA 1VE9A 2Y6VA 4NKRA 1R0YA 4KLCA 1JHOA 1DC6A 4O4IF 2CN1A 2H08A 3IVGA 1P0IA 1XZQA 3ND9A 3PCRB 3O4VA 4TOIA 5JFGA 4R9SA 5H81A 1R6BX 3ND6A 5ALTA 3G1UA 2CFRA 3GPCA 3QGMA 2W0SA 4FT4A 3DCYA 5K3SA 4ZODA 4PFKA 1M54A 3IKJA 1JXAA 3ZDAA 4MRVA 1J0DA 1P3Y1 1VLMA 2BGJA 2X4LA 4FIDA 1Z6PA 1CRLA 1T1EA 3LAWA 4LFCB 4MI6A 3VUFA 1DQNA 4EJSA 1DT5A 3VR6H 3EDMA 5JFTA 4MQFA 3LA8A 3DOIA 5JTUA 1B8OA 2GKGA 5CDGA 2J7PD 3UWKA 3WAGA 1JUDA 1T5TA 4BMSA 4EF5A 4Y1RB 3TG8A 1FDVA 3VZRA 4NCIA 5EJEA 4X45A 3I6QA 2P6NA 2PD4A 3ROXA 4MHOA 5DCWA 2FMKA 3GLRA 2KMLA 2BHLA 1OZFA 3IA2A 1FLVA 1GAWA 1UIMA 2BEWA 2OFOA 3PNMA 1OAOC 8LDHA 1ZHOA 1EGQA 4FC6A 1UFVA 1RBMA 3MYRA 2J5XA 5IEBA 1L5KA 3EVTA 4CFZA 2YHBA 1CZUA 1KS9A 3FCOA 2ZSDA 3PWZA 2HADA 1OFVA 1DAMA 2HF8A 2WFAA 3I5MA 2HV8A 3E53A 5H02A 3SQOA 2OBBA 2Y2UA 4XVHA 1B2LA 1KBQA 4FB5A 4F7WA 2GK6A 2XWSA 3LCRA 1CR4A 1JVSA 2FE1A 3HBJA 2XE4A 2AOXA 1ITZA 4DCTA 3DV0B 2RAFA 5SY9A 3FM9A 3IAHA 4DNQA 4BP1A 3HCEA 4HN2A 1HQYE 2A1TS 4YLYA 4U7HA 4BFLA 2M1ZA 4MI3A 4QIHA 2DULA 4DWOA 5CEJA 3HXQA 3DC7A 4QUHA 5BUQA 1YGPA 5EGSA 1XHEA 1QTNA 1QZXA 1YJQA 2Q3DA 1Z0IA 3TOXA 4LYDA 4EY4A 5EIAA 2Q41A 3LLSA 1V11B 4UU0A 2A0YA 3ZCRA 4IGAA 3AJEA 4UVDA 1OTYA 1VJRA 1TT5B 2GTIA 5K8TA 1X6VA 2MDTA 1EJBA 3AC0A 2E6KA 2VO1A 3AB3A 1US8A 2B5OA 2QUHA 4ZO4A 3E7XA 2H4WA 2Y0BA 1PQUA 3I2JA 1ESDA 3R20A 5BW6B 1MC8A 2DG2A 4IMIB 3TLGA 4DUZB 4XQ9A 2Y1WA 3EHDA 3LXMA 5AKKA 4L8WB 4M7RA 1LUAA 1CUEA 1U4NA 1WULS 4YCCA 3GRZA 2H7YA 4FNGA 1XG5A 2GK3A 2Q3LA 1B16A 4H77A 2ENWA 1TLFA 2OFXA 4BVLA 2BTOA 3E23A 3ORHA 2OILA 1AJEA 2B7LA 3F5SA 1G6Q1 4YXWA 5E6UA 4N1AA 1KK2A 3DQZA 3KSDO 1CW2B 3O0DA 5C34B 3WQQA 1T5HX 1ZVMA 2P5SA 1U8TA 3FFTA 1U90A 3AL0C 5IF3A 5EIOA 4MMZB 5I9TA 2WJJA 4E46A 3NALA 5GJVC 4ZTZB 1K7EB 3FUUA 4DWWA 4IJMA 1YBFA 3QKRA 5AKHA 1K88A 4BV2A 2B61A 4IRUB 4PO1A 4XUGB 2SBTA 4ENWA 1O1YA 2EKQA 2P2NA 2XB6A 3H0EA 5DBOA 4HNTA 3MPUA 3DWEX 2FHPA 3KALA 1MG0A 3LWNA 1A4XA 4ZALA 3AKZA 4DRXA 1U8EA 4NDAA 4L5JA 1JH8A 1QDEA 2G3YA 2QA5A 2VHWA 3JYLA 4I1VA 4PG4A 4Y9TA 2AVDA 3CW9A 2BJVA 1R6UA 3AWDA 2W2KB 1P6QA 1T9DA 3RADC 5KYGA 3OCYA 1M9NA 3CWCA 2UUCB 5ALUA 4LRXA 4BX2A 3KZXA 3RQIA 3DBLB 3Q5GA 1FFXB 2ZB8A 2BGTA 4JBHA 4EHJA 5ESWA 3BWYA 2GD6A 3LGSA 1E9BA 3JYPA 1I9CA 2DU8A 1QOZA 4NSNA 1U0HC 4O5OA 4PYKA 5F33A 3UWMA 4YR7A 4HAXA 2HXYA 3SS8A 3LPAA 3T52A 4DMKA 5CLHA 4DL9A 1SCQA 2WF8A 3AR5A 4D8WA 1CUFA 5J2UA 2WWRA 4YRRA 3RU2A 3VV3A 4C04A 1ZH2A 4FJ1A 1NW8A 1YKFA 2C2BA 3CUYA 3KHUA 4XB6B 3P9XA 2HNBA 3L4SO 4DV3B 3R9XA 3D6MA 4GE0A 5BSTA 3SQNA 3W8RA 4BO2A 2Z2JA 5K3AA 3BGSA 4ECAA 3IQGX 3MELA 2BGIA 1XZEA 2IJGX 3RYIB 4GI3A 3D6JA 1QAOA 2P0YA 4NQZA 3LHDA 4DFDA 4DR1B 3WOHA 4XEUA 4B79A 1MRSA 4UPDA 4UULA 1UBGA 4KDRA 4FPXA 4DDKA 3T5DA 3TX2A 4BO7A 5ALDA 2PK3A 1I4LD 2H7CA 1CIPA 2Q4DA 2VBIA 1YONA 4FHFA 4HWPA 2VDUE 4RF2A 3DZFA 1FX1A 3DZKA 4EI2A 1WDLA 3BD7A 3LJKA 4DQKA 5TJ9A 2ZI4A 5KSZA 4L5IA 2VA8A 3OLXA 2WUFA 3UXEA 3AMVA 4BKUA 1E92A 1NPTO 3B6IA 1HKUA 4QNRA 3JY6A 4G07A 4U00A 2RGGA 3BMNB 4IX1A 1Z26A 3AM1A 1PL7A 2QUBA 1UL1X 3QHQA 1NR7A 2C5AA 3LQ4A 3KS9A 4R8RA 3RIEA 4BB9A 1BXRA 1X7XB 2ZRJA 3G85A 5CX1A 3W5CA 1RRPA 3M4ZA 4AF7A 4E4RA 4IVQA 5BT9A 1JG3A 1XTUA 2IUFA 2G1UA 1ENOA 3NBQA 1GVNB 3HVRA 3AJ8A 4HQRA 2LKCA 3MPOA 3HH8A 3CY6A 4PZLA 3I2YX 1ANKA 2V8BA 4IDPA 1XR3A 2PO7A 2XHEA 3K9NA 3QFRA 1XAHA 4RGQA 3H1PA 1Q1AA 4UHHA 5EJ2A 4CLXA 3IAFA 4FMCF 3WE7A 1KK1A 2KX7A 1ISFA 1RRGA 2X42A 3G5AA 3FTCA 2PLRA 1P17A 4NK5A 5EJMA 4C78A 3HJGA 1OGIA 4V0RA 2Y2VA 3NBZC 3BFKA 5CT4A 2IY8A 3E1GA 4PGGA 4JLBA 3IL2A 2D7JA 4AKHA 3KB2A 1OBVA 5A6SB 4BGDA 1YS7A 4N0QA 5D3KA 3VDNB 4DLAA 4U39A 2AF4C 2WM3A 3HBAA 1O6ZA 4WK0B 3KSMA 5ALYA 1YRQA 3DVLA 4I9UA 2MSKA 1UXKA 4JJ8A 3X1YA 4DUGA 3BE6A 4IVPA 4BEVA 1BCSA 3KYDA 4LOJA 1N6RA 1NVKA 2QX6A 5TQJA 3WMGA 3EG9B 1NZFA 1XMJA 1UBNA 1PJ3A 2H5EA 3IJ5A 3UN1A 2XSZD 4DNXA 1Z2CA 1TM1E 1ZIYA 1Q11A 2FK8A 2HA2A 2OP0A 1F60A 5EL0A 2NU8B 1U7ZA 1P3DA 2VSQA 2BH9A 5AI9A 4O3MA 3K9LA 4FBGA 1ZEJA 4RADA 3L0DA 4XIJA 1HG0A 4AB1A 5KDLA 5KX5F 4N3AA 1NSTA 4XCXA 4L5AA 4DJJA 3DVSX 5B1EA 5KNBA 2WJPA 3QA3E 4LV8B 2C5LA 4IS2A 4YROA 4ATNA 1E64A 3F7OA 3VVCA 2IP4A 4TV8A 5M34A 8MHTA 3IIEA 5CH8A 3AEYA 1CUZA 2JH9A 2RGBA 4E5SA 3F8SA 2X5NA 3OQVA 4XXHA 1OT5A 3T34A 3OE4A 1AKRA 2JI6A 2MTBA 3ABQB 1VE5A 2WFMA 5J4KA 4UBNA 3PVZA 3B6JA 3ZU2A 4PLYA 4O4HA 3GGDA 1GL9B 4G1UC 1NBOA 3S81A 1EINA 3AUKA 2R4TA 1N2CE 1ZNYA 2FLVA 4FFVA 4R1SA 3SFTA 5JXWA 1OI3A 1JL3A 4KQ2A 2P9TA 3PNOA 4U5XA 4KQFA 3T41A 1QUEA 1Y1TA 3UB2A 5T7BA 5IF9A 4RC9A 4CM9A 1J20A 3TPZA 1XO1A 2A9KA 2FR0A 2H9AA 2G16A 1ABEA 1EM8B 1ODIA 1XWIA 1ZK0A 1GUYA 4RJLA 5FO1A 2WTAA 1GTJ1 4ADSG 4F6RB 1YSCA 2NYAA 4IIVA 4TWJA 1FPQA 5EXDA 4DNFA 3BXZA 1GFWA 1L8AA 2PU7A 1RQLA 1IXYA 2PM8A 3O31A 4C14A 2FQWA 2VHVA 2A5YB 3I5UA 3L0SA 4LSWA 4NJOA 3EARA 4OGFA 3WFZA 2ECFA 1YRWA 4ZDKA 1KJWA 2J32A 3A6EA 2HQSA 1MB9A 4RV5A 4X8HA 1ZMBA 4ISCA 4C76A 1M2VA 4AXBA 2AYYA 3V6MA 3F3YA 3GMSA 2NMVA 4AS2A 5DM70 5C1DA 2BMJA 3GFFA 3ENVA 4UMVA 4XWAA 2P3QA 5CJ2A 3Q10A 1QCZA 3K4PA 5BSHA 3ZNPA 1X1CA 2BC9A 1V5EA 2VHZA 3CF4G 5BN4B 1TYCA 2WM9B 4YX9A 4JEHA 4Q3AA 2ZSBA 1QKJA 1II8A 2X19A 4K2AA 4XUCA 3G9UA 3ZR4B 1WW8A 3ZHQA 3JQDA 5I7EA 1IPEA 1GTL1 4LOHA 1LDGA 3RUIA 2QD4A 2C7VA 2PBZA 3CLUD 1KWGA 4ZOEA 2M9MA 3H04A 5SZJA 1Y3FE 4EGSA 3DFKA 3AHEA 4MWZA 4N3NA 3UZUA 1LTQA 4BY9E 2RCNA 5DRYA 4JDUA 2C57A 1T29A 1VZ3A 4FXOA 2A57A 4EUEA 4IG9A 2W2OA 2ILTA 3U56A 4YMIA 3MT7A 1KQFA 1T8YA 3TKYA 1Q84A 3KHSA 1PW7A 2H1FA 2R11A 4G9GA 2NADA 1VA5A 3TMKA 4JWTA 1SBIA 5E95A 2PX5A 2W93A 1LLUA 1VIMA 3EJ6A 2RK6A 3NHYA 4ZTUB 1A4UA 3HB5X 3T7CA 4IF4A 2LD4A 4DIEA 1JLKA 1L7AA 4B4VA 2HW8A 1HT3A 1GTZA 2G06A 5JWOA 4MQ5A 2EBUA 4MYRA 4ZQHA 2QQGA 1T2NA 5B58C 1DXHA 3DKRA 2ETVA 3C41J 2C7GA 1YZFA 4G1VA 2J6CA 3AR4A 3WK6A 5FUVA 2W42A 2FK7A 3BWXA 2X14A 3GFOA 5F2KA 5I7UA 3U26A 4KLNA 3KXIA 3UM9A 3L7YA 2ZR0A 3L7OA 4MI1A 1NDHA 4KDFA 4NHEA 4UTOA 2IYPA 1MEEA 4P9NA 3HPQA 4HEA1 4KO3S 1C8KA 2WUVA 2OQ2A 4JI5B 5HZMA 1HSOA 2PJRA 1ZUIA 3K35A 4G1BA 3N8HA 3LTEA 4W63A 2VK8A 2X7HA 3SHTA 3A10A 4CIAA 3IQXA 1UAGA 4GRIA 1KO4A 1XLTC 1U94A 4ZN6A 1JDVA 4K3VA 4K6GA 3T3DA 1JV2B 1W4LA 1V7CA 1YZGA 4O4JF 3ZLBA 3VI3B 2Q5CA 1M7BA 4XIFA 4S1PA 4JJAA 4I19A 1USIA 4JCCA 1JDBB 3DEKA 4DQXA 5CB0A 2J9YB 4RWEA 2OC4A 2PRKA 2AN1A 1EVEA 1WDMA 4O1IA 5KREA 5I3ZA 4F5EA 4E2XA 1EXVA 5EXSA 2UZ1B 3PHCA 5AO9A 2G9NA 4RZIA 3WLMA 1H0RA 2QNBA 2QP9X 1Z5UA 2JLXA 2W8ZA 2H4YA 3W2FA 2ZCUA 3A37A 3LNTA 3EEQA 4YN3A 3WISA 1HE1C 5DT9A 1F4VA 2EYUA 3BT7A 4G89A 3S27A 1J2YA 2UUAB 1N32B 2EERA 3JPWA 5FI3A 4EA8A 2DPGA 1X15A 1VKJA 1CPYA 4R0NA 3T95A 2JEZA 4YRFA 1Z25A 3CO5A 4JUAA 3RBVA 1FP1D 4NNOA 4X24A 1L7OA 2EAUA 3LOUA 3IP6A 3IV7A 4AY2A 4DUYB 2PL9A 1GQQA 5DT2A 2Q1TA 3DBOB 1J42A 1E3WA 1KZ1A 2FPSA 1WMEA 1VDZA 4U7WA 1HMPA 2XUZA 4PLVA 1LF5A 2GXAA 4MCJA 5A9SA 4PR0A 5BXQC 4KI7A 4FVTA 1YJBA 3PA6A 3UMVA 2ZE8A 3KUXA 3KR2A 1I1OA 1II9A 8AT1A 1BX1A 3ZHBA 3PF9A 1D6MA 3E15A 3FFWA 3D6AA 5FI5A 2C42A 1QKIA 2VJQA 4NV3A 2X5OA 2EYQA 1KSGA 3SHOA 4FN5A 4FFWA 2IXEA 5A2GA 1G9SA 2D0DA 3AEUB 2XUPA 1N0UA 3DTYA 4E07A 3CA8A 2M6LA 3EW9A 4GPIB 4CF5A 1IIBA 1BS9A 1VB3A 4D9FA 3PE4A 4MGIR 2LMEA 1FW6A 1KY4A 1GADO 4OV6B 1LS6A 2PWYA 3DZ8A 3E22A 3P0EA 4OYRA 3OZSA 1GGVA 4KBYA 3I6BA 1MAHA 5HUJA 3A28A 2O7QA 2JASA 4C22A 1U5BB 4MGZR 4FZJA 2WWTA 3WL3A 1FJXA 5LA6B 4NS4A 1NMYA 2H00A 4NICA 3L07A 4UM9D 5K8VA 1QG4A 3CEAA 3RIXA 1Y8RB 1EP1B 2Q4BA 3I0ZA 3NVMB 5ECDA 2HRRA 3PUHA 4IHKA 4ZXPA 1MOSA 1D0IA 1RZRD 4NR0A 5JJLA 2IHBA 2WWYA 2FPIB 2NO9A 2YTZA 1MG5A 1ZNQO 3A6HA 5FBQB 4XUEA 3OMWA 1JZQA 1TU4A 4UZEA 4YMSA 1OBHA 3F6PA 4H59A 2IDJA 1OKKD 1R37A 4RH3A 1X2EA 3WYDA 4BMCA 1J8DA 5HE9A 3SGLA 1XDUA 2RB4A 2VKTA 4TROA 3GXBA 2KLBA 1QH0A 1I30A 3MIZA 4Y2YA 4OHRA 5ALHA 1YASA 4OFWA 4XJVA 3KKPA 4FFOA 3S2SA 3TK1A 5DP2A 3AUSA 5DDIP 4BLTA 3KOZA 3HRIA 3NTXA 4FMDB 1WV1A 3ENNA 5AJWA 2FFAA 2XDQB 2OHFA 4HX5A 1F9EA 2PGNA 4Q9JA 1BHJA 5B3LA 1KI9A 3QU4A 4ENQA 1LK5A 4B7ZA 4GC5A 1BVYF 1WTAA 3HDQA 4OMDA 1WR8A 3G9ZA 2NO7A 1JA9A 5LLDA 3D0KA 2X5XA 5MN5A 3Q41A 1Z68A 2N47A 4DBLC 1PHPA 5DM4A 5HK8A 4QKQA 5ARBA 4Q12A 5E4YA 4M0LA 1U7XA 4OB6A 1DJPA 1YA8A 3X3HA 2F43B 1KMHB 2Q5IA 4GF5A 3RYFA 4OGKA 4U6NA 3L0BA 4FDTA 1I7LA 3W2HA 2NV6A 5FJIA 4QXAA 2QE6A 4KFCA 5ESDA 3AVUA 5EHGA 3NFYA 3WLHA 3TAUA 5F2NA 4IZ6A 5IJZA 1Y3AA 1HZJA 3CCFA 2HJSA 3GDHA 3RRFA 1W7AA 3GJ4A 4X3CA 3AHFA 5FTLA 3KOMA 3USES 2P3OA 3DHYA 4IV8A 5G0SA 2WSBA 4KRGA 3G9XA 4MP6A 5LBUA 2QRUA 2GJKA 1XTPA 3H2BA 3LWBA 3O8QA 4GM0A 5JDIA 1ZL2A 4LJYA 4R81A 3U5TA 1L5GB 2QD1A 4TTRA 4ZVPA 5ADWA 1FJHA 1M0TA 1EE2A 3KX2A 5IDVA 5JRZA 2QJOA 4PGFA 4C2BA 3LLCA 1P62B 2VJDA 5KS2A 1PJ8A 4GMFA 3AOGA 1GZUA 4E09A 2C9YA 4AZ0B 5B6PA 3OUTA 4W7SA 1I6LA 4X60A 3RSCA 4N9QA 3ZWWA 5CX4A 1EXMA 4EYEA 5FV4A 1M2FA 1UJ4A 1P7PA 3IBTA 1QGYA 4ES6A 2BEKA 1T0IA 1IRIA 1CQXA 1DHTA 1YR7A 1E7YA 2GO7A 1NVEA 2JGDB 2QHXA 1A9XB 3KKOA 2F1IA 4NG4A 4MGEA 4O2BF 1G21A 1QV9A 2FFHA 1D6SA 3G2OA 1FTGA 5LQCA 1U3TA 1GG8A 4UHDA 2LP4Y 3PHBE 4D9EA 1Q83A 5KB3A 1XTJA 4PHFA 4JBWA 5BSFA 4UOEA 1CQJA 2K2WA 4L1KA 3OZ7A 4P4TA 3QSYA 2QPAA 1XXHA 1K08A 3P26A 1K66A 5KOJA 1L2TA 2Q6LA 4TQ9A 3WYNA 2IELA 3BUSA 4OJQA 1HT0A 4BVFA 3VMFA 4X62B 3FWYA 2JGMA 1VE1A 1KHTA 2OCIA 5HRUA 4DCPA 2FEOA 2JFXA 1QDUA 2Y77A 3VO2A 5AW6A 4CM4A 1DKUA 4MDFA 4ESVA 5EP2A 2KS6A 3HDGA 1NP7A 2EFEB 1A69A 3ESXA 3TDMA 5TB5A 4RO0A 1OD6A 4ARSA 4D26A 4R2WA 1UF9A 1JTFA 4N5HX 2QJWA 5KJFA 3AQIA 3LUPA 3SC4A 4PU0A 4ESOA 4FN4A 3LY5A 2CHQA 4RF4A 3ZBUA 5LXTA 3TOZA 4S0ZA 3SDBA 1YQ9A 2GFQA 3NBYC 4IH9A 2ZVJA 4A0FA 3ADDA 3I04M 3KDAA 3TQCA 3OJEA 4LE1A 1W8IA 2A53A 1E1YA 1NW9B 2XNCA 3B52X 3GEEA 3HCFA 4GG1A 3PE3A 4HS4A 4II2A 2H48A 4LKOA 4XRRA 4IFTA 3GIWA 1P0QA 3CF2A 3NIDB 4V1CA 1DIBA 3ULKA 1ZM9A 2JLQA 2EKPA 1WP4A 1KVUA 4ZQFA 2VP9A 1LVUA 3L40A 1CUSA 2IYWA 5EKDA 3TECE 2JIMA 4U63A 2X1LA 3HY4A 3IEIA 4TV9F 1QRAA 2AOUB 3GLGA 1FE8A 2HIGA 5TLSA 3QVVA 4GSLA 1II0A 1QH8B 3OCWA 1NFFA 1FBNA 2EWVA 3BWCA 1G55A 3GJ8A 4F11A 1F1BA 4R71A 1EJ6A 4MQEA 3FNBA 4JGIA 1CS0A 3BD9A 4BTVA 4ZYVA 3IHTA 3ZCPA 4UZSA 1JFSA 1PS0A 2ATVA 4Y8VA 3DHVA 1F2DA 4OUKX 3U16A 1E69A 2DFDA 4MV7A 2FEPA 3KR9A 1IG3A 3P8ZA 4XJSA 5GGXA 4DADA 1LKZA 1U31A 3S2UA 1NVVQ 1JJ7A 2O2EA 3ORQA 2ADFA 3GPBA 4CEIA 1JAHA 2ZBVA 2EBHX 4AS3A 1HDEA 1N6KA 3B3JA 4Q3LA 1N9GA 5IP5A 3MGBA 3AOEA 4Y6SA 4GI2A 4Q4AB 2EX4A 4I8XA 4GOND 4MW0A 4RM3A 1W30A 3SJCA 1QB7A 4WTOA 3I9FA 2X8AA 4AS1A 1U2GC 2QB5A 4AN1A 2B21A 4C4SA 1NF8A 4CHGA 4H4CA 5LFAA 4G8DA 3I05A 1A9TA 2NTNA 1RYDA 5T8KA 2FWAA 3VDQA 2YUTA 1DWOA 1Y6RA 4RLQA 2D7CA 4M37A 3KBBA 5AKGA 3MC1A 4HV4A 1EFCA 2COUA 4RYDA 3ER9A 1N33B 1GDDA 4HYQA 1PP4A 4PX5A 3KP1A 3O3NB 1XPRA 3HLTA 3TD9A 3TL3A 4FHDA 4ARZA 4ARCA 1ORHA 3MQ2A 3AB7A 4H17A 4L3WA 1XZLA 3SZGA 3OF3A 5T41A 1AQNA 1ZWKA 5DHSA 4AIIA 1Q6ZA 1DQZA 4LDZA 1JB9A 1UJ2A 4OGWA 2XAAA 4DCJA 2FWIA 4UOQA 5DK6A 5EYPA 1LSUA 4H7DA 4UEKA 5FFNA 2PGIA 2Q0HA 4H7KA 1QFXA 1U6IA 3KZMA 1HO3A 4HX2A 4PNHA 5CDFA 1PFGA 5E6SB 2KW5A 5I4CA 3MW8A 5ERYA 2VXOA 4PC7A 1KDTA 2CFCA 3GQBA 1TTQB 3U7QB 2GERA 2EGHA 1Z4LA 2R8BA 2ACVA 1FFHA 2JIBA 4PGMA 2A88A 4HCJA 1CDOA 1GG5A 1ORDA 2ZANA 3ETDA 4C3ZA 3FETA 3DBRA 2CBXA 2FVYA 1ZH0A 4B81A 4DQVA 3ROEA 3SHVA 4QM7A 2WAOA 1JVBA 3WQSB 5BV1A 1VIVA 1VFPA 3W9SA 4MRRA 4YV1A 5JEDA 1Y7PA 5LUAA 3BDIA 3O4HA 3BDVA 4TGLA 5AJHA 4ZKEA 5HNKA 1Y0BA 1H6AA 3SFZA 2G08A 4G5OA 4QWMA 3CH4B 3K1AB 4BNFA 3L6CA 4ZIRA 5LQJA 2WJWA 3PC6A 4Z3OA 4B3RB 4RD6A 4F1WA 3WKAA 1C1YA 2AFIB 3RBZA 1PVOA 1CKEA 3L7BA 3WI7A 1JR4A 1S9DA 2C4VA 3EEYA 3NIWA 4LXHA 4PLHA 1T6BY 1WWKA 5EQFA 3ZZNA 3T6KA 3TIXB 5J4YA 2AZMA 2Y1EA 4TM7A 4XD7D 5FWYA 5K8JB 4BNMA 3N0WA 4IINA 4I3HA 1U3FA 2YWFA 3TEFA 1N2JA 2RI6A 2W6ZA 4TKMA 3ZJ4A 2WVAA 2BFFA 1EUYA 4CR7A 2YXLA 4D5GA 3U49A 1YS9A 3HKCA 3T7RA 3EN0A 1CFJA 1LJUA 2WA1A 2ZRGA 4I1UA 1C1XB 1JP7A 3OT1A 4FDLA 4W5JA 2HU8A 1CUCA 3C2QA 1PR9A 3GMDA 3NVAA 4Y2RA 3IPCA 4MQBA 3DAPA 3B9BA 3WWPA 3RTCA 1EZ4A 4FHCA 4HATA 4BKPA 1U6JA 2IY9A 3SEAA 3UJ3X 5IJXA 3MHTA 2TMGA 4ER7A 3E0QA 5JXGA 1JR2A 3VU0A 2GN1A 1AKEA 2FX3A 4ROTA 1UWKA 1U99A 2RKBA 2ZRLA 4PPGA 1IHOA 4RF5A 3CB2A 2PMKA 1OREA 3W3AD 4NONA 4F4DA 1JHZA 2Q27A 4LBWA 5A4JA 2ID7A 4QREA 3NTRA 2OYRA 2V4MA 4XYBA 1E9DA 3OAAA 4LC0A 3ZCVA 1MAWA 3H5NA 4R1NA 3R3UA 5LWHA 3I30X 2E18A 3IILA 2I4MA 1PJ4A 4EY3A 2X9QA 2I7DA 3NEPX 4GNRA 4B74A 3M83A 2DQZA 5JXHA 2HREA 4WBNF 1IEVA 3H8JA 4HDSB 3VVBA 4F21A 4ZOQI 4HNVA 4D45A 1EUZA 2XGJA 4H27A 4M54A 4AUKA 3L1IA 2ZI3A 3PYMA 5CA1B 4WL0A 4Y18A 4DT1A 5JS6A 1VLZA 4MA4A 1WCYA 3IBGA 4GVLA 3C3DA 1PR1A 3GZNA 4B32A 4JC8A 2VDVE 3NGLA 4QL3A 4BO9A 5AKYA 1BQ3A 1GWNA 3DMRA 1YVDA 5JAHA 5GZ1A 1OE0A 4KKXB 1Y3CE 4R8KA 4NX2A 2G1PA 1CR2A 1RW4A 4Z9BA 1W44A 2ZQYA 3CW2A 6REQA 5FP0A 2VQEB 2OBLA 3M9XA 5BR7A 2UXDB 2GXSA 3OETA 1XU7A 2IZ6A 2OOKA 2ZIVB 1SBNE 3IC5A 3ZWYA 4BCBA 5EEGA 4N4AA 5IUKC 1ZSNA 3PHGA 1CE8A 4M9ZA 5LQAA 1ZD4A 3JAKA 4D99A 3R09A 2AUTA 1E3EA 2XBUA 5BOSB 2CXRA 4EPTA 2AYZA 2QM7A 1Q3TA 2XYQA 2L19A 4UNSA 2GW4A 4K6OA 3OE7D 1E8DA 2P6UA 2FRVA 2NTJA 3WMWA 2NSLA 2ET6A 4C06A 1JDJA 1TB4A 3GNTA 9ABPA 2QVCA 1GPYA 2XT6A 3BRSA 2ZSKA 4QFCA 1KHHA 3ITKA 1M8JA 4DDWA 2CL5A 1JLSA 1FU4A 1H8EA 1I2BA 3TTYA 3UBMA 1EPUA 3ETJA 7AT1A 3WNQA 1LC0A 2F3PA 4LV5B 2O8NA 3DT9A 2R44A 3QHPA 4TXLA 5H7XA 2O4UX 1BU5A 1RD4A 4EKDA 1XEWY 3PPIA 4IIGA 2PH5A 5ALLA 4ZCIA 1CUXA 4MS4A 2FPMA 2H2DA 2HCTA 2NGRA 2OCDA 3HRKA 4TRJA 4D9CA 1ISJA 1TQ8A 2FMXA 3CO0S 4HNHA 3SEQA 1RWXA 1SN7A 3DE3X 4YRJA 3I52A 2ZTLA 4UDOA 5GZ6A 3EZLA 4JUCA 4DR7B 1JA0A 1V37A 2QE7A 1KEKA 1WQ3A 3O74A 3DZCA 4XQGA 1Q0PA 1MO4A 2XUQA 3F47A 1AA9A 3IO5A 3FW1A 3M8KA 1B8VA 4PV7A 4UATA 4QTYA 5BORA 5JPIA 3GXOA 2C5EA 2OGFA 3K0HA 2XCRB 1JXQA 4H3KB 2HUNA 1XNGA 2BI4A 4JYBA 5LJLA 4I7EA 3UOGA 1REQA 3W3AH 4EVRA 3I42A 3OWXA 1F0YA 2P4SA 2PKRA 3U1VA 3ZE2B 2O8FB 4BMZA 4D8VA 3LL7A 4EG5A 5HF8A 1NNUA 4L0MA 3LP5A 4GWKA 1DKNA 4XVRA 1RHUA 5IJWA 5KINB 1SC9A 1NNEA 5EUCA 4FCVA 4E3ZA 5D1HA 2VPZA 2MINB 1GGJA 3UQZA 3OTWA 2P5UA 2QN6A 4NBVA 2DRIA 1EBBA 1KSFX 2XGSA 3IAUA 3AEZA 5DGHA 3FG9A 2I34A 4LX0A 4C2TA 3HQ4O 4KITB 4IDQA 3H19A 4FS8A 2GESA 4P58A 4DUPA 1G59A 2R1ZA 5CLLA 3FMIA 2VNJA 4N12A 3UHAA 4YMGA 3N8DA 4UAVA 5TQ0B 4E12A 4CMEA 2QVZX 4JB0A 2GF9A 1VBMA 1PT5A 5EWLA 5BO5A 3A3NA 1NX9A 3E3MA 3LX4A 1HLFA 1XF9A 3GRYA 2P9HA 1E2FA 3JYNA 1UMDB 2GCOB 3V4SA 3QFSA 2FUCA 1UBLS 1ZOPA 2X9NA 4GD3Q 1P77A 4BHTA 4MUJA 1NW5A 3EISA 3NWOA 3TNDA 4EKEA 4U7GA 4KR0A 3VA7A 5CP8A 1D5WA 3GNLA 2DX7A 4MVXA 5C8YF 2ZWIA 3ZEIA 4PYNA 5DO9A 4MS1A 4UHCA 2WTBA 5EE9A 2ZE5A 1XVIA 2QN9A 3U31A 3MZ0A 2GHQA 4HGPA 3RYHA 4TVSA 2RGWA 4F6CA 1SQ6A 3U44B 4L4XA 1JS1X 2VHEA 4B7XA 2C1EA 3MMZA 3BL6A 5AXDA 5CBPA 2B2NA 5FBWB 3MUNA 4QDJA 2VUHB 3AEQB 4B5LA 4H15A 1IXRC 1W35A 1ZBQA 2I1LA 3GGOA 3PUJA 4GEKA 5IM5A 3L18A 1RXSA 4YUVA 3WICA 5FBRB 4NBUA 1AHIA 1Q0QA 1Z7BA 4KUEA 3G0IA 4KXVA 5KYWB 5LP6A 2VEOA 4GXQA 5BQXA 3C3KA 3LGAA 1X3SA 1M5RA 4B7UA 1XIVA 5EJIA 1K7YA 4BVKA 3NPMA 2HWYA 3F97A 3WL4A 3OU7A 1GZ7A 1YE3A 3C3CA 1HBJA 3O8OA 3KV1A 1QO0D 4G37A 1SXJC 2VYVD 3MEQA 2BZ0A 2R0QC 2C8JA 2O3JA 1GPBA 2DJIA 3EIFA 2QD3A 1NI4B 4PGAA 3ZVLA 2F67A 4AJ9A 4YMTA 2GASA 1R8JA 2C7RA 3CB4A 5K0ZA 2JD2A 2FFQA 3J7TA 1Y9JA 3CJQA 3WJ1A 1K06A 1Z38A 3HHPA 2XUOA 4RH1A 2BCEA 3PUIA 1D7OA 1UT8A 3WLEA 5DTEA 3ER8A 1PFWA 2VEDA 5DNDA 4RZ2A 3PV0A 4OATA 4FKMA 3BMQA 1MR3F 1DRUA 1NJ6A 4FMPA 2Q4EA 2XDYA 1CYDA 2A78A 4QYXA 5YASA 5B2EA 1ODJA 1UKZA 4Q01A 3WLOA 1ZRNA 2IQ5A 1GG9A 3KJGA 3MSCA 4K6HA 1WSBA 3JWHA 2V5UA 1RP1A 5GINE 3WNCA 3KWMA 1JGTA 3U6BA 4S1TA 5EIXA 1U1CA 3LYLA 1A8PA 2EKZA 4RVGA 1V6CA 1JRLA 1QVAA 2BEUB 2IIPA 1M2EA 3GVXA 3JVIA 4NFSA 2XTNA 2YVQA 5EJFA 3MCWA 1RWWA 5CA0B 3WO0A 3C6XA 2EP8A 2AOVA 1FUIA 2GAFA 3OLWA 4OBBA 5E3IA 2C2YA 3FX2A 3G2LA 4UBOA 4Q19A 1S7CA 2CV0A 5JS2A 4MV1A 4D9BA 2GD0A 3PQ2A 2WABA 3BXEA 2H16A 2C9OA 3WWCA 1UC8A 1Z4KA 4XYGA 3PZBA 2AG6A 2GBGA 3DOCA 2UV8A 4I08A 3AHIA 1POXA 1CZRA 3HGQA 1MENA 1ZPDA 3ZI4A 1P31A 4B09A 5KJEA 4QOGA 1S2NA 5DW0A 3DOUA 3T7DA 3TZHA 4F12A 2NU7A 1U0FA 4LISA 3U61B 3VRHA 4ENPA 1UH5A 3OBBA 4V0QA 4KR3A 1YDMA 1UKCA 4AJNA 2B4RO 1E0DA 4OHMA 2WFLB 4BNXA 2RCYA 3EQ2A 2VDWA 3GLQA 3TLYA 1B6GA 1BD3A 1N3YA 1YOVB 2CCJA 1NXPA 4QTZA 5DOVA 4RMIA 4RKRA 3VR5D 2IEAA 2R5NA 3F4BA 1NMEA 3L6DA 5E7JA 2HTFA 1BXKA 3NJ8A 4REQA 5JASA 3RFFA 1WXIA 3CWQA 3G02A 3H5AA 1UMBB 3OM0A 5EPUA 1JYFA 3NKFA 1JQ3A 4NU6A 4B48A 2J6IA 1GGNA 1PGOA 3UMSA 3BILA 2UZ4A 5AJZA 2BFWA 4RJTA 3RVQA 2AE1A 2JIPA 4LKRA 4EEKA 4IJQA 4MPTA 4DMRA 4BNDA 5CDHA 3OD1A 2E55A 3U40A 1Y4SA 2EFYA 4TT3D 1B93A 3LIIA 3RRZA 3SIPA 1XU4A 3EUEA 5ICEA 4M6WB 5CK4A 2XF8A 1LPMA 1ECBA 4Y2XA 5T4HA 3EGXB 2XRZA 4EW3A 1E1DA 1WD7A 4GDMA 1YJAA 2QVYX 4R9UC 3ZH2A 1FP4A 1PQYA 3EODA 3WR5A 2B30A 3R0QA 4M9CA 4X54A 4ON9A 4BV3A 2XZTA 2R3SA 3O2SB 4M88A 4CG0A 4CG2A 1SD2A 4MO9A 3WZMA 4XLLA 5LBTA 1CB0A 2VP0A 3N3BC 4TTQA 4H1HA 4U2BA 4W8GA 1NASA 2XH8A 3BWVA 1CRWG 3FA2A 4M55A 5CH5A 4DIBA 1EA7A 1ESZA 3G49A 3JQFA 1L1EA 2QPOA 3KJXA 4H3VA 5HGJA 4HKTA 5F3RA 3U7RA 1H9CA 1W5EA 1CZHA 1M10A 3VISA 5DN6D 4R3NA 2PX3A 1TMOA 2IZ1A 4IIBA 2E49A 1ODFA 3PFNA 3CUSA 5DP1A 5ILGA 3HVKA 3DMHA 1FNCA 1L5WA 4NMXB 5FL3A 5FR1A 3PXEA 1TE2A 4RY9A 5JBNA 2B34A 4M9QA 4N0EA 4F7DA 4R9NA 1XK7A 4HDKB 2HMVA 3NO4A 1RQ2A 2FUG1 2JAOA 1FDTA 4GEGA 4Q6BA 4X9XA 5DB4A 4Y6QA 5FL7D 1P7VA 4KQEA 4TMYA 5NULA 3RM3A 4D4HA 3AP3A 4MINA 4MUBA 4YCLA 4F04A 1RWKA 5I7RA 1E7RA 4J7UA 3LCMA 5EN4A 1DOAA 3UYKA 4I9NA 5KWSA 3SVLA 2AVNA 4MK4A 1L4NA 3BN3A 4PN7A 3QKSA 5TMPA 5ALFA 3A8TA 1T5DX 1AHPA 3FBGA 1ZIPA 3UGTA 5KWIA 1SVLA 1U8UA 3COVA 2ONZA 3LQFA 2W6JA 2XRYA 3ENQA 3OOEA 2JLWA 2B36A 5EKTA 5FDFA 3AY7A 3S6JA 2FYTA 4HDAA 3ZLVA 3L01A 4EG4A 5B3AA 3IERA 2R9VA 4RVCA 2GT1A 1A9OA 4NLLA 3PNPA 5AOCA 4AJLA 4HQ6A 4U7JA 3ZD9A 1T4DA 1KY2A 1SZJG 1XEAA 1Z75A 2F3UA 3P2EA 3BQMB 5H0IA 4ESHA 1SHJA 1FIUA 3MWGA 3W5UA 1PV1A 3C5CA 4AUNA 5JV5A 3QBDA 3OQBA 2ZRKA 2NZXA 3LT1A 5DI9A 1KOFA 4CM8A 5JAPA 1NW4A 4F4UA 3HGTA 4I9GA 1Q19A 4U3JA 2B2CA 2OV6A 3L82B 2GF2A 3R3YA 3TRIA 2XVZA 3QKIA 4HLCA 1GTVA 3FPJA 1PRYA 2E9SA 2ZDQA 3WBKA 4EKIA 1E6UA 4I6EA 1RI1A 4EHFA 3HKDB 1IJEA 1N92A 3RU7A 2ZVDA 4TVBA 4ZCTA 3PPYA 2BSAA 4WGFA 1RJWA 2YJ6A 2UVQA 3CSUA 3VR5H 4A0SA 5LOVA 2Q6VA 4QJ3A 2GK7A 1RRKA 1VXOA 2J4FA 2OGSA 3H1BA 4Q34A 2RBKA 5LMZA 3THWA 5LU8A 3AESB 3UENA 1T35A 3UOAB 1DSSG 3DOJA 3SI7A 1SWWA 2ZYDA 4Z7QB 4IZIA 4N8DA 4BMVA 3E9RA 1Y1QA 1RZUA 4FILA 1G8JA 1OZGA 3LU1A 3PEUA 3EXHC 4NARA 1NL3A 1T5OA 2GN0A 4LWPA 4YREA 3JAWB 3ZK9A 1Z4JA 1BXZA 5EPOA 3ZI0A 5FBVB 3TTSA 3TCNA 3FYUA 3KVRA 3ZWNA 2IRWA 3V1KA 2HLPA 1P44A 2PLAA 5AMXA 1KQPA 1TVKB 1JW9B 3NOXA 4UXHA 4L5CA 5C5DA 1AXRA 5D1NA 1EDZA 2XQFA 3G3EA 4R2MA 5HJ5A 4JLOA 5LDDC 1WXQA 2EF1A 2FFJA 2ATXA 1V3QE 2CMDA 1ZKDA 2EXXA 4N54A 4NOMA 3RVJA 4WZBA 2FZLA 2J9FB 4PBRA 1KJYA 4KMRA 4ZANA 1DZIA 4ZU3A 3UT6A 3A7EA 4CTJA 1KGDA 1U8ZA 3TSYA 1W0KA 2JGRA 1LPAB 3AF3A 3DHWC 3VYVA 5TXGA 3V7NA 1T43A 1LV7A 2H2FA 1A7JA 1GPLA 1Y1SA 2IPOA 4KPEC 2O7SA 1N7IA 2WOJA 4F4FA 4W5TA 1SUFA 2BGKA 2LUOA 4KCGA 4RPCA 2AR7A 1AS3A 3GH3A 2OC9A 4PXYA 4QTTB 5DHRA 3T06B 4EYOA 2FMTA 3DHNA 1T5LA 2C2WA 3V8RA 4H3HB 2YMPA 5ALQA 5INTA 1INLA 2UVPB 3HFSA 5EJAA 4COKA 1DCTA 5KVCA 4PYQA 2WTXA 1FRQA 2RB5A 1KJ9A 3L3BA 1DBRA 1WXEA 4DDUA 5D51S 5I8ZA 1KAHA 2HQRA 1Z29A 5C4MA 3E27A 4JZKA 5B1DA 4N7JA 1P6XA 2AL7A 2QSJA 4L07A 4DAEA 3DV2A 1E7QA 2I22A 5BNFA 3W6ZA 5I7SA 1M1YA 3QIAA 2X8JB 1NJFA 2WE7A 3KXLA 3IR6A 4J1TC 2PSHA 1ZNXA 1U0SY 2JKYA 2MIIA 3AX6A 3M70A 3R6TA 4HMOA 4YP0A 4ARUA 5AQ1A 1JLMA 2BD0A 1KQOA 4QLBA 4CF6A 4UE6A 1DXQA 1GPJA 3L8HA 5K3FB 4ZQGA 3UK1A 5JQGB 3FKJA 3W90A 4A23A 2JIRA 4DKJA 4GOLD 1NA5A 2GKOA 2BGMA 5HWSA 1CRPA 3D43A 1YWGO 4J4HA 4J49A 5DRTA 2RDMA 3DTVB 3TNYA 1EGVB 3DA8A 1ATIA 1I8TA 1V47A 4I5DA 5L4NA 4MIOA 1N0VC 2WF6A 4FDUA 3PJDA 1OTHA 1XTRA 1ZESA 2O07A 2FSVA 1RFLA 2V45A 2WM8A 4V0KA 3HWRA 1ZH4A 1UBTS 4QAQA 2HSEA 5KYVA 3RUPA 3VGPA 1RADA 2B5WA 3LVRE 3RCBA 4C4YA 1Z63A 1DBWA 1Y4UA 2NVOA 4I14A 2O9JA 4JP5A 3MK31 2Q7OE 1M6VA 1VG9B 3IV9A 2WLSA 1YAJA 1P0MA 2E2WA 1NP6A 2R6AA 4MVJI 2XNHA 5JNRA 2IV2X 2I6QA 1J00A 4DF3A 1F9AA 2QL5A 3KQWA 3LX5A 4PPFA 3ZJVA 2HDWA 1I2AA 1Y48E 2XB4A 2JRCA 2W6PA 2PD6A 1M8GA 3ANTA 1IOWA 2EX0A 2NAFA 5KQPA 1EWYA 1G63A 3QUSA 3R6GA 4OXNA 3SLGA 1ZXLA 4QQ8A 4MDHA 1KTIA 3MINA 2WP0A 4YDRA 4P3NA 4ZI2A 2HHLA 2BKVA 2SICE 1PG2A 3BWBA 3QRWA 5A5GA 2GPYA 1D2RA 5JZMA 4DJTA 3LKVA 4WKNA 1GCGA 2XNDD 1XZNA 2DHDA 1XBTA 4IY1A 3E82A 3ZTWA 3OE5A 4CIXA 1LX7A 1RYFA 3GPDG 4NU5A 1R5OA 1FB5A 1VMIA 2V9CA 1WHSA 3RAEC 1HLPA 4OH7A 3RFTA 4I1YA 5DSXA 2NO6A 1DX4A 2XWBF 1XZCA 4IHQA 4MYHA 2J9GA 2X4GA 4RK0A 4CM6A 3DM5A 2PT9A 3EE6A 2ZCVA 4FR2A 4QYSA 1IY2A 2EGGA 3LM8A 4X7BA 3SN6A 3V2IA 2KBEA 3G8AA 4NNPA 5CAEB 1J0AA 4A0HA 4WOBA 3I1YA 5FTWA 2RHTA 2XA1A 1ELOA 4FFBB 5AVUA 3SSAA 2QAGA 3HXKA 4MUKA 2DJ5A 1PUJA 1AZWA 2Y67A 5A9RA 5GTDA 3TZ6A 2OK7A 3N6VA 3DPUA 2Z6AA 1Z08A 2E48A 3AL3A 3T4PA 1RMYA 1A2KC 3VHXA 2JK1A 3DUWA 3D7RA 2OCYC 1GA1A 1U5BA 4NEQA 4LSGA 5CTAA 1U2TA 4R3WA 5AVWA 1SKMA 2X2FA 4A8JA 5K0BA 3NNSA 4W9MC 2IQIA 1N0IA 2CVQA 1DV2A 2PVPA 5A4AA 4YJFB 1RNLA 2ZTSA 1W47A 2X9GA 1QIGA 2O0JA 5JZVA 3QMPA 4C21A 2D0OB 2HJRA 1OWLA 3VH3A 4LIPD 1LGYA 1Q1ZA 4X63A 3QX9A 3ZY5A 5JECA 1WBJB 2HA7A 3K70D 4KPYA 3FR7A 1BE8A 3FIUA 4NPAA 1W2WB 3U81A 1OXVA 5JCXA 1UPXA 5K3DA 3TVTA 2AK3A 1T8PA 5BRNA 1WDTA 4QA9A 3BHIA 3SNHA 3UV6A 1BRTA 4YRLA 1QLHA 4AC9A 4CF4A 4HSEA 3HCBA 4YALA 2JFPA 4AK9A 4OKIA 1X1TA 2OOSA 3IOBA 4G23A 3E8SA 3TS1A 1AX9A 3TTVA 3WS7A 4OQXA 2VHYA 3PXCX 1KDZA 2VH1A 4FLFA 4UE3S 1J49A 2SKEA 5D3MA 3GF4A 3T0FA 4B8ZA 1W4ZA 5DLPA 3EPRA 2BHSA 4TLAA 3H17A 4QXPA 3K15A 1KE1A 2GJ4A 4YUWA 4A5OA 4G4SP 5LMUB 4RUKA 4RVOA 3ET4A 4I8DA 2IV7A 4IQ4A 3FWHA 3AZOA 4Q9KA 1I5RA 1CF9A 4RIFA 4LSMA 1TIPA 2QROA 4L9AA 2B98A 1UZLA 4MS3A 1TVCA 3MTJA 2QW0X 3OEWA 4KTTE 3L0IB 3LD9A 3KG2A 4LVCA 4PNZA 4U02A 1FF9A 3RSSA 1LW7A 2X13A 1NBME 2B25A 2V6IA 4BX3A 1SXJB 2Q0QA 4FYVA 3U2QA 1NG9A 3EDRA 1TYZA 4WZAB 3SCZA 1BOFA 4X91A 4J0CA 3EGDA 2Y93A 3G79A 3HYNA 4PAOA 3FSGA 4YASA 1G8YA 5ER6A 2W2QA 1TADA 4D9IA 4AP5A 2GCGA 5M5BA 4MW9A 4UEOA 1J9GA 1NQTA 4G81A 4YJGB 2X3UA 1SOMA 4YRBA 1J70A 5FLKA 3T3EA 5E7MA 4JJKA 3UPUA 4UNQA 1CDDA 4RK7A 3U17A 2H0QA 2ID4A 3HL0A 2IYFA 3EAFA 4NYJQ 4CQJA 2LDBA 2G8LA 3KLBA 3CI0I 4IF6A 5HBGA 4MUYA 2AXNA 2HN9A 4MLDA 5AVZA 3IQZA 4Y6OA 3OY7A 3MFYA 5BV8A 2ZIXA 1ZJWA 1W76A 2XBMA 1UJCA 2AC4A 2IOFA 3R3XA 4ENTA 4DNOA 1WUHS 5JANA 1DHRA 4FFPA 4ASUA 2FQYA 2LCIA 3CLRC 1P5FA 1SUPA 2P1ZA 2ZJ5A 1T13A 4CMHA 2GM5A 3D5QA 1K89A 3T1NA 2FG6C 3DR3A 2HMWA 3KZOA 4BQEA 3RS5A 1BJTA 2WJGA 3AG6A 4H6WA 3G2PA 3SS9X 3JQBA 1DXOA 3GLKA 1MOQA 2W2LD 5KSPA 4MQUA 3GLIB 3O3OB 5CEFA 4QEKA 5C5IA 1Y37A 1XCOA 4LXUA 3ROZA 3SIWA 2ZWOA 1WKCA 1XZBA 3CFYA 3NHZA 2GYYA 3P32A 2QTZA 4I55B 1CUGA 1Y5RA 3GFPA 3EXG1 5I48A 5EFOA 5F3WB 1JEAA 2Z6UA 5K8CA 4CCAA 1RACA 4CR8A 1ML4A 3EVBA 3K6SB 2QLNA 3W04A 1X19A 3MBKA 4IEEA 1NONA 5I7HA 2NVWA 1NQWA 1F1JA 4DMLA 2ZB2A 1HYBA 1OXKB 5EIEA 5IXJA 3RARA 4NMWA 3RHSA 4AKSA 4MV3A 4K9MA 2Q8QA 3LT5A 1QF7A 4LZLA 4AWBA 3JPYA 4ACAA 3B53X 1EVYA 1KI8A 2NQ8A 1Q1GA 2ZUDA 4DEXA 5CD1A 3TZLA 3LPCA 3RAPR 4DQ0A 3H2ZA 5A3RA 2GCIA 2NZJA 3H7AA 3AERB 3N0RA 5LR6A 3EBLA 4P08A 1EYZA 1Y8QB 3O4GA 4NYIQ 1PR0A 2XCUA 4QFMA 1PG0A 2JKZA 1ULHA 4IKOA 1S8NA 4PFQA 4YAGA 1M0WA 4PRZA 5B7PA 2ZUCA 5HRAA 1XZGA 2V3CC 1PJTA 1TMYA 3OG9A 1NBMD 2J0SA 4QDOA 4S24A 2PKQO 1GT91 3CX8A 1NATA 1RPNA 4OQZA 5IG2A 4GVPA 4N0MA 4KQ9A 4NVRA 2P3SA 1EFVA 4HFNA 2R6HA 2D6FA 1LA2A 1CLUA 2ZQ5A 2ZJAA 3LOPA 4OBEA 5IYZF 3V7UA 2V74B 2IXTA 3GJXC 3WYBA 1ODCA 1V8OA 2Q8PA 3B7PA 4XIGS 1ND5A 2OKGA 1S3IA 3UH0A 1UEJA 1N5JA 1ZJYA 3HV2A 5EQTA 1IZ0A 4NZMA 3UT5A 3UBTA 3MNFA 5DI3B 2I4RA 2IX3A 2IDZA 4QU5A 3FDFA 3WV5A 1YR6A 3SXJA 1JPUA 4CMIA 5MN6A 3MS2A 2B4TO 1K27A 2ZSFA 3QEJA 5CK5A 1QIKA 4XPIB 3FMOB 1TCAA 4G0OA 1X7HA 2HCRA 1LK7A 4QLAA 2VP2A 3PUZA 1IVYA 5K0FA 1V1JA 1S01A 4YI3A 1AUXA 3GYGA 4I81A 1J2EA 4YUAA 5DM0A 4AZVA 2QX4A 3KJFA 4BMXA 4CKCB 2FR8A 1OFHA 5G40A 2V7QD 4NYMR 1DFIA 3B82A 3DS8A 3LX8A 2FZWA 3AUYA 3MJCA 3R5HA 4YQZA 3WMRA 1E79D 2B5VA 1PZMA 3UJ9A 3NH6A 1PFQA 2I65A 3UXHA 3W4IA 1C1DA 2R96A 3ASYA 1CIJA 1EESA 3UFXA 3NUZA 2W2MA 3TSWA 5K45A 1C9MA 4K26A 4GKKB 1P9NA 2QP4A 2QBYB 3V8PA 2C5BA 2CDRA 1AMOA 1TUIA 4ZT5A 1MKYA 1SUDA 1TOAA 3P20A 1Z35A 3WMXA 3GY0A 3B5IA 3MERA 2NYRA 3THRA 3U7QA 4CN8A 3EZ2A 2DR3A 3E5HA 1CETA 2PZAA 2ONYA 1QYCA 3M49A 1UIRA 1A5BB 1I33A 2OB2A 1UKVY 2QKYA 3M5WA 3L0YA 4JJIA 2YVLA 3WGHA 3WL7A 3V5NA 4WLEA 4C89A 1Z16A 1UMKA 4B3GA 3LZ6A 1A2OA 1SVKA 2QR3A 3WXMA 4ZO9A 4DA0A 1HQCA 1XJQA 2BFBA 2IZ7A 1V16A 1P1BA 1Y5NA 3H8SA 1K8YB 4NBRA 2ZDGA 2GM9A 2QVBA 2YFQA 3B60A 4EHDA 1E2DA 1YVEI 2P6MA 4R2IA 5I9IA 3MILA 2VSOA 4NPCA 5BR1A 3K1AA 2OM2A 2RH8A 3KOUA 3K0KA 1Q0HA 2RGYA 4HDQB 4YWHA 2PT7A 4XDGA 5CD9A 2JCBA 3A1WA 1RXVA 1MD9A 1E1RD 2GPNA 3P4YA 1EX7A 3HDHA 2G3DA 4KHZA 2SECE 4P7JA 4RXTA 1OWMA 4S3MA 4OK3A 3HSSA 4O4LA 4XQEA 4AROA 1CY0A 1NF2A 4HP8A 4LXGA 4N5NA 5EQDA 2HO5A 3FCAA 1QRRA 4GVXA 4HRXA 3OMLA 4G85A