2A86A

Crystal structure of a pantothenate synthetase complexed with amp and beta-alanine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantoate--beta-alanine ligase
publication title Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 92
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a86A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a86A01
1EFVB 5FO1A 1KP2A 3N05A 3IDFA 1KP3A 3FIUA 1QRSA 3VU8A 3H05A 4OUDA 1O95D 1JMVA 1M83A 2V0GA 3SDBA 4MUGA 1JZQA 1F9AA 1M1ZA 1YUMA 4JXZA 3TZLA 3CLTD 1TFUA 3FOCA 3E27A 1MAWA 3AL0C 4XSVA 2GOYA 1Q19A 2CYCA 1T6XA 2H2AA 1O97C 3A05A 2ZP1A 3MUEA 3G6KA 4ZCTA 3FNRA 3ND5A 1GPMA 4DJAA 4MW9A 1N2IA 4FZJA 1WXFA 3ZJVA 1M8GA 1NYLA 1TYDE 3DO8A 2VTBB 3I05A 4ZT6A 4J75A 3U1VA 3IODA 3P0JA 1G8FA 3COYA 3QTBA 1OWLA 3COWA 1ZUNA 4MUJA 2E21A 4TS1A 4DNXA 2X3FA 2EL7A 4KPUA 3MXTA 1QQTA 4JYZA 3A04A 4UZEA 5TEWA 1EJ2A 1KQPA 3N9IA 4MW7A 5HUHA 1ZH0A 2WSIA 1OBHA 3CVVA 1O96A 3BL5A 4JXXA 4G5FA 1MBZA 3FDXA 2HGZA 5LLTA 1GTRA 4K03A 4JFAA 4I6JA 5J5AA 3SEZA 1QU3A 4YP7A 4HK4A 1V8FA 4MVWA 4PBRA 1R6XA 4Q16A 3UK2A 4ND6A 3H99A 1D2RA 3IH5A 3IUEA 5IHXA 3AG6A 1O97D 3ZJTA 3TZEA 2I1LA 1JIIA 1SURA 1WQ3A 3Q12A 1N3LA 3HZRA 3COVA 4S1OA 4U8HA 2V0CA 2DXIA 1B6TA 1OBCA 1GLNA 3LOQA 4MQ6A 2O5RA 2BTEA 4CT0A 1GZUA 1K92A 1KQOA 5LM3A 4WSOA 5KHAA 1F7UA 1KH1A 4MAFA 5DEOA 1EUQA 3PXUA 1T9GS 1Q11A 2PXHA 4EG7A 3Q4GA 1FYDA 1J1UA 4I6GA 3UMVA 2TS1A 4MUHA 2J08A 4I6EA 4R2LA 1TYAE 4EG3A 1LI7A 4F3RA 5K0TA 4G5YA 1G8HA 1GN8A 3KT0A 4XFJA 4KR6A 4MLPA 3DV2A 1H1TA 5AHWA 2A4MA 3TS1A 1OWOA 4NAUA 3HMQA 4DDKA 1VL2A 2D54A 3S3TA 3TNJA 1DNPA 2WQ7A 3INNA 1JIKA 2QTRA 1IRXA 1X6VA 3ZXSA 1EE1A 2J4DA 2GKSA 2IP1A 1MOPA 1WXEA 2Z3VA 1YUNA 3P0IA 3AKZA 2A88A 4P2BA 2CV2A 4JZYA 1MB2A 2E0IA 4ZT5A 1JGTA 1GAXA 1N2JA 2YWBA 3NBKA 3RBAA 3MLAA 1PFUA 3NV7A 1NSYA 1OD6A 3PNYA 5KWVA 1EUYA 1QTQA 2WQ6A 3H9CA 5BNZA 4AS1A 2PFSA 5F23A 2A7XA 3N8HA 1N1DA 1V47A 1M8FA 2QUIA 4MWEA 1KKUA 3CVUA 3Q10A 3JXEA 5HG0A 2QUJA 3QTTA 4HJRA 5TEVA 4DDMA 4CDNA 3X1JA 4MW6A 1J09A 1TYCA 2XRZA 1I6LA 2BYTA 2ZUEA 1NI5A 3A2KA 3HL4A 1R6TA 2YXNA 4CDMA 5EKDA 1ILEA 3M5WA 2YWCA 1JEEA 1IQRA 1WXGA 4MW1A 2JANA 3QE4A 4YBRA 2CFOA 2DR2A 2JAXA 3IOEA 1ZJWA 4E1AA 1IH8A 5DK4A 1J21A 3CVWA 1XNGA 3HGMA 1O0BA 4Q93A 2J09A 3ISJA 3ND6A 1QU2A 1ZH6A 2EJCA 1T6YA 5J59A 4EG5A 1N2EA 1Q15A 3AG5A 2HMAA 1M8PA 1PG2A 2C5SA 1YIAA 3SZGA 2QTMA 3GUZA 1H3EA 4BWVA 1H3FA 1NUPA 3TQIA 1I6KA 5DASA 2GM3A 1NURA 2CUZA 3ZUGA 3FH0A 1WKBA 4NATA 1O94C 1I2DA 1VBMA 1OWNA 4ZCPA 2CSXA 3KT6A 1TQ8A 4U7JA 4MWDA 2QUHA 1KR2A 1PFVA 2OV4A 1PG0A 4MW5A 4MUIA 2VXOA 1P7PA 3COZA 3UC5A 4MVCA 3X1KA 3LE8A 1WQ4A 4MUEA 3N2YA 4YP6A 2J07A 2AKEA 3CLUC 3CA8A 4ZT2A 3ZIUA 1J70A 1ULHA 3RFFA 1UFVA 3CLRC 3VGJA 3CVXA 2B7LA 3SP1A 4ZCSA 4MUKA 1S4MA 3HV0A 1KAMA 2PZBA 1NUQA 1Q77A 3NBAA 3H97A 3F3MA 2CT8A 1KQNA 1YIDA 2DUMA 1J1ZA 2D5BA 4YMIA 4MUFA 1KAQA 3K32A 3LCJA 3IMCA 2H29A 1MB9A 1U3DA 1TEZA 1JIJA 1O94D 2A1UA 4HJXA 4NDAA 2O8VA 4R2MA 3IOBA 3L92A 2E18A 5H16A 4L2IA 2A86A 1COZA 1YULA 1N78A 3RK0A 1MC1A 4KR7A 1N77A 4PY2A 3AIIA 3DPIA 4KR9A 1JILA 5FNZA 3FI0A 4U63A 3IUBA 1N2HA 1T9GR 3IVCA 1G59A 3RHSA 1H3NA 3ZJUA 1NP7A 2CYBA 4KKVA 3X1MA 2DEUA 1VBKA 1A8HA 4UZFA 1NUTA 4GRIA 3OTWA 2AG6A 4OJMX 1F4LA 4MW2A 1VBNA 2A1TR 1IFXA 1K4MA 3UY4A 3RK1A 2WB2A 1JZSA 4MWBA 4EF6A 4AQ7A 4DLPA 1RQGA 1U0BB 4QRDA 5LFAA 2QJTA 4H3SA 4RUKA 2PIDA 2X1LA 3K9WA 3PNVA 4EG8A 1JHDA 2OQ2A 1MAUA 4RPIA 2QJOA 1FFYA 4DDHA 3IOCA 3FY4A 4QBTA 3SYTA 4MW0A 3MLBA 3DLAA 3P0HA 1PFWA 1EXDA 1LW7A 3IMEA 3C8ZA 1WXHA 1XNHA 3FWKA 4EGAA 1Y42X 4CQNA 2DLCX 2E89A 3ELBA 2A84A 1I6MA 4PBTA 3HFJA 3CR8A 2IJGX 1QJCA 1N2GA 1O6BA 4ARCA 4ARIA 4WNYA 1M8KA 2X1MA 1R6UA 5TS2A 4YP5A 3GLVA 4ZT4A 2NZ2A 4NAHA 3SZ3A 2A1UB 2HZ7A 2QTNA 4HPWA 3SEQA 1KH2A 1M8JA 4MWCA 2RD2A 3ND7A 2IELA 3GMIA 2NSYA 3H9BA 1BS2A 4G6ZA 2J5BA 4L2IB 1HYBA 2R5WA 5FO0A 2DERA 4A91A 3D6VA 1TYBE 1IQUA 1EFPA 1U3CA 3MMXA 1K97A 2CYAA 2YY5A 1N2BA 5JBNA 3G59A 1QNFA 1EFVA 3TQOA 3ZXIA 2AZXA 1O0CA 5HUJA 1IQ0A 5K0SA 1O5TA 1X8XA 2D13A 1N2OA 2QJFA 4XFDA 1OWPA 3ZGZA 1WOYA 3CLSC 2ZUFA 1KH3A 1QRTA 3KT8A 2CV1A 4MW4A 1MRZA 5J58A 5KCMA 1U7XA 1WY5A 1N75A 3RJZA 4NZPA 1NZJA 3AFHA 4GU5A 3FETA 3CVYA 1QRUA 4X0EA 1OWMA 1IVSA 4QREA 4MUNA 2G36A 4ZT3A 1NUUA 2JA2A 4EG4A 3ILVA 4ZCQA 1WXIA 1F7VA 2VTBA 1KORA 4MULA 1IHOA 4MVXA 3FHJA 2PZ8A 3FG9A 2Z08A 1LI5A 3UOWA 4OUDB 4EG6A 3P52A 1XNJA 3IVXA 4R0NA 1O95C 3VRHA 2X0KA 5DB4A 4J76A 3CLUD 1XJQA 1YI8A 4DE5A 3KFLA 3IVGA 5H7XA 4K0RA 1U7DA 3CLTC 1G8GA 3PNBA 1J20A 1T6ZA 3CLSD 4PBSA 2A1TS 1MJHA 3CLRD 1WZ2A 3D6UA 1NUSA 3OP1A 4EG1A 3IMGA 1VLHA 2PG3A 4EFKA 1CT9A 2Z09A 4ND7A 5TGTA 1WJGA 2XRYA 2QUKA 4NX2A 1GTSA 3G5AA 3PRHA 2DETA 3KT3A 1JECA 4ZT7A 1PFYA 4KPUB 2PZAA 3L93A 1K4KA 2RE8A 3A4IA 2DPLA 2CV0A 5IJXA 1EFPB 4ZCRA 1O96B 1JEDA 4MVYA 4F4HA
chains in the Genus database with same CATH superfamily
3A6EA 2HJHA 1Y1QA 3DXYA 1MC4A 4H7IA 4OAPA 3IHWA 3OM8A 5HMLA 1XCOA 1Q6ZA 1RT9A 3TGPA 2MCFA 5T4BA 3CS3A 3MG9A 1JBEA 4ZYTA 2VWHA 5EE9A 3WLIA 3K1ZA 1P3DA 2M6LA 2O3QA 3RS5A 1F9AA 2IZZA 3FOFC 5GOZA 3TZLA 1E1NA 3E9YA 1WMDA 5KB3A 3VPCA 1NX6A 1UXKA 2X7XA 2BHTA 3MELA 1YS9A 2OBXA 3QELA 3U4AA 1PG5A 3VH3A 1XP5A 2GPBA 2Q7XA 5CLJA 2XYRA 2R00C 2O07A 4DJFC 3TIXB 5DDIP 4LRUA 3QVLA 3EW7A 3GBPA 3ND5A 2PZFA 1E7WA 4MW9A 1MH9A 4AZ0B 1GU7A 3A6PC 2HA2A 3PCXA 1WNTA 5FI1B 2VDQB 2EDAA 3U5ZB 2GYWA 3I05A 1CJUC 4J75A 1SQFA 2E4XA 1U3VA 4M83A 1IYZA 1G8FA 2W6QA 1JDTA 2P2CA 3IP3A 5ENDA 4DQ0A 4YDHB 4YAEA 5KVAA 2NSHA 2WJGA 5AVUA 4N6OA 4ZTZB 1N8NA 2I3AA 3UWPA 1TKCA 1T5IA 1TKRA 3RC1A 4XLZA 4Q9IA 3QA3E 3GCZA 1KQPA 1ZN7A 1GQRA 1T36B 4BO0A 1JJAA 1W6UA 4KQIA 4DGQA 1W2GA 1WPQA 4L51A 1RRFA 4H1TA 3UB2A 4Z3DA 4BWYA 1AMNA 2Q1SA 4NU0A 1GILA 1UH5A 3NBZC 4YP7A 3D3QA 2YMPA 2WVJA 2JW5A 2ZI5A 2XD4A 4TZKA 2ANCA 5CVCA 1N8TA 3UK2A 2X9NA 4EYGA 1YQEA 5JEEA 3FWYA 1RWVA 2E4VA 1QM5A 2P35A 3CI0K 2GD1O 4KFTA 3WBKA 4KQXA 2R3SA 2P6PA 1OH8A 4BLPA 3ZOZA 3O7WA 1E32A 4UARA 1CEEA 4IO1A 2OILA 4U2DA 5H3LA 1NLUA 3ZIAD 3JQGB 3GIDA 4MQBA 2RIPA 4UU0A 3Q12A 1G2QA 4U2GA 1BA3A 3M33A 5A9RA 1VKRA 3X1ZA 4LDPA 5JLJA 2RGRA 1QHSA 4M38A 4DT1A 4JVOA 3LCVB 3UAVA 4DV6B 3DUWA 5FORA 1KPGA 1AU9A 2EOAA 4MQ6A 3OJXA 4PCUA 1NVWQ 2AFIE 2QEQA 3DOFA 3PCRB 4B9EA 4J6FA 3EUWA 3IEUA 4JS0A 4Y98A 1WXXA 2G9NA 5EIFA 2V3VA 3KVYA 1PJAA 1II9A 4BQFA 4D42A 3HCWA 4OP2A 1QP7A 3VBEA 3VH2A 4O63O 3EOZA 1CETA 1G20B 5AK0A 2FHSA 2XV1A 3E3AA 4MLDA 1KXJA 1Y6GA 5G40A 1Z39A 1A8QA 3EZFA 1LS1A 2H4HA 3N87A 1DOHA 1T36A 2NZWA 4V0KA 2PKYX 2AEFA 4X6LA 1DBVO 4JMLA 2IEDA 3S68A 1DAEA 2F9FA 5EKUA 3AM4A 1QIDA 1K9SA 2ZYGA 1M6YA 1P8AA 2VDWB 3AM5A 4F3RA 5KOHB 1NNLA 4AICA 1HZZC 1KMQA 2ZVJA 3G5MA 4FK8A 2IXGA 1U81A 1MO5A 3HDGA 3E48A 1WOMA 1U04A 1G21E 1WVMA 4TTTS 4F93B 3UJNA 1CUWA 3EXFB 2NYUA 2PQMA 3V32A 5C4IA 2R00A 5HIKA 4LZAA 4C0WA 3HS3A 2R8BA 4KN5A 5CB4F 5A5GA 2FPIB 2P0AA 3LT5A 3G8CA 2JPDA 2CNOA 2ECKA 4GC5A 5D5QA 1NQVA 4IIFA 4U6QA 2ZYVX 1CQIB 2C07A 1NDHA 3H0KA 3D7NA 1Q7GA 1AZWA 3A1EA 4PHHA 1QHXA 1FFEA 3X2EA 1AS3A 1DXOA 2EWVA 2WUWE 4HCJA 2ZCVA 2Q2WA 4R41A 4DAEA 2WTUA 3REFA 2DQSA 3DFMA 3VX3A 2PKCA 2V7WA 2QAGC 3H75A 1NVKA 1ES9A 3F98A 1MU0A 4GDMA 1L1QA 4LDAA 1G20A 4KXMA 3UMYA 1ZMTA 2J5KA 2ZT6A 2Y68A 5HEKA 3GRAA 3T9AA 1E1YA 3ABZA 1IY2A 3QLEA 1CEQA 3I6ZA 5EOVA 3D0QA 3B9BA 4M55A 4TSRA 2QM7A 1ZR2A 3I72A 3A2NA 1LDMA 1IM2A 3Q9NA 5TARA 4FX5A 1XCPA 1FQKA 4CN9A 5LOVB 1UZNA 3R3UA 4DV3B 2F64A 1PDOA 1OLSB 1R6TA 3SLKA 3TLAA 3GT0A 4YQFA 3NAQA 1MDBA 4B73A 3GXOA 4KH0A 1JEEA 4R83A 2G67A 2H7YA 2FFBA 3TLMA 4F3KA 3L43A 3FFAA 1U2PA 2O06A 2XVYA 3EXFA 3K16A 1E7YA 4PSVA 4GE0A 4D3SA 3IEIA 1DDIA 1VKJA 1JQLB 2NV2B 2PEYA 3AVYA 3NX4A 3K31A 1BQ3A 1RLIA 4TUYA 1MEOA 2BONA 2OHHA 4A7PA 3E84A 1PR3A 1KI1A 4KLNA 3CVWA 4KW7A 3O9MA 1C7IA 3ZC3A 3OQPA 1THGA 3UKJA 2AG0A 4BV8A 2ZSUA 1ODSA 3ZCVA 3NTOA 4NAVA 1FW6A 1ZH6A 3GH1A 2D3TA 5BNTA 3PC4A 2Y3IA 2HLPA 1M8PA 1PG2A 4MZDA 1KZYC 3W2TA 4TMYA 1BH6A 1CXZA 3NAMA 2R1UA 4B76A 3S81A 2YVLA 1AY0A 2A2ZA 3FPCA 3ZNOA 2ZAYA 2BD0A 2GM3A 2YDXA 2MT9A 4HAZA 4RQBA 4B32A 3FTQA 4I4LA 2J3HA 5DZSA 2NO7A 3KTDA 1Z6TA 3CUUA 4TKLA 4OGFA 4U7WA 6LDHA 4Z3KA 3BULA 2EQBA 2I3GA 1Q7EA 1T5DX 1PWYE 4U0JA 2RKOA 3THWB 4GOLD 3SJAA 2O1SA 2OV4A 1K5HA 1OLSA 3DDCA 4BVGA 2X4GA 1U1CA 2RIRA 4DWVA 2HUPA 4JYCA 2WBLC 4PW0A 2DUUA 4PNZA 4GI5A 3L4JA 3L6OO 2IXAA 3QOFA 4ZAVA 4H27A 5T6MA 3AEXA 5IT4A 2PSFA 2BGJA 4ZO6A 2PGDA 4TKUB 2W5UA 2AT1A 2EC5A 4JQOA 1E4EA 1AMOA 3G9XA 5TY0A 1TW3A 3AR2A 2AR9A 4EPXA 2ODTX 4C2TA 1VZ3A 1B0ZA 3TOCA 1KRXA 1FDSA 4NBNA 2A7QA 3RFFA 2WZDA 4Z7QB 4N3CA 4ZICA 2FDCA 2P4SA 3PXDA 1GP2A 1TKAA 4MUKA 2GLUA 2OG2A 1BE8A 4RETA 1UL1X 5EPEA 3FLAA 4DBLE 3B5EA 4QBGB 2WTMA 2FLWA 4ZO4A 3NBAA 3H97A 4B6PA 5LMZA 2NXEA 3ENVA 4WKNA 1DIAA 2CT8A 1XU4A 1CZHA 1PUJA 3L6RA 3TAHA 2V7QA 4RHFA 3ZYCA 1E5LA 3SFTA 3P2KA 4GPTA 3IMCA 4BMZA 2C4NA 2FPXA 5B1DA 3LQKA 5E38A 1TEZA 3L8HA 5KPDA 2Q9AA 2QGZA 2J32A 3QIVA 4HJXA 4R8KA 2EHJA 3LBAA 3LPAA 2IW1A 2XT0A 1EBUA 1SU8A 2IPXA 1C8VB 3KFVA 4JOQA 4MA4A 3OKFA 3TZBA 3QEMB 5E9QA 4ZAZA 3GGGA 3G8DA 1Q20A 4PSDA 4G8JA 3EZ2A 1EGAA 2VTEA 2VPXA 3EIUA 4FQ8A 4Q82A 4PYJA 3AIIA 3AUKA 4PYMA 2QL7A 3A3YA 4IIBA 3RR2A 4ZN6A 5U9CA 2F62A 3AU9A 3A58B 4MWZA 1DFHA 1AKUA 3BWXA 2CDCA 2LD4A 2GAIA 1Q3HA 3A14A 3O73A 3QV2A 4HB4A 4IHJF 4W82A 3T1OA 3WRVA 3A3NA 3PD1A 4JI1B 3WFZA 4YUVA 1V95A 4IDBA 1J0DA 4LGMA 5DNYB 4PZ9A 3AHJA 1L7NA 2CMHA 4CKXA 2WWXA 2I3ZA 4PX3A 3ZS9A 1YVPA 2NACA 1Y80A 5EPOA 3BGSA 3STWA 5IJ9B 2WJ4A 2BDUA 3ZG6A 1ZRNA 5A9SA 3OZVA 2XUKA 2R44A 1UJBA 2YFHA 1XK6A 4PSKA 1U98A 1BWPA 1UDAA 2P0EA 3UJAA 2YJ6A 3IV6A 5FI0B 4DV4B 5K0NA 2JFNA 3BIJA 2VATA 4UXIA 2UYOA 3HCDA 4L15A 4M0FA 4EIWA 2XB2A 4H3SA 2ZWPA 1KNXA 2BBWA 1T2CA 3L7DA 5A0TA 1Y6QA 1K2VN 1JQEA 3HJCA 5BYBA 3EZ7A 3SDZA 3T7RA 5BWCA 1VCNA 3HRIA 4EG8A 3CEAA 3ENKA 2XYQA 4H4CA 5BSTA 3TE7A 1X8KA 4N18A 4FM9A 1EQ2A 1GV1A 2CZQA 1NQWA 2HBQA 3G17A 3MCAA 2R8ZA 3Q3IA 4OQZA 2Z6QA 2F8LA 4WMLA 3R0VA 1GNSA 3ZZ0A 4XLTA 5DX1A 5EZYF 1GR0A 5HKLA 4DDHA 1B16A 2GXUA 2DPGA 3O3NB 4MINA 1I0ZA 1LZLA 3VR2A 4B6FA 3CZ4A 4BNNA 4BNIA 4L50A 3S27A 5F77A 1WPXA 4XWOA 3NC4A 4QUDA 2QD3A 2IIBA 3VR1A 3ZX4A 4QDOA 4B3XA 4BO2A 4M1ZA 4IIGA 1B1AA 1PT7A 2B35A 3BZUA 4BQRA 2CXPA 3NBUA 3N6RA 1V48A 3CR8A 4IGFA 4K05A 3D8BA 1OXBB 2JGRA 3EIEA 3GV0A 1CDOA 4X8HA 2JVKA 2DB3A 3DYBA 3PSHA 3H5RA 4G0PA 4P58A 4GUDA 4DTCA 2HTFA 2JGAA 4LCBA 1S9HA 1E77A 2PCLA 3HDHA 2ADFA 4WA7A 1U7HA 3UK6A 4AF8A 2G5GX 5HW0A 3I1YA 1P3Y1 2IQIA 2VUIB 5IJ9A 4J1NA 1M2FA 1Y6ZA 1R00A 1RWPA 2XWPA 3BWBA 3NYIA 2KQUA 3W7VA 2V7QD 3BF8A 4I3HA 1RM3A 5HQTA 5BSFA 4AY2A 2QTFA 4KWCA 2CFTA 1MMFB 3WRYC 3ZBQA 4ISBA 1ZVKA 4MWCA 3UA3A 1EE2A 3LRTA 3ND7A 4J7AA 4DDVA 3A70A 1YMVA 2FR1A 1R0CA 3DE6X 1GUFA 3DS8A 4DCUA 1GCUA 3DC7A 4KQGA 4BNUA 4DVJA 4YCSA 2NVUB 2DERA 2EP5A 4LWZA 4RD3A 1KHTA 2JKVA 2WHXA 3L0SA 1UBOS 3QX9A 2ATCA 1ST3A 4FC7A 3KWJA 3RADC 2NQ8A 3OQIB 3OT5A 3TBFA 3J81k 2KLBA 3U61B 4Q4AB 1X7XB 5IXSA 5L45A 3GEDA 4EA6A 4XQ9A 4F12A 1U31A 1QAQA 2AJTA 1HNWB 4YP9A 3S2SA 3KT8A 1N6OA 2R65A 4MW4A 5MN5A 5J58A 1YD7A 1SELA 1PJ3A 4W9NC 2IWRA 5IF3A 4P93A 3RYHB 4HGZA 4JLMA 5JYCA 3E3LA 3FOEC 3G1UA 3G79A 1MABB 3O3OB 2I6QA 3KQOA 3PF8A 4R3NA 4UXJA 4GU5A 2QRJA 1QRUA 1GWNA 1Y3HA 4QOEA 2PYZA 3FUXA 4HQLA 1UBUS 4TPKA 1F0YA 3OFVA 4UE2A 3WYGA 3ZGYA 2YJZA 1UKBA 3H5NA 3S4YA 4Q4CA 1GLVA 2ZTHA 3DWIA 1FFXB 1GQ2A 1XIVA 4KR0A 3PITA 1OH5A 3WWPA 1E3SA 4GVXA 1GEGA 1Z73A 1SC1A 2ODBA 3N8KA 4TRNA 3WK6A 3H17A 1OH7A 1JKXA 4UM9B 5JJKA 2G9UA 1P72A 2MMGA 3KQTA 3VR5H 3OAAA 1QANA 1KK1A 3PJRA 1BD3A 4Z0TA 4G81A 3MGCA 1VP9A 3NIDB 4V2UA 3M8KA 2O8FA 4ES6A 3DZDA 3ER9A 4KBGA 1XNJA 2WAAA 3H4TA 2GERA 2JJ8A 4EVQA 4ZDKA 3JS5A 2JKYA 4JMPA 2G08A 3HWSA 1U1FA 2DRIA 3T1VA 2BEJA 4MKHA 4W5HA 5BRNA 3IVGA 1SMKA 4K46A 5KX5F 3DKPA 4RE5A 3HA7A 1G8GA 1X7XA 4IGAA 1J22A 1R4MB 4BNGA 4UFOA 1M0TA 3ZWCA 2VJYA 1I8TA 5AM4A 3EMVA 1ZN2A 4RKYA 3HJBA 4BL5A 2XMCA 1YR6A 3AYZB 3GRZA 1JH8A 3MHPA 4KV7A 3LKDA 4RL4A 1BEUB 1ZD8A 4NU6A 4EFKA 2DC1A 2GZHA 2XUQA 4QJIA 3RYHA 4RMNA 5B3AA 4A92A 2D7DA 3W9SA 1MABA 2TRSB 4JCCA 5JCOC 2JHFA 2J8ZA 1RWMA 3BG5A 4Q3BA 5CP8A 2IY7A 1IWBB 1VJDA 4B3MB 3R9KA 4KYIB 1RQNA 3TTUA 1TX4B 4NMHA 3UAOA 1Z2OX 1U9CA 4KVZA 4BAZA 1PFYA 1WAMA 3CNQS 5F3DA 3HJFA 4X6YA 2IHUA 4FFNA 5FOVA 1M9NA 2VRNA 2Y1EA 5IJXA 3BJZA 1LV7A 1NE7A 1QHEA 1O96B 3WHPA 4JBNA 1I9GA 1CUFA 4Y2QA 3C98A 2G7ZA 1FTWA 4EGQA 1WSDA 2A6PA 2ECPA 1L5NA 4LDNA 3TD6A 3TRFA 4EENA 3HG7A 2FCRA 4P34A 4V0SA 4CEHA 1JQDA 2YWRA 5U4XA 4PZPA 5J3JA 2HU2A 3WLMA 3HVIA 2WWRA 1LBQA 2BMAA 1S96A 4BFCA 3C4VA 4J0IA 1VQ1A 3B89A 1M1ZA 3QU5A 1QFSA 4MRSA 4Y1RB 5EIHA 1S89A 2WE8A 1R4MA 1X0VA 1UODA 3N8NA 2JI4A 2PMFA 3HYSA 5CBKA 3BBPA 2IV3A 5EP4A 5FA8A 4W9NA 3LCRA 2ZPAA 3VHRA 4B6QA 3IAS1 2VQSA 4N3GA 1FDVA 2B2XA 1F2DA 1REQA 1YBVA 4CMEC 3WLFA 3R20A 1T5TA 4MWOA 1HE3A 2O0KA 1P81A 2BEKA 4WCVA 1XXHE 5BMOA 1M8GA 2ON6A 5LA6B 3N5KA 1ID8A 1ZK3A 1UPTA 4ZT6A 3H84A 1OW3B 5K1ZA 5KWEA 2ZW9A 3OZ7A 4NI5A 5F52A 4DILA 4E5YA 2YQ4A 4B43A 3ZE1B 1Y4DE 2ZWOA 3SZMA 3HZOA 1ZY2A 2HDOA 3A4TA 1YGPA 4P38A 4QBFA 2C59A 1A8SA 2QX8A 4DKJA 1A7AA 3LX5A 4QTUB 4UZEA 2JAHA 5HUHA 4I3GA 1NMEA 2YWJA 3OAAD 2QD2A 1O96A 3CEMA 4LFBB 3KOWA 1EWVA 5CNKA 1KRHA 4KJZA 4UDXX 5J2UB 3RC9A 3U44B 5ILGA 4RJTA 1V11B 1CJVC 3TAUA 5K4GA 2IHNA 2BY4A 2FZKA 3R3JA 5I8ZA 2UZIR 2Q9BA 3FCUB 3L7YA 3AI2A 4H1UA 3IFSA 4F8YA 3HVHA 1Y3FE 2JAWA 4YI3A 4HK4A 4KH1A 4DBZA 4EY5A 5EJEA 1P39A 1GO2A 1L4HA 1R64A 2AXEA 2XKBA 2ZFUA 5H8WA 1BDIA 3N8DA 3QFRA 2W6OA 3H99A 2C9CA 1KAHA 2F9LA 2WA2A 4JUFA 2OXTA 3U80A 1KO4A 4EGJA 4YBZA 4CQLB 4JI2B 2OFFA 2MSEB 5JMTA 1XXLA 4BHTA 2QN8A 3CSDA 3I9JA 3DDZX 3P9CA 2GBLC 3H42B 3D6HA 1NATA 2PV0A 5KJEA 3RRYA 4XEUA 2PJUA 1RACA 1XZAA 1YDMA 2PRZA 2GPTA 2VNSA 3DVAA 5JCOA 4I55A 3SC4A 4DIDA 5LQMA 1U99A 6CHYA 1S3IA 1UDXA 2AB0A 3BFXA 2ZAOA 2DBQA 3K0SA 2QPTA 5F2KA 2Q49A 3K20A 1GDHA 2YC2C 5LA6A 1Z6AA 2PKRA 3AQ4A 4IMJB 3QKRA 4YNBA 4QQKA 2B78A 2O5RA 4G1CA 4HNAA 2ZZNA 3PQEA 5DYIA 5AHKA 3G1TA 4B84A 2XKKA 4MKZA 1LSSA 2V3CC 3LC1O 4C3OB 1NV9A 3TQSA 2IZ1A 4LJ6A 3ESRA 3IQFA 4ZO7A 2PAFA 2DR0A 4P83A 1NULA 4RADA 3RC2A 4FYVA 3HKCB 4CKCA 4EG7A 3Q4GA 1FYDA 1AA6A 2P2NA 3CH6A 1K4YA 2ZXFA 3JTEA 5LMCA 3D3JA 4I9GA 1W76A 1V11A 2Z3WA 5A5EA 1AJEA 2XGMA 4G4SP 4A6XA 2D0DA 3CEJA 1ZL0A 4JYPA 3KQUA 1GN8A 5C3UA 1RFGE 3A0RB 3WDSA 1VLJA 4HWPA 1P44A 5BXQC 1VE6A 3OUUA 4U2BA 2ZYIA 4DDKA 2D54A 2WHPB 2I8LA 2JGIA 3H1TA 3SYMA 4EJMA 3DO5A 5AW9A 4J9UE 1GY8A 1ZWLA 2QTRA 4UE6A 4BJ6A 4ODIA 4RV5A 4DXAA 5AW5A 1Z4PX 4LNHA 1WXEA 1J9EA 1EDBA 2WWWA 3CKMA 3UG6A 1C7FA 4PX9A 1Q21A 5ALPA 1IY0A 2P30A 1UDBA 5L7TA 3TLYA 1HSZA 3U3DA 3HXPA 1TQ6A 3ESAA 3AK4A 4G85A 4GD3Q 5I9TA 2H8KA 1LWNA 1GUBA 3IT3A 2G72A 1K75A 1PBNA 3D81A 2YWBA 4Q7QA 3DZFA 1D9ZA 1JE1A 1SBTA 1LEHA 4Q0MA 1EHCA 1X15A 1GR1A 2R8RA 3ETNA 2OV6A 1ZJYA 2WINI 5KWVA 3G9UA 3P9KA 4P0TA 1QTQA 1JMYA 3LQ2A 4FE7A 3WKCA 2J3IA 4NMLA 4HZUB 5KAPA 2A7XA 5L3SA 1ZCFA 4PZYA 3CNEA 2P9BA 1B8PA 3EZNA 5LWHA 1N57A 2EXXA 4P1ZA 1G8AA 3RVNA 4YWJA 4UBMA 4R2HA 2D06A 2C4VA 3DULA 4OU4A 3OCUA 5ELLA 3VC7A 2JAQA 4JC8A 4A10A 3VO8A 3ZWKA 1JYEA 3WB1A 4Z9AA 4M54A 1KZ1A 3LBIA 2D2XA 4I08A 4OMFG 1WZEA 2QQ0A 2OQVA 2XRZA 2VO1A 3IPLA 4GBMA 5HS6A 1N5RA 4BPRA 1I2MA 1VHJA 1Q50A 2G1KA 1B6RA 2I5PO 3HHPA 1YB2A 2PUJA 1GDTA 1XRMA 3AJ8A 3ZWNA 2WHPA 1EQAA 2WKWA 1VL5A 2Q3FA 3BDVA 3LOPA 4N8SA 3TNLA 3GGOA 4DREA 3R9WA 1J06A 5CD9A 1NIPA 4HY3A 5ALYA 4FHGA 1DTWA 4OLJA 4E1AA 3TJZA 1CDEA 4QOIA 2LKCA 2PH1A 3PVZA 4PU0A 2DWOA 2O7VA 1JKJB 1SAYA 2FUEA 2HCJB 2VI5A 2A9JA 3C43A 1EFUA 4JH0A 4O5AA 4QL3A 4TVKA 5IKEA 1A9XA 3OUTA 4G8DA 1E89A 4D96A 2ERXA 4TVBA 4X64B 1Z5GA 3LUJA 1YJQA 2P4QA 3UJBA 2H4FA 4DIMA 1QU2A 1E2GA 1IJFA 2HWUA 3WWZA 2XADA 2PMWB 4TL7A 1VL8A 4EHJA 2HA5A 3JPWA 1AKWA 1QFZA 2WHEA 4ZYWA 5C9ZA 4N5DA 3T99A 3WIDA 4RS4A 1TDJA 1H3EA 4P33A 1KJYA 4TS4A 2NWQA 4UUOA 3GI1A 3IGFA 4YJDA 4EARA 4HZUA 4NZMA 3BE4A 1DEKA 3I28A 2ZSJA 5H9VA 1MX3A 1J8FA 4RNDB 1OLXB 3GAMA 4BAUA 4EY7A 1DXYA 3D6MA 4H1VA 4Q4HA 1D2AA 1YJXA 2ZU0C 1QCCA 3B52X 4AS2A 2J6IA 1YB5A 3T0GA 2GUWA 5FOWA 3IJEB 7MDHA 4OBBA 2ZANA 5CCBA 3UJHA 2P6NA 4S2UA 4WBSA 1YB7A 1X1EA 2ZBGA 2GZSA 2NG1A 2RK4A 1IBCA 4MWTA 3DTNA 1M1XB 3O93A 1GU0A 2B1IA 3UPTA 1XMQB 1N0WA 1FTYA 4IY1A 1OTYA 3OKCA 4EB8A 1AS2A 1PNOA 2RHOA 3DE5X 3ROTA 1PZXA 1SOMA 1W19A 2GN4A 5AK4A 3ZIUA 1VE7A 2BKUA 4RF2A 2GBIA 4DV1B 2X86A 2XWQA 2C97A 4EUNA 4S05A 3E9MA 4GNKA 1JKJA 1GNTA 3GJ4A 2Z5VA 1YE8A 3MK31 2QE6A 2QI9F 3HFGA 3IKVA 5CGQB 3OETA 1T3HA 2IYNA 3EDCA 1XE3A 3IX7A 2F3QA 4QBIA 1UJ5A 2V7PA 4ZQHA 1GRVA 3UWMA 4A2QA 1WP9A 5LP6B 1E63A 3O4HA 3SSMA 1SBZA 2V1XA 1ETUA 1NGSA 3LD9A 2XIJA 2QRUA 1QIGA 4XOUA 1I01A 2H54A 2W2PA 4YRCA 1JNYA 3O1LA 3JQ7B 3I2FA 3L8DA 3FFXA 3MTAA 4MV3A 4R40A 4UVIA 4C43A 1OLXA 1VB5A 4UFNA 4RVDA 3IDOA 4JOBA 1KDOA 2Q2VA 3IUJA 2C0PA 4BRZA 5CA0F 4EI7A 3DFIA 2VAWA 5BSRA 3AUFA 4FYMA 4Y3UA 1EDDA 1E6LA 3P5SA 3UQZA 5EIAA 4AL4A 3A3KA 4HNVA 5I4BA 1PFQA 3PNPA 4MI9A 4URYR 4UU8A 4LF8B 4L5BA 5K4HA 3J7AC 5JNRA 1XL1A 3QM1A 1JDBC 1JFFA 2OHJA 1FP4B 3CIFA 3LC7O 2OD2A 5DLQC 3VYSB 1PKEA 1L2TA 4KXWA 5FLEX 5DNWA 4F7DA 1CF2O 3IVCA 1G59A 2R68A 1OT3A 4UCQA 2QD5A 3ED5A 4RANA 2OY0A 3L7BA 2Z0MA 4ZMSA 1Q7BA 4QXPA 4I81A 4HFNA 1Z5VA 3T94A 1KZ4A 3WB0A 3JR3A 3ZD8A 3ISTA 5HKAA 1YS1X 1IFXA 3KEMA 4N3AA 3TKAA 1PJ2A 5LP6A 1BDMA 2YJ4A 3KXIA 3RFCA 4NCNA 3RK1A 4D3ZA 2A9QA 2ST1A 1PJTA 1VC2A 2HDWA 3B2EA 5F1PA 3MWJA 3VM6A 2QD4A 4JP5A 3ZUPA 2QIOA 2JJMA 3CO0S 3GCXA 3H87A 5H68A 4HV4A 5BSEA 2NYVA 2W7TA 3N7TA 4TMTA 1TAGA 4N9QA 4C03A 4J1TA 3JQ6A 1MJ5A 2Z57A 2HNAA 5E95A 3ZGNA 2H1RA 2Z9DA 2G5CA 4W1RA 1FVXA 1O87A 5C37A 2NZJA 3M81A 1JDBB 2VXBA 4PLYA 4L57A 1EWRA 3S2FA 1VPEA 1UANA 3EC1A 3QPVA 4HDSB 3K73O 4UU7A 3FZYA 1YRWA 1JN0A 1XN1A 4D79A 5CB4A 3DPSA 1DG3A 4PCLA 4TV8B 2C2OA 1HE2A 3OT1B 3RSOA 5JHGB 4G0YA 1NXSA 1OFIA 1VJRA 3PXGA 2D8AA 2WC1A 3P45A 3PPVA 4DA8A 3C5EA 1V6AA 2ORYA 4PBTA 1THZA 3RU7A 3HFJA 5A4DA 3KQHA 1FX0B 4BFSA 1FL9A 4G24A 4LXXA 4FFLA 5HQ3B 2OVFA 2R62A 3CMMA 2E6UX 2QUZA 2ID7A 3I39X 4BFVA 1P0IA 4XRGA 2H2FA 1V16A 1U5BB 2FU5C 1I13A 2HA6A 3RAFC 5AOVA 3CF4A 4RXUA 2O0JA 3VYTB 4EJFA 2XMZA 4ZYYA 1DKPA 5AXCA 3UIEA 3QK7A 1CY4A 2HDNB 4LXYA 1VIVA 3W1VA 2YZNA 2GTIA 1EG2A 2HSDA 2IOFA 2QTNA 2WUDA 5DBGA 2ONZA 4BJ5A 2DFKB 3NORA 4D02A 4M9UA 3BSWA 4RY0A 2DFLA 5J4VA 1E1KA 4MJ7A 2NV6A 1CRQA 2XMBA 4JR0A 5BVHB 2VBIA 2HBRA 4FDVA 5TS3A 4CM3A 4YPVA 3WAGA 4DUZB 3D6VA 4FZ3A 2IBTA 3HEBA 5BORA 1UBMS 1IUPA 3WXBA 1ENYA 1BTOA 3MMXA 5EJ8A 4JA2A 4Y8VA 3WMFA 3GPCA 1DJMA 3HADA 1EFVA 2EEZA 3F6CA 3L7LA 1C3OB 1QQ7A 4HDSA 5G1NA 1TVMA 5CYPA 4NMMA 5K0SA 3WYCA 4BFTA 2JHPA 1M34A 1L3BA 1DKLA 4FFPA 3WGHA 1L3IA 4TV8A 3O3MB 2ZUFA 4A8HA 2ZYWX 2A78A 1XVVA 1L5ZA 4OYRA 1E9DA 1XRLA 2J3MA 3EBLA 5F9MA 5K05A 2PK3A 4LZLA 3I64A 4Q9DA 4ALLA 1R7RA 2AFIB 2OV1A 1PYGA 3E5NA 3R77A 1W59A 2I6XA 4LRXA 5CNMA 3HYCA 5E7JA 4CLOA 3O4JA 1OFUX 4HRAA 4RV9A 1SBNE 4QWWA 4NZPA 1ELOA 2GEDA 3W06A 2INGX 3A4MA 2N0SA 3WJ2A 5M04A 2XNDA 3P0RA 4X0EA 1EWYA 2YN0A 1U5BA 1JLRA 5P8WA 2NOAA 4CDRA 2PLFA 2BMWA 1X8JA 3WO1A 5B7NA 1QDEA 3LT1A 4Y9RA 1DX4A 3BT7A 1H2XA 5IK2A 3EVFA 1M75A 2AFHE 5CM2Z 3QNWA 4NK4A 3WWCA 4J07A 2NTEA 1SRRA 4DEYA 3SPXA 2ZSBA 1G21B 3TH5A 1KIMA 4PPQA 4UVHA 1KFBB 1WU7A 2PSHA 1A9YA 3B7PA 3LP5A 1DG9A 4LQCA 4EGSA 1THTA 1OGYA 1FY2A 1O95C 2C2BA 4R0NA 4AWBA 2FEOA 5FIUA 2J0EA 3RG8A 4FP9A 2FWIA 1PK8A 2PO7A 3IP5A 4BQOA 4QJ3A 5CVJA 3QJYA 2W6PA 2OTCA 1UP4A 5CNIA 2BL4A 3CLSD 4PBSA 5DLPA 2FMUA 5SY6A 3DB1A 1OFGA 4RTOA 2CCKA 3DF9A 1G9XA 1BGXT 1W1UA 2KJQA 1OTHA 2P2ZA 3EDRA 1JR3A 2Q9CA 2FI1A 2NUPB 1XMJA 2PRYA 4PLGA 4BCDA 4F84A 4RE6A 1Y8ZA 1I24A 1RZRA 3EF1A 1U2QA 4P84A 2JIRA 3DKRA 4YHBA 5FAXA 4Z7OB 1Z4KA 5KZMB 3LL4A 3Q8LA 2QTZA 3WWOA 4X41A 2FW7A 3K6JA 4PR0A 2W2MA 4Y2PA 1DRJA 2E5FA 3ECSA 4LZOA 3F74A 3OFSA 5FEUA 1QLJA 2NZYA 3W5DA 1JHQA 2WUGA 4CMBA 4IF4A 2B94A 1NP3A 2DX7A 3FOWA 1TGYA 1K7SN 3MBKA 1JECA 4L22A 5JSHA 1FOEB 1WUJS 4ZI5A 1SBYA 3EEOA 2AR0A 1K4KA 1SOWA 2X76A 3KPWA 5EQJB 3V80A 1MTOA 3B12A 2WA1A 3WNQA 2QQEA 5ADVA 3C3WA 3WSTA 1WZIA 1E94E 4QD3A 1I4WA 1JEDA 3CHYA 5ENZA 3H3FA 5HPYB 1G42A 4YJ3B 3CCFA 2ZIUB 1QRDA 2QB5A 1G21A 4I5DA 2H3HA 2OHVA 1CRLA 3EIQA 3Q5GA 4JC4A 4RJKA 5CRIA 4ZQIA 4WOPA 1LSJA 3GN1A 5FL3A 1NW6A 1PQPA 2GK3A 1VXRA 3SDBA 2XWBF 1R4ZA 1XMIA 4LJ7A 4M0CA 2Q41A 3TEMA 5LU8A 1GPJA 3LQ4A 3C3CA 3VPFA 2BKAA 2AA3A 5G1OA 1I1NA 4PR3A 4HH4A 3SFZA 3EVGA 4B74A 4AUMA 3ANMA 1Y9DA 3EH1A 1U9JA 1WQ1R 4HI0E 1KFJB 2P75A 2M6RA 3RKUA 5A5VA 2NUPA 3D3WB 1N36B 2VP6A 3ICEA 5BPFA 4MEJA 1QDLB 1DUVG 2P11A 1T8PA 4OFZA 3EBOA 4ZCTA 5AJUA 4ON9A 1SXPA 1DHRA 1EQUA 2Z6VA 3IBSA 3P4YA 3OE5A 4DBLC 2XNDD 4H0NA 5AVWA 2YHIA 2PX4A 1YKFA 1TYDE 3ETDA 2XA9A 4NS4A 4O2AF 1CY6A 5FA5A 3GZNB 5TF0A 1SUCA 2OGSA 4IAOA 3ZWVA 5JS8A 1FU8A 2RI1A 4QPJC 5K01A 5LXTB 3HM9A 3TWOA 4IF6A 3AVOA 1DCKA 4NLLA 1TZBA 3KAKA 3DLHA 3PHHA 5IK2D 1VI5A 3B9QA 3TTWA 1EJ2A 4LSMA 3I6YA 4YRFA 1W2WB 1PDWA 1TADA 1JW9B 1ZI6A 2PGLA 2WSIA 3IDAA 3KKZA 3BL5A 3PENA 3PL5A 4K9DA 1Z2EA 1T4DA 4WOJA 4GPAA 4YJ3A 5CJJA 3ONWA 3TTYA 4MKXA 4JLKA 1J33A 3KUDA 4CTKA 5DHTA 3EJWA 3VUFA 4D5EA 3FPFA 3IL2A 3MNFA 2C5HA 3HDTA 2DUWA 1JFLA 1ZOSA 3N2KA 3ZI0A 3O21A 1VLLA 5EFOA 2RKWA 2PTGA 3KKMA 3IH5A 4D6XA 4LJSA 3KHSA 4LY0A 3RC7A 4NBSA 4OX9B 4C3VA 1JR3D 3C6ZA 4RIHA 2NPOA 4YPOA 5IHXA 3DV0B 3R24A 1SHKA 1RZRD 1NVGA 1I33A 2Y0EA 2FJUA 5BSGA 4DQXA 4CIBA 3MMPA 5F9FA 4GZ5A 1EXVA 2Y1LA 1Z6GA 2WM8A 2EP7A 2ZRHA 2TYSB 4NOKA 1KY4A 4PANA 4CG2A 4D0NA 1W6RA 1EFRA 1X7DA 2H5IA 4FJ2A 4XWTA 1MIOB 2VF8A 2VJOA 3F6EX 3TN7A 1G5PA 3W6ZA 1Q95A 3QF7A 5DU2A 3UMJA 5EMLA 4QM6A 4RF5A 3GZNA 3HDJA 3LZ6A 4YMTA 2IY8A 3USES 4RMGA 4RTSA 3RUAA 1QMGA 1ODCA 4HKTA 3JYPA 3MPUA 4TWJA 1Z0FA 1KQOA 1STOA 1KDZA 5B1YA 5BNWA 1TF2A 4WSOA 5FXMA 5KHAA 4OO3A 1Y9JA 1QFXA 4BQIA 4PINA 4Z8YA 1XRSB 3JYHA 2QDXA 3L6EA 4UEKA 2BGWA 1P1RA 3BQ9A 1T8YA 2JAUA 4CTMA 4AD8A 1VL6A 3GEGA 1U7TA 3ON5A 4DXHA 4A6DA 5CNJA 2NO9A 3JU3A 4B3HA 1DSSG 4EYSA 1L5OA 1TD9A 1YR9A 1BE6A 3C3KA 1Z4LA 4EF5A 5DWDA 1XQ9A 2PR2A 5ALFA 1SA0B 1USVA 1VIMA 1X0XA 4O29A 1G8HA 5BR7A 1JEYB 4RGQA 1L4FA 3K1AA 1Q17A 5CEJA 5JS1A 2LNDA 3C5WP 2BE7A 3DHNA 1YWGO 5CCXA 2DY0A 3NDBB 4D97A 4RVUA 2OO5C 2EVWX 4V38A 3UW3A 3VI3B 4DABA 1N0VC 3U3ZA 4ZK2A 5AM3A 1NY5A 2QZ4A 3K9LA 4IRXA 3ESBA 1QORA 1N9GB 2YL2A 3VZBA 1QGUB 1SC9A 3U7GA 3P2MA 3TNFA 2Q1WA 5LZ4A 5KNLA 1KJ8A 2VHQA 3NPAA 5DISB 5LB4A 2RMKA 4AQYB 1G6KA 3W8EA 5HZMA 1A5AB 3L4SO 2WJJA 2O8BB 4P54A 1EVJA 2C84A 4D0RA 2CHFA 4KNVA 2XXAA 4XARA 1XAHA 3AF1A 2V9CA 3FPEA 5CMLA 4C0JA 2C0CA 4X7RA 1NSYA 4CIYA 2GR8A 2CB0A 3KYDB 1OU4A 3OWOA 4IMRA 1GAQA 2ZE8A 3HVUA 3I3SR 3Q2IA 1DAFA 2DUJA 1YHNA 2B92A 1M8FA 3Q87B 4FN5A 3HJGA 1W96A 4G8CA 1KKUA 2YXEA 1TOAA 2A9KA 3A1WA 3UTCA 3D9QX 3KYIB 3PYMA 2Q62A 4PZDA 5H70A 1WIWA 3ITKA 5DE3A 1P6UA 1KY5A 1TI7A 1V8PA 2G5PA 2WJZB 2W00A 1ID1A 3IEPA 3TB4A 1J09A 3ZU6A 1UBJS 4E70A 2BWJA 3C39A 1NI5A 2DFTA 4UJ3A 1SA0A 3NAGA 5EZSA 2YXNA 3OZUA 4GKAA 3ZDRA 1Z13A 1GA6A 3ND9A 1PGOA 4YN3A 3OZBA 4KYVA 1JU9A 3P26A 3NHPA 1EFCA 4YMHA 1EX1A 1G63A 5ADWA 1UBKS 4B2LA 1MHTA 1U2SA 2QX9A 1JYFA 4KQCA 3BUSA 3WRYA 1ND6A 3FDZB 1PSDA 4ER3A 5B58C 1QPBA 4EHBA 3NDIA 3A4VA 4DJDC 3R5XA 5MF6A 3BJMA 3OSZA 5KTPA 5FUMA 3HNOA 2I99A 1QGUA 4AG3A 3WDKA 4RPCA 5CB0A 1EFRD 3AF3A 1FDRA 4YV0A 1C1XB 2RE8A 3DMNA 2WB4A 4GOXA 4URUR 4EGFA 1KVQA 3W5UA 4B3IA 5D3ZA 2I7VA 1RFLA 2O8BA 3IV9A 4LQDA 1LSOA 5T3YA 1NRWA 4JI8B 2DBZA 4JB2A 3DBRB 1IN6A 2X8AA 2ZKIA 3GFTA 2VWQA 1CQWA 1Z18A 1VGRA 3AMVA 4JB0A 5EP1A 3MGBA 1EBFA 1YQTA 3BXGA 4KGZA 3F97A 4TT8A 4W9MC 4OAOA 2PN1A 2ZVQX 1QPGA 2J9YB 1L5VA 5JEDA 3LVQE 2MYNA 3FHLA 5CDTA 4DEVA 2P78A 3DZJA 1XLTC 4AJ9A 4L3VA 2DP4E 4FFWA 2WF9A 3A6DA 2XT6A 3R5FA 2QE7A 1QX3A 4L9AA 3C14C 4LOJA 2BDTA 4HQOA 3HYRA 4IJQA 2CJPA 1JEAA 2NU7B 1V26A 4O4HB 1PG0A 1NPYA 3JAWB 1E2PA 4WKBA 2QKYA 2IYXA 2VDKB 2C2KA 5I7WA 2NM0A 2IPMA 2OHIA 4XQGA 3T3IA 3G8YA 4MCIA 3LP8A 1OU0A 1WZNA 4FW9A 5IJZA 2IH4A 3K1JA 1CUXA 3LY8A 1POXA 1XTRA 1LS6A 5KKNB 1Q0SA 3FDZA 1GU1A 1TRHA 9GPBA 1AC5A 1JRLA 2DBYA 4D3FA 2AR7A 3JYOA 3K09C 3MWEB 1U9IC 4NNOA 2YVUA 4RF3A 2GEFA 3DVSX 1WCIB 3KXDA 4AZ3B 4E1BA 4N5IX 1XQVA 1E6CA 1C1XA 1S7GA 3T95A 3U9LA 5EIBC 3SEFA 2CCJA 4FHCA 3EXHC 1EM6A 2RHGB 2IP2A 3R7WB 1UWVA 5BWLA 1B7GO 5BW0B 3ACDA 4LZWA 3DL4A 5DTRA 4C6HA 1NUQA 3IAEA 4MDHA 3M4ZA 4HDCA 4IFBA 3C70A 2KW5A 3LIPA 2QTBA 3ANSA 1ITZA 4WNAA 4LKRA 4AKSA 2DUMA 4R69A 3D4LA 2YVAA 4PLWA 3AFNA 4AMZA 1V45E 1WW2A 4V0OA 2QU8A 4YGXB 5TNXA 1HFEL 5B7PA 1E18A 4ZI7A 4J90A 2L42A 4JXKA 4MP3A 4N8DA 2IKQA 2I4NA 4G37A 5KVSA 2JCSA 3DFUA 2Y76A 1HMPA 5L3QB 1Y7LA 1ZGJA 3OE1A 3R7DA 4BFXA 2H51A 5E0KB 3LYAA 2DFVA 4RH1A 4DMGA 1AGYA 1A7JA 1UC9A 1CLEA 1KO1A 1KEPA 2EGGA 1KYQA 1QQBA 4I4TF 1JLKA 2O2IA 3MRXA 1Z5WA 4N12A 3ERCA 3GFVA 5CITA 3FVVA 4GX1A 3JYQA 4IM7A 5C7OO 3Q6MA 3AR7A 2DTEA 3IIIA 3I9V6 3EDYA 3H7IA 4QTXA 5HJ7A 1IIBA 5DTIA 4TYPA 4R9RA 3FW1A 1Z12A 2F1JA 1QVAA 1RI4A 2BJWA 3DTVA 1ZDMA 2QQ5A 3MWEA 1XAIA 1JXQA 2O2DA 2R4TA 1VRCA 3O4IA 4URHA 5AOCA 4BXOA 1M33A 2EZTA 2PYIA 1HE1C 1QDUA 2PXAA 3BXFA 1GUYA 2KWIA 2DEUA 3H6HA 3JQBA 3W8NA 2RKBA 1CS0B 2IGBA 4DR3B 4HTFA 4HLDA 3IEXA 1VBNA 3R7WA 3WP0A 1NBME 1K6EA 3ABQB 2OUIA 3BRCA 4YDSA 3V1NA 5EAIA 1NBIA 2W6ZA 1JR6A 3TGLA 1ODTC 3F4KA 4B5KA 1JZSA 1IJBA 1T10A 1V8BA 4EA7A 2HAEA 2IDJA 3TE6A 3LUCA 4ZO9A 5EERA 5KNDH 1E6WA 1Y9AA 4LJYA 4MV6A 3ST7A 4AQ7A 1NW4A 5MN6A 3BIOA 1WABA 1L3CA 2IZ5A 2ZRGA 3FPGA 4C1BA 4LTMA 1FXWA 1T8WA 4PIPA 1ZUWA 1RQLA 3G2QA 1W5BA 4R2JA 1EB8A 5K0CA 2QVGA 3NIGB 4CLXA 2QE7D 4OMDA 2EFCB 5M34A 1QGOA 2WM3A 4P3YA 5IKXA 4DB2A 2BMEA 1Z6ZA 1E61A 4GM1A 4GPZA 4HDAA 5L3QA 1X9IA 3OPXA 4JB8A 4BWFB 3O84A 3WSWA 2VK4A 2ZBFA 5A4KA 2G88A 5F98A 1E7RA 1I1OA 4L6IA 1RP1A 3H9EO 1Z06A 2YXPX 3ZLBA 4B4KA 3GR6A 1LQUA 1U9IA 4IDGA 4RSMA 1VKZA 2G6BA 4A0RA 3ONDA 4CMKA 4ZI3A 4MPRA 1XXHB 2V4UA 4C7KA 4MPJA 4EHHA 3RC8A 1NKVA 1S2GA 1XTJA 3G23A 1ULAA 2PX3A 3KDAA 4M9QA 1IL0A 3AEUB 5E9WA 3RUDA 1SWWA 2HB6A 5FPSA 2V6JA 1SOVA 1DE0A 1GA1A 1OSNA 1L1FA 1P7YA 4BNFA 1E9SA 3HRKA 3SYRA 3UKDA 3GFPA 2JFWA 1GRNA 3CGWA 4TLAA 1CS0A 4M9CA 1RWXA 2F3RA 2YFKA 2ZUCA 5LQDA 4WQMA 3PXAA 5G02A 5JJIA 4UMDA 4IYRA 2LVBA 4M1QA 3EQ8A 1YZTA 4DR5B 1R3UA 1UMDA 5ALOA 2H1IA 3P2JA 4XYMA 3GAZA 5ALDA 2X13A 1RM5A 3GK3A 2HHJA 4RY9A 5PNTA 1PTJA 1USUA 3GFSA 4L9WA 4FHDA 3VZSA 1CX9B 2GVZC 3RLFA 4LFAB 1GCOA 2EX4A 4QU0A 1O6ZA 3OIUA 5AKZA 1WSBA 1ABFA 4JGBA 3ORQA 5FFFA 1SCKA 1TD1A 5EHXA 2OCDA 4WECA 5HK9A 5IBPA 1HFWA 2R6CA 3CRQA 3MRVA 4G84A 3KVVA 4TSFA 4XB2A 1ISHA 4RFSA 5TE9A 3AL0C 3HU3A 3PQFA 4BMSA 1LDNA 2QJFA 3CG0A 4EEXA 4LVCA 5LZ2A 2Z4RA 1G3IA 3RQSA 3WO0A 3BQMB 3NOOA 3ZQJA 3C2QA 4H7JA 5AICA 3DTVD 5EJMA 1DAIA 2DH6A 4N5HX 221PA 3WLAA 4ZVVA 3V9AA 1ANKA 3OIYA 3U4QB 5K03A 1G2PA 1DAKA 3LG2A 3HCPA 3RJZA 2PJDA 5SY4A 3E70C 4TWBA 4EDHA 2BT4A 2XIQA 4E2WA 3TIVA 4HDRA 3F5FA 1ECJA 1XHEA 3KJGA 3LS2A 4FNAA 3S7ZA 3TTVA 2BKVA 3WSVA 1IXSB 3EHEA 5LKAA 3E03A 3I58A 4RGBA 1ZKDA 3COJA 4FWBA 4J8PA 1A27A 4HDKA 5L7WA 4WEQA 3WGJA 1H0SA 1KXZA 5AI8A 3GJSA 5JDCC 1IONA 1XRQA 1IPEA 1F7VA 3P9NA 4ZCLA 4HQNA 3TD9A 2ZOSA 2GCGA 2GJ8A 2OMEA 3I9NA 1U0HC 4WT7A 4DUYB 1NN1A 1OX4B 5KYVA 2BFBA 4GLFA 2ZYSA 2Z08A 3AEYA 3WVNA 1L7VC 2OBFA 3URMA 1G7TA 2ZJFA 2ZUSA 3IVXA 5LJLA 3WGKA 3ZE6A 1TMKA 1MQ8B 1NY6A 4DRZA 3ONNA 2FPOA 2B61A 4DZZA 3I9MA 2G0TA 2RBGA 1M5UA 1SB8A 2BHLA 2HJWA 3DDHA 3BCRA 1KP9A 1U7DA 3FI9A 5H7XA 4C4YA 1TFRA 1N5JA 1T6ZA 2E7ZA 1XZDA 4LUCA 4HZIA 4COOA 2AVDA 4DLXA 1U90A 1H85A 3H1AA 1OFUA 4KQMA 4J9VA 4NQRA 5I7RA 3NQ41 4UCFA 4D8UA 1Y1LA 3EMBA 4YRBA 1ZHOA 1MP0A 2H1HA 1CYEA 4EG1A 1UKEA 2AG8A 2IOFK 3KYBA 3KYJB 4CMHA 4EHLA 4JVLA 2WHYA 3FNIA 3RASA 5EXXA 1E6MA 3PSAA 4GZMA 1BE0A 4M1OA 3ZU3A 4AJEA 1PD0A 2AGVA 4JKYA 1UPAA 3DOCA 3USCS 3UUEA 4KMRA 4KBYA 2GTPA 3PKJA 3C48A 3BF7A 3O4FA 4PM4A 2IHJA 2RHWA 3E0XA 2RH9B 4IO0A 4R5HA 4Z1OA 1BJRE 3L93A 3EMDA 4WK0B 3ZY5A 2K2WA 4IOJA 5I8PA 4XCXA 4X93A 4N40A 4LTNA 1DAPA 2W2KB 4XD2A 3QOYA 4BFUA 3PYLA 5EHZA 4X60A 1PZMA 3RJ5A 3ZH9B 2FZCA 1ORIA 4HB0A 1S0UA 3RTGA 5CBPB 2NLOA 2VZEA 2JEOA 3FIUA 4FE3A 1QRSA 3M5DA 1Q16A 5FI5A 3DOUA 5TVKA 1ULTA 3TRKA 2IC5A 3JASA 1NONA 5E3IA 4LI3X 5LNK1 4XDZA 2R6R1 2CHGA 3B1YA 3VKVA 1PTKA 3DLIA 6PFKA 3ZK7A 4TSFD 2LWIA 3T7SA 2W0SA 4NOLA 2C4WA 4GL4A 2XWSA 2OCXA 3RIXA 1ADJA 4PFJA 5A4MS 4TLDA 3TGWA 1GRRA 1XZNA 3MGGA 1DFIA 2CXHA 5ALSA 2C29D 2HV8A 2IYFA 1ATZA 1I2BA 2YY7A 3N0RA 2PIAA 4PZAA 3GRCA 4XSVA 4KFUA 4MOWA 4AZSA 5C32A 3R5HA 5C1DA 1V43A 3KKLA 3AERB 4M9SA 1DJNA 5HTOA 3VDMA 2PD6A 5E8JA 1S01A 2OUKA 2RC6A 3G6KA 3LECA 4ETNA 4DDTA 5T4EA 1P45A 1EGHA 3JRNA 2YNMA 2WSYB 2VSFA 3EODA 4ASUD 4HVCA 4X8MA 3VU1A 4ZEVA 4WKOA 3AVPA 4FYIA 5GOTA 5I6DA 2Y1KA 1MQAA 2RAVA 4J2OA 5JAZA 1O3YA 2GAJA 2UZAA 3WGYA 2IU4A 3K9HA 1O8CA 3PHLA 3ZXXA 1N92A 1KQFA 4IPTA 5FFNA 2E21A 2FMIA 3NLLA 5LP1A 2WILA 3PGA1 3GL9A 4JYZA 4KGDA 3KL2A 4GMHA 1RW4A 5TEWA 3FKSA 1P9RA 2AMJA 2W2KA 4X3OA 1JJ7A 1IWPB 4RSRA 5CT9A 4G4IA 4UBNA 3WQSB 4BBZA 5K3CA 4EW2A 3GLTA 5CBPA 1GL3A 2R8EA 4FXPA 4DDUA 3GRKA 5L4LA 4RHTA 2I2AA 1QG0A 2K7ZA 5DWVA 4Z0PA 2GZAA 2VOJA 2W6NA 3UWKA 4BEBA 4DEXA 1P2FA 1V8FA 3ASYA 3L8YA 3Q3EA 4ACBA 3OQMA 3G1WA 3NUZA 4WBNB 4MTLA 4J0HA 3LV8A 3A1FA 1F5NA 3EA4A 4C0KA 3DWEX 4L16A 4PGHA 4DPLA 1Q1NA 5HBGA 3AG6A 2O05A 3A9TA 2PA3A 4Q1AA 5JECA 2C04A 4Z99A 4KK3A 3PDIA 2PM8A 2IYSA 4UVEA 5JAQA 4B47A 5LDHA 1AVTA 2Y0BA 2JASA 5GY7A 1BXGB 3RH0A 1E2IA 3CBGA 3ZHRA 2CLFB 1C1DB 4S1OA 2Y6VA 4QYWA 2EFJA 3SQXA 4NDZA 4M0LA 1OBCA 3K92A 1GLNA 4C0SA 3H04A 1DTSA 3NVAA 4PHCA 1ZQ1A 2OEPA 4MB2A 2YXDA 5EMMA 4LMPA 2HL6A 3F1LA 4BN4A 2XRMA 4IUYA 1WUYA 3TFWA 1MT0A 4JBIA 4KVFA 4ZOBA 4DLRA 3HP7A 3ZDFA 4ZHQB 4GZ6A 3VSCA 3ZDCA 3AB3A 3PR3A 5EZ5A 5JYDA 1ZZGA 1FRZA 2GCEA 5L3SB 1RHMA 4NPAA 1ZC3A 5KIAA 5LIRA 1PL8A 3VTAA 4MAFA 4JT2A 1W85A 2GN6A 2ZYTX 4HN2A 1K2WA 4JFRA 4J0CA 3U3OA 1E58A 2Q0XA 2V54A 1MW8X 1JA1A 3QUQA 4L5CA 5KQMA 4MUHA 2CNWA 2WJVA 5FR1A 4RHEA 4KOEC 3AY0A 2CMFA 1EX9A 1WPRA 1OXSC 2GLTA 3OX4A 3O8RA 5CIYA 5BR8B 3JQQA 1M1YA 3QE3A 3VO1A 1VRVA 3DV2A 1JYSA 1ENOA 4P4UA 3W79A 3EOAI 4OSPA 2YJTD 3AL2A 1QP0A 1OI2A 4FX2A 1Z5ZA 1JIKA 4AMGA 2Z2YA 3M9XA 2JJ1A 5FNVF 1HF3A 1Y1PA 2A50A 2B8EA 2E3JA 4MVJH 3CBQA 3I23A 2C2HA 3BYZA 1DQZA 1KYZA 4D9KA 3FWNA 4P2BA 2YNMD 4HQ0A 3O1IC 3IE0A 1XMXA 4U7PB 4W6QA 3PE6A 1RJFA 1XYVA 1CQZA 2V5UA 2VJBA 3DKKA 4A6EA 1NNUA 2BZ0A 4HL6A 5BYKA 3PJFA 5JCXA 5FBRB 2EBHX 1NQXA 1IDOA 2ALJA 2DPXA 4K6KA 2IH5A 4O4JF 3L0CA 3FNBA 4FN4A 1GPDG 5KYNA 1K0FA 5SZJA 1JAIA 2FN3A 3G13A 3O26A 5GM1A 3FLBA 1Z4JA 2DQYA 1F1BA 2R11A 2ESRA 4CG1A 3PEWA 3DEYX 3M1IA 4ZHQA 5IN4A 3ZY2A 1TM4E 3FKSD 4DR2B 2QPLA 5EMNA 4JJKA 2ZJBA 1H6DA 1XJ5A 2EYQA 2XOKA 3PX2A 4OXNA 2NU9B 3KD2A 5JO0A 4FT4A 3HKBB 3C4QA 4B6OA 4OATA 4UUPA 4HJRA 4LC0A 1IB0A 4DWOA 1KWKA 2FW6A 3A6ZA 5TEVA 3IC5A 5LR6A 4CDNA 3D8SA 3FCCA 1FS6A 2C8LA 1B0AA 4MW6A 4WK4B 4D9JA 1IZ0A 4JVMA 2BSXA 5TLSA 1R12A 3QVGB 3SIWA 3QU2A 2FX3A 1Z83A 1ZL2A 3O03A 4RQAA 2JD0A 5AVOA 4D4LA 3W4IA 3EISA 2FFAA 3O2SB 3RUFA 2R8YA 1K6XA 4MS3A 3HWX1 1ORTA 2ETXA 3PX3A 3JYLA 4G41A 4L85A 3V1KA 3WQHA 3VJRA 3QJGA 1UINA 1TIPA 1T8SA 2P91A 4F2PA 4E7OA 1KDVA 4E5MA 2XEXA 5AD1A 1T25A 1XZJA 2NT3A 4MITA 1RC8A 2RGDA 1KMHB 1QOQB 2OR3A 2ORIA 3R7NA 2ZBDA 3ZDXB 4C6SA 4XD7A 4F5DA 1R9JA 3EG9B 5F7JA 1IG0A 4RENA 1NVEA 5A1TA 4ZFNA 1L4UA 2I55A 2AYXA 2FQYA 4HEA1 3OZXA 2ZSIA 1YRQA 1WY7A 1CYDA 3AG5A 1RC1A 3GDWA 3RABA 1RKQA 5LL6P 4URXR 1FLVA 1MTZA 3BTOA 3LC2O 1Y37A 2LGJA 2BEVA 4CM7A 4FILA 4MICA 4TZTA 3I01M 3GJQA 1F9EA 4B34A 4BNLA 4NZYA 1BMQA 5IMSA 3TPZA 2HU7A 1QZ3A 2JFXA 1JQKA 2FMFA 3A06A 5K6TA 3GXBA 3E53A 3HKBA 4I5IA 4PQEA 2HHCA 3SKVA 1UEJA 3I2HA 2CNWD 2HF8A 4ED9A 3AI7A 2C03A 4WK2B 4KIGA 4FFSA 1O7JA 1PW7A 3VSDA 4CV2A 4DUGA 2H4ZA 3THXA 4ZVMA 1C3XA 2ZWAA 3T5GA 2ZXEA 5I4CA 5JASA 4YCAA 1CUUA 1CZNA 1LNZA 2JB9A 3QVGA 8ADHA 1EXWA 4B5LA 4PYOA 4QPZA 4EHFA 5KPJA 2QNIA 4ZI2A 3C5HA 3KBBA 1E9CA 1SCBA 1L5WA 2GPYA 3C6QA 1CQPA 4F4JA 1JXOA 4FT2A 1E9RA 1OIWA 2JJ1D 4IRUB 3X1KA 1D04A 1L8LA 2H11A 4EJ0A 2VPPA 1KSHA 4EL5A 1WETA 2C4UA 3SMQA 5HF6A 4D1YA 4M7WA 4ZT2A 3T9CA 3ZWXA 3V46A 1ULHA 1W8IA 1GVNB 1NR1A 1SQGA 1VPTA 3H2HA 4L6CA 2CW5A 4UTXA 3SEAA 4YT5A 3UMFA 1J8VA 1TCVA 1UFVA 1BWSA 3DNMA 5CAEA 2O59A 2IE8A 3MSXA 4GI1A 2FOLA 3E1KA 3E2PA 4RDIA 1QR2A 5A2QA 1KMHA 1XD8A 1DEOA 1R8YA 3ZTTA 3SR0A 4ZAWA 5JQGB 1M2GA 2SICE 4Q3EA 3TOXA 4OPMA 4ARZA 2AFHB 2CN1A 4UEJA 4YRTA 7ADHA 1VE1A 1LB1B 5ICFA 4Z86A 1PLKA 1SKQA 1HLGA 4JP2A 2XOKD 2AC4A 1XDGA 1YL7A 2B37A 4G0OA 4WAUA 4WZAE 5COQA 5A0FA 3KJXA 4YXWA 1U3DA 4TTIA 1RHJA 2CHVA 1R0YA 1FYEA 3GJRA 4LYGA 2RK6A 3A26A 3M9WA 3HE3A 4LWQA 5KTMA 1AHPA 4GW3A 4ZEMA 5JNUA 2WE7A 1YGYA 1T1JA 1YB1A 2AEMA 1Z38A 3AKEA 3NH6A 2DU8A 4YIKA 1M7BA 5IC6A 2E4UA 1IHPA 1T1RA 5KTRA 5T4FA 4JSYA 4Z4EA 1IE3A 1CUCA 5AM1A 3GU3A 2QGFA 1SVKA 1N78A 1YDFA 2NVWA 1NNSA 5AJYA 2IHVA 1R0LA 4URVR 3I04M 4PY2A 1QCYA 2NZXA 4RHYA 2I71A 2A3RA 3HVKA 3TDNA 4EY3A 5DGHA 3PLRA 2HYIC 2P7IA 2AV6A 4D9BA 2VDRB 4F2DA 2ZB8A 3RWOA 3IPAA 3M4NA 1Q44A 2H1VA 3OG9A 5LXTA 4JT4A 4IVQA 2Z56A 5BQPA 1DT3A 4KKVA 4Q02A 3RIYA 1B2LA 5JJCA 4XD7D 1KYIA 3FZNA 1ZNZA 2RI6A 4UAVA 4B82A 2R6ZA 4O6VA 4Q6BA 4RC9A 4DM3A 3ZS8A 1VPWA 1CTQA 4O5OA 3IKLA 1FFHA 3OCYA 2H4YA 4H7HA 1D6JA 4O4LB 2Q50A 4DQDA 5MDHA 1K9VF 4FR5A 4GKBA 1K3FA 1W34A 2COEA 2WEKA 4EVIA 1ZK2A 5FTNA 4WRRA 4DCCA 4OQQA 2B8WA 5ICGA 4BP1A 3G0DA 2EBFX 5FWYB 4B3SB 1R16A 1X8LA 1I3CA 1UM9B 1J42A 1F6BA 4L3OA 2DBRA 2JBHA 4R31A 5LJIA 1PNQA 3OP4A 1RLOA 1EVKA 1U2TA 3KJEA 3MJVA 3K0KA 4N4AA 3AUAA 4JU9A 3U2QA 3K9WA 1ECGA 2B25A 3PNVA 2OCGA 4KODA 4DUGD 2PS9A 1T26A 1UBTS 3RSGA 3M5PA 5JAUA 4O4IA 4NNJA 3ED1A 5ALKA 5GGXA 3P0EA 1PWXA 4LZZA 4GP9A 2X5NA 4PXSA 3TI7A 4RPIA 3W8DA 3OU7A 2QJOA 4BLTA 3LO5A 2FPLA 2JFGA 3SSAA 3KOOA 1NM5C 3OJLA 3DHEA 2X5JO 3OY2A 1CQXA 4DA9A 3K70D 1E4YA 2CL5A 1AUOA 4G36A 3NB0A 1N1GA 1T8RA 1HKUA 3RIGA 2VC2B 1IXRC 2QZZA 1SGWA 3L8GA 4N5LA 3RUCA 3RU2A 4B8WA 3L9WA 2A84A 4BO8A 5B4TA 3H8JA 2XDWA 3U7HB 1FNNA 2I03A 4PFKA 2GBCA 5L53A 4BUZA 4U2KA 1GL6A 1RBZA 5TT0A 3QLJA 4LEIA 1A9TA 3V2HA 3LXRA 3RAGA 4WNYA 4ARIA 3L8FA 1KMNA 3EGEA 4X7PA 3CPJB 1QWSA 4NVRA 5JNVA 3R0XA 1YL5A 4WACA 5ALIA 5TS2A 1ESNA 2XUGA 4O4LA 4ZT4A 4S04A 3AHDA 3EG5A 3EA5A 3TZKA 2G5ZA 2A9FA 3KU1A 1K3UB 1QYDA 1K5GA 3TQTA 3RV4A 2JBAB 2AW3A 1LJUA 2OESA 3IPCA 4MCHA 3MILA 4YXWD 3KQYA 1Y8CA 5FWYA 2MU1A 1PR4A 1SIOA 2W2XA 4X54A 2G83A 1VPLA 3LQRA 4DCGA 4L2IB 3E9CA 1LQTA 5EHIA 1GGNA 5FO0A 5GM2A 4OQDA 3SK0A 4A91A 3KQNA 3GLIA 2GKOA 2EU8A 3GUCA 1M54A 2ACWA 4GEKA 5JPCA 1FRVA 5JBNA 2CUKA 1GGEA 4MKIA 4GLBA 4JBXA 4YJ2F 2VAVA 1O5TA 3TR6A 4TYWA 2CL0X 4BZZA 4XFDA 4XGKA 2G1PA 1MO2A 4JI5B 4JLNA 3LY7A 1T0IA 3K5HA 3GLFA 4WFIA 3AVQA 4CIWA 1VYUA 4GYWA 1XZPA 3AUUA 3N58A 5CVVA 3ILYA 1ESZA 2P4HX 3GBVA 5FBLB 3VAYA 2F3UA 4H6VA 2HPZA 3WTCA 5ES4B 1NXWA 4RHXA 3ML1A 3VAZA 1Z0DA 1NU8A 1KI2A 1WY5A 2QZ9A 5I5EA 2YYZA 5KYYA 1YFJA 1PVVA 3KPJA 5EWJB 2FX2A 1UADA 1NIJA 1Z56C 1TMGE 1SG6A 2GARA 5CJPA 3AFHA 3K9CA 3PUHA 1DQYA 2LRHA 3H8SA 1L8OA 2WYHA 1YQWA 3B3AA 4Q19A 5CTJA 2B5OA 3TQHA 1BIFA 4ESEA 4CQJA 1FE8A 4LJRA 2VF2A 3EZ9A 2A0XA 1U7UA 1YH3A 2JA2A 3QU9A 5GJBA 5HZKA 4DNFA 2EP8A 2HW8A 2WF8A 4KLAA 3SQDA 2JBAA 4YLGA 4NBRA 4EHAA 4DRYA 1ZVVA 3DF7A 4M1YA 2CLSA 4WD3A 2F3SA 2IL1A 1QB7A 4AP5A 4DBVO 3LRXA 3T5CA 2VZ0A 1MDFA 4ENUA 2ATXA 2PLAA 2RGCA 2X15A 3D1JA 3KEGA 4AN4A 1F8YA 3GDHA 5DOZA 3P4XA 3GZTB 4N82A 1NM5A 3P52A 4YAWA 2I22A 1PJLA 2X0KA 4WKGA 1KO5A 3FOAA 5JI3E 1XELA 1HE4A 1GZSA 2X1HA 4R0MA 4BFZA 5JT1A 2CVPA 2GFHA 1LI4A 1YFZA 5JPDA 3LK7A 4H0CA 2H9IA 4HXGA 1F8XA 2P2SA 1IUNA 2X0RA 3V1YA 1UK9A 3PUZA 5AP9A 3UMMA 1QP4A 3V34A 4LF6B 4ZU3A 3I09A 5HRUA 1RKUA 2RETA 4MGIR 1J4AA 1DADA 3VYWA 3CUKA 4LDZA 3ROZA 2GILA 1US8B 1BEZA 1PN3A 4YT4A 2ID4A 2ICAA 1CW2B 1NR7A 3FRJA 2Y9MB 3KSZO 3B2NA 4FPXA 3EQ6A 3G2LA 1ZCAA 3LLUA 4AK9A 5CVDA 4BU1A 5KQSA 1A8IA 4MV1A 1HPLA 2FG6C 2WU3A 1L1RA 1Q1EA 3PRHA 1MB3A 3EMKA 4HVAA 4P4GA 4V0QA 4BY9E 2O3UA 4YROA 3AHIA 3E15A 2XTJA 5FUXA 1BO6A 2UZ1B 2XVXA 3KP1A 4HRYA 5DVZA 3LWBA 4KPUB 4ZT7A 5JAIA 1ABEA 3DLTA 3SFVA 1NF9A 3FDFA 1R8SA 4P5DA 2GDZA 3G6WA 1G98A 1JDSA 2ORVA 3F8WA 2OXEA 2OOKA 2ZJ8A 2DWUA 3F46A 3OU2A 1MCZA 2ZRFA 1PGNA 1RQ2A 1XZLA 3H5WA 3K53A 3GNTA 3Q5DA 4XIGS 4YACA 2RHHA 5DM2A 5NULA 3DMTC 3PC2A 4M8LA 2JEYA 1VA5A 2WIBA 1SU4A 5IM4F 4A6PA 2PSSA 3L0BA 3R6TA 3D7LA 4Z9XA 4UHFA 5T6BA 3ZR4B 4J1QA 4E07A 3E27A 1LPOA 1QC5A 2RC5A 1E3EA 2GYVA 4JUCA 3LCMA 4REQB 1OYVA 1U65A 4D9NA 5JYBA 2FVYA 4ICIA 1N2SA 2YBEA 2B99A 3K3PA 1J24A 4CV1A 2W2VA 4N7JA 1K7EB 1E79A 1US8A 1M1NA 1R10A 1DLIA 1Z2NX 2PL1A 4FFVA 2CVZA 4M1SA 4P3KA 1EVYA 4XWYA 5F5XA 3EZ6A 1FCJA 4M1EA 4O0MA 3OTIA 4DJAA 3JWEA 3ORRA 1N7JA 3FRHA 4YO7A 5IAAA 1MAAA 1VPDA 4JWKA 1YDWA 4UNQA 1AGXA 1X1TA 4LGVA 4C4TA 4OSEA 3U5TA 1D1PA 3DC2A 1B0PA 5DIFA 2C4KA 2HU5A 4YEDA 3NP7A 5BSUA 3ZZ1A 1NE2A 1SVUA 3PCTA 2WT4A 4RHUA 2E9SA 4DLAA 1S8OA 4II3A 4KPUA 4QVGA 3NVKI 2PRSA 2JKZA 1I7PA 1KI4A 3VFDA 5KJ6A 5H1YA 2E2WA 1ZOOA 3CINA 4J94A 3INTA 3PYXA 1XG5A 3I4CA 1LPPA 5LVAA 1J90A 3AVVA 1E0DA 1OBOA 4B80A 1A1SA 3CMCO 3IAXA 3NJ4A 4IRMA 3QPBA 2P8SA 4RM2A 1EJ6A 1V8DA 2WWHA 2GZMA 1Q91A 1XCLA 1XT6A 3BPSA 4H7KA 4KO3S 2NUTB 5DTMA 1YRLA 1PRYA 3ZY3A 3ZOKA 1U5AA 1WULS 2Q29A 4CFYA 2P65A 3SC3A 4AO8A 1PSZA 4K6FA 2ZROA 4UTVA 2PUFA 3ZJTA 3UJ8A 1SCIA 1TXGA 4HDQB 3PFIA 3K9QO 1YO6A 1N0HA 4INJA 2HQOA 4M7PA 4FGLA 3GRYA 5C46F 2C7RA 5IFKA 1XFDA 1ZSVA 2J0UB 2V0CA 1ADCA 1B6TA 2Z95A 4HX9A 1FB5A 4QEZA 3EFBA 2ZSAA 3NHSA 5HMMA 3TK1A 4TL9A 4DSUA 2ZB7A 1VFNA 3EA0A 5JWOA 2QTLA 5IPFA 2XYVA 1P17A 2HWXA 2E48A 1GZUA 2O2ZA 4MV0A 3DHWC 1UFQA 2MYTA 4OBEA 4KAJA 3LYLA 2B0CA 2P9CA 1RXWA 3Q40A 3RTEA 2VP4A 1EGVB 1MV8A 4R1SA 3K6KA 1KH1A 1QLHA 1YZKA 3F3SA 1XCBA 3NNSA 2PX2A 5IG2A 1HLPA 3DHYA 2Q1YA 1T9GS 1Y63A 1DCMA 1X7YB 1Q11A 2H08A 2YY6A 3DMTA 2GZDA 4DLWA 3H5OA 1EK0A 1Q0QA 3C1OA 3NXSA 4W9RA 2GKGA 4I6GA 4W7SA 3TAXA 3QX8A 2W98A 3HSKA 4G9EA 4BRWA 4YMLA 4R7GA 5LCXA 4B1FA 1SXIA 3B1JA 5DHUA 2IBSA 2X0IA 3P19A 3ZD7A 1U0TA 5C4MA 5IDWA 3L3BA 2GNOA 1ISFA 2QRMA 1AOXA 4RTRA 1X6VA 3TM5A 4EO9A 3PS9A 4OLHA 2NUTA 2PT6A 4B6JA 3T15A 3B6KA 4EY6A 1MOPA 4MLCA 1YUNA 1E79D 1ZXBA 4L5JA 3L1VA 1MVNA 1ONOA 3NUGA 1J0BA 4EKDA 3V2IA 3QGMA 3QMMA 2UYYA 2Q6LA 2CV2A 3KOYA 4V39A 3Q7QA 5DM70 4AI6A 3TFOA 4ZT5A 3UNXA 2J0UA 1D2CA 2GHQA 4Y9UA 4QGAA 4R8LA 4TV9F 5E2IA 4AAYA 4KE9A 3PEYA 1JIVA 5C8YF 4NV3A 3WY9A 5A9TA 4BC0A 2X9LA 1PFUA 3G7SA 4BMXA 3AV0B 3AC0A 4IUBS 2BFWA 2X3UA 3OCXA 1E60A 4N54A 4R9SA 5GPBA 3VR6A 2I8AA 4EJSC 4TTJA 9ATCA 4BO5A 3N8HA 2G0AA 3T1QA 2XCUA 2Y1XA 4KYUA 4K0KB 2FWBA 3RYIB 4LMRA 5B3JA 1W75A 2F2TA 2XNKA 3H1BA 2A9OA 1RWBA 1X7YA 4CIXA 5JXWA 1XNQB 3R75A 3TBHA 2IWHA 1L5FA 2PPLA 3X2FA 4TZ6A 1SUEA 3WKDA 1A4RA 3G9ZA 3T1YB 3RWBA 3RO7A 2Q5EA 4RBNA 1SM4A 4DANA 5BV1A 5T8KC 4C7MA 3CJTA 2JLCA 4HAOA 1U02A 2CHUA 4DL9A 1BC5A 3FVQA 1RSZA 3KKEA 3NP9A 4CVNA 1DRVA 1IOVA 2BRUC 3TUJC 1GPYA 4N7MA 9MHTA 1AV7A 1ZJWA 1IH8A 3NOQA 3TW4A 1S5PA 2QYOA 4KDFA 2C7OA 1YDGA 3OOYA 1SO8A 3KUKA 3O0DA 1P9LA 1W1WA 2NO5A 2PA0A 3P8ZA 2ODPA 2ZQYA 1ARZA 1NG1A 3W8FA 1QG2A 1EK5A 2BEWB 3G5UA 2EQ5A 3QBDA 4QYIA 4KR2A 1XD9A 3CJRA 3E7PA 3G0BA 1WKVA 2HMAA 3PHIA 4I9UA 4PS0A 3B8HA 3SYKA 2H2HA 1LK7A 1ODLA 2QTMA 4L8WB 1U63A 1RXIA 3R76A 2F8SA 2APJA 4I4CA 2PRJA 1RM4A 1HTBA 4H7EA 4OXKA 1UBRS 4ZOAA 1AN9A 5EQFA 1YJBA 4G5HA 3V8EA 4U5XA 4JKOA 3Q0TA 1SQ0A 1A8UA 4FSHA 1KY3A 1YNOA 2Q3MA 5LZ5A 4FUQA 5I9BA 1HOXA 5BO5A 5ARBA 4PICA 3K8YA 3NNDA 3VOBA 1YZHA 3ZYZA 4B4WA 5J2TB 4TZ0A 4RGVA 1H4SA 2ES4A 2JLAA 2QUHA 5AI9A 3C3PA 3A28A 1HNZB 5I7UA 4JITA 1WCWA 5MFZA 3HCAA 5LYJF 4WXPA 4JBWA 4QU5A 5DXFA 2XDYA 4RA6B 2O2YA 1AQIA 1TUBB 2C4TA 4DV5B 4JLWA 3MJFA 4BB5A 2G77B 1U0JA 4YAIA 5AM2A 3G2MA 4AYWA 2XBMA 2ZSHA 2VDUE 1WS6A 1PU2A 2PWZA 4KIJA 1JVSA 2QW8A 4YRDA 3LX6A 1MJNA 1Z34A 3A27A 5ALUA 2FX5A 4CV3A 5DHPA 1RJDA 3N2EA 3BFPA 3U7EB 3IV7A 4IIVA 5EQDA 2ZAIA 2XDAA 3QEBZ 2XBUA 2OAP1 2P9EA 3ZBUA 4F2HA 5EL0A 4JLBA 1SH7A 3JVDA 5IJ0B 3CT4A 1A9PA 3IAS6 4I1VA 1Q77A 1TQ2A 4P3NA 4RMHA 5FTLA 5KS2A 3VR6D 1YIDA 1BOOA 1ETHA 4ID3A 4P4TA 3EVBA 2OKCA 4G1MB 4Q1BA 3KE8A 2ZRNA 2PUGA 5HGXA 3BXXA 1SB9A 3BXHA 2H1FA 1XZCA 5AHRA 2FSSA 1PZNA 3E1SA 2D74A 3HB0A 4B7UA 4FDLA 1PS9A 3AWDA 5BUSA 1RAFA 4QGBA 3VPSA 1YU6A 2I78A 3W9BA 4QJ4A 1G0OA 5T8KA 4TRRA 3RFVA 2WU8A 1HGXA 3R3VA 4NOJA 5JNTA 3VA7A 1VLMA 2Z43A 1EFHA 4H17A 1Q0LA 3HR8A 4JK3A 1VDZA 2HK7A 1D2NA 2BZGA 3Q9UA 4K8OA 2BRUA 5EJIA 4GSLA 1EXMA 3LAWA 4OI4A 4R1QA 2REQA 1N77A 1RZVA 4C0HA 3B6EA 1TUBA 1DL5A 2D1QA 3P5BA 5CT6A 2JZOA 4UMFA 4NQZA 4D98A 2Q8PA 5IRCD 4YFVA 2WVGA 1P1BA 4JOCA 2GN2A 3A9RA 2CD7A 3GD5A 4ITRC 4J3JA 5HF5A 4CE6A 3TW8A 3URKA 4TX1A 3QFHA 3ZWWA 1DXHA 1H2WA 1UZMA 1RHKA 1V8ZA 2EARA 4UBLA 3ZJUA 4MVJF 1I80A 5EJFA 5IULC 1OZHA 1R0WA 3GJXC 1QYWA 2ZDQA 4UZFA 1BQ4A 2PGXA 3HB5X 4TYMA 3TRJA 4RVNA 1RTTA 5DP1A 2X5OA 1F4LA 2C00A 2HRRA 2XLBA 3DT8A 4GMKA 4MW2A 3RKRA 1UIRA 1P4JA 1JSXA 3WLKX 3LX8A 2QLJA 3ZQUA 1QGZA 4LMAA 2WB2A 3JVEA 1ZEJA 4FONA 4L28A 2GCNA