2A86A

Crystal structure of a pantothenate synthetase complexed with amp and beta-alanine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantoate--beta-alanine ligase
publication title Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 92
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a86A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a86A01
3IOBA 4EG8A 5AHWA 4ZCPA 3UK2A 1V47A 4RUKA 2Z09A 4WSOA 2A1UA 2QJOA 3U1VA 2QTNA 3CR8A 1TYDE 4XSVA 3PXUA 5J59A 3FOCA 1TEZA 3Q10A 3SYTA 4ZT7A 4A91A 3ZGZA 3AL0C 2PXHA 2X0KA 3A4IA 5TS2A 1GN8A 4QBTA 1N2BA 4U63A 1NURA 3TNJA 1J20A 3N9IA 3KT8A 4QRDA 1J21A 1H3FA 1WJGA 1J1ZA 1WXGA 2CYBA 3DPIA 4ZT2A 4XFJA 4ZCRA 3A2KA 1OBCA 4ND7A 1F9AA 1ZH6A 4EG5A 2DR2A 3GMIA 3FI0A 4Q16A 1DNPA 2CV2A 4JXZA 1QNFA 3PNYA 4MUFA 3ND5A 3RK1A 2CUZA 3RBAA 5KWVA 3LE8A 2YXNA 2EL7A 2DPLA 3IMEA 1T9GR 3CVYA 2A86A 1T6YA 4KPUB 2QTMA 3OTWA 3CVVA 1TQ8A 4ZCTA 3BL5A 3ZIUA 5DEOA 4NAHA 1QRUA 3ND7A 1XNGA 2J09A 4JYZA 5HUJA 3E27A 3ZJTA 1XNJA 3ELBA 4YMIA 3CVWA 3VGJA 1T6XA 3DO8A 1M83A 3FY4A 5K0TA 3IMCA 2VTBB 3JXEA 1O6BA 4R0NA 1N77A 3CVUA 2DERA 4NAUA 1NUUA 4TS1A 3NV7A 1HYBA 3FNRA 1TYCA 3IODA 3D6UA 4JZYA 1T9GS 4MW9A 2CV0A 1KP2A 1KAQA 1NP7A 3AKZA 3H99A 1YULA 2J08A 1EFPB 1M8KA 5FNZA 4F4HA 1J70A 5FO0A 4ZT6A 1U3CA 1KQPA 2H2AA 2PZBA 1IQUA 4HK4A 2NSYA 2AG6A 1U0BB 3LOQA 4RPIA 4UZFA 1JZQA 1N2IA 2X3FA 3KT0A 5J58A 1I6MA 1NUSA 1R6XA 2J5BA 3CLTD 4EGAA 1O96A 4KR7A 1Y42X 3CLTC 5DASA 3RK0A 5IJXA 3DLAA 4H3SA 3TQIA 2RE8A 4MQ6A 3FDXA 1KR2A 4MUJA 2XRZA 4HJXA 1MB9A 2A1TR 2C5SA 3AG5A 3KFLA 1IVSA 1IHOA 4ZT5A 3Q4GA 1IRXA 1F4LA 3SDBA 2H29A 2QUHA 4DNXA 2E18A 1OBHA 3QTTA 1N3LA 1KH3A 1OWPA 3CLUD 1M1ZA 2A88A 3CLUC 3CVXA 1KQOA 3QTBA 4NDAA 2IP1A 1NUPA 5BNZA 2ZUEA 1MOPA 1J09A 3SZGA 4MW7A 2DXIA 1O96B 3MLAA 1Q19A 3RJZA 2PZAA 1O0CA 4MW6A 1EJ2A 1D2RA 2CYAA 1NUTA 2WSIA 4DE5A 2A7XA 2OV4A 1F7UA 3MUEA 3UOWA 2PIDA 3PRHA 4I6JA 2JAXA 1EXDA 4KPUA 1NI5A 2A1TS 3CLSD 2GOYA 2R5WA 3P0JA 4EG7A 1XJQA 3CLSC 1KP3A 3AFHA 1K4MA 3F3MA 3COZA 2QUJA 3VRHA 3X1JA 1WOYA 2EJCA 4I6GA 1O97D 1R6UA 3HL4A 1O97C 1NSYA 4MWCA 1MBZA 5KCMA 1VBKA 1PFUA 4KR9A 2AKEA 4HJRA 1K92A 4DJAA 2HGZA 1H3EA 4E1AA 1N75A 2ZUFA 2O5RA 2YWBA 2VTBA 2QUKA 4DLPA 2JA2A 1A8HA 3ILVA 1MRZA 2VXOA 3LCJA 2BYTA 1KH1A 1LI5A 4R2LA 3X1KA 5H16A 5TGTA 5JBNA 1P7PA 1QJCA 2DLCX 3FHJA 1GPMA 4P2BA 2PG3A 2OQ2A 4CDNA 1EFPA 2J4DA 1OD6A 1XNHA 2JANA 3P0IA 1KORA 3ZXIA 2E21A 1WY5A 4JFAA 3TS1A 5IHXA 3IVCA 1I2DA 5HG0A 2YWCA 4YP6A 3GLVA 4YP7A 2BTEA 3H9CA 4U8HA 1N78A 4NZPA 4U7JA 3ZUGA 1JGTA 1TYBE 1JHDA 3N05A 1EE1A 3HFJA 1M8FA 1QRTA 4KKVA 1N2HA 3H9BA 5H7XA 2WQ6A 1I6KA 4PBSA 2HZ7A 1OWNA 1Q15A 4ND6A 3IMGA 3HV0A 1FYDA 1G8FA 1M8JA 1VLHA 4S1OA 1IH8A 1MB2A 1H1TA 2O8VA 1WXEA 4MLPA 2X1MA 3NBAA 3Q12A 4NX2A 4MUNA 5DB4A 2V0CA 2D13A 1X8XA 2GKSA 4YBRA 3UY4A 4EG6A 3COYA 3IH5A 5KHAA 3H97A 4AS1A 1S4MA 4DDHA 1PFWA 1CT9A 1JIKA 1NUQA 4MVXA 2J07A 2GM3A 4MVCA 4J76A 2CT8A 1QRSA 2QJFA 4I6EA 1IFXA 2RD2A 1V8FA 2E89A 2DETA 1YIAA 4G5YA 4MWEA 1EFVA 1KAMA 1JEDA 3G59A 1PFVA 1O5TA 1U7DA 1YUMA 3OP1A 3DV2A 3FG9A 1WQ4A 4HPWA 4KR6A 1N2JA 1GTRA 4L2IB 1N2EA 1LI7A 3PNVA 1TYAE 2QUIA 1NZJA 4MUIA 3A05A 3FIUA 4F3RA 1K4KA 3X1MA 4MW0A 4ZCQA 4CQNA 4NATA 2A84A 3INNA 3A04A 1KH2A 2AZXA 4MAFA 1IQRA 4MUHA 1PFYA 3AIIA 1WXFA 1WXHA 1SURA 1JIIA 1OWMA 1PG2A 4MUGA 5HUHA 4MUKA 3RHSA 1ILEA 3K32A 1EFVB 4MVWA 3N8HA 4MWBA 4JXXA 1PG0A 4X0EA 3FH0A 1K97A 2PZ8A 3KT6A 2A4MA 1YI8A 1JEEA 1MAWA 1GZUA 2B7LA 1TFUA 2E0IA 1ZUNA 3MMXA 3P0HA 4K03A 3HGMA 1KKUA 1JIJA 1VL2A 5LFAA 4G6ZA 4YP5A 2QTRA 1YIDA 3IDFA 1O0BA 3QE4A 3G5AA 4OUDB 5F23A 4WNYA 4CT0A 4MW4A 4DDKA 2XRYA 1YUNA 1B6TA 1N2GA 3TQOA 4EG4A 1GAXA 1IQ0A 3L93A 1QTQA 4ZT3A 2TS1A 3D6VA 4ZT4A 1F7VA 3SZ3A 1N2OA 2NZ2A 1M8PA 1FFYA 2A1UB 1X6VA 3SP1A 1WQ3A 2IELA 1R6TA 3NBKA 1JILA 4EG3A 5K0SA 3FWKA 4G5FA 2DUMA 4CDMA 5LLTA 3M5WA 1J1UA 1VBMA 3GUZA 1QU3A 2YY5A 1OWOA 1JZSA 3VU8A 3ND6A 4MW2A 1MAUA 1Q11A 1M8GA 1NYLA 2CSXA 2G36A 1MJHA 3IUBA 4UZEA 4MULA 5TEVA 4EFKA 1T6ZA 4EG1A 4R2MA 1GTSA 1WZ2A 3L92A 5FO1A 4J75A 2I1LA 3HZRA 3HMQA 1BS2A 3TZLA 2CYCA 1O95D 2HMAA 3UMVA 4EF6A 1O95C 2D5BA 1EUYA 4GU5A 4L2IA 1O94D 1ZH0A 3TZEA 1O94C 3ISJA 1UFVA 1WXIA 3CLRD 3ZJUA 4MW1A 3COVA 3CLRC 3ZJVA 4MWDA 4ARIA 2CV1A 2ZP1A 1JECA 3K9WA 5EKDA 2Z3VA 3UC5A 3IOEA 4FZJA 1ZJWA 3IVGA 1GLNA 1G8HA 4K0RA 4PBTA 2CFOA 3SEZA 3G6KA 2DEUA 2D54A 2Z08A 4OJMX 1Q77A 3KT3A 5TEWA 1OWLA 3IUEA 1KQNA 1EUQA 4DDMA 5J5AA 1VBNA 3N2YA 1ULHA 3COWA 1MC1A 1U3DA 1H3NA 2IJGX 3AG6A 4PBRA 2X1LA 1U7XA 4ZCSA 4MVYA 3FETA 4MW5A 2V0GA 3S3TA 3MLBA 3IVXA 1RQGA 1G8GA 1QQTA 1QU2A 1JMVA 4MUEA 4QREA 4XFDA 4BWVA 4GRIA 3SEQA 2WQ7A 2PFSA 3CA8A 1LW7A 3C8ZA 3P52A 4PY2A 4AQ7A 1G59A 2QJTA 3PNBA 4OUDA 3I05A 3ZXSA 1N1DA 4Q93A 4ARCA 3MXTA 3IOCA 1COZA 5DK4A 1I6LA 3H05A 3RFFA 2WB2A 1WKBA 5LM3A
chains in the Genus database with same CATH superfamily
3GJRA 2WYWA 4G4GA 4TWRA 5IZCA 1Q50A 4W63A 5AHWA 3K2QA 1SOUA 4QGSA 3S2GA 3K9GA 4WH0A 2RGAA 5TIIA 2W6CX 2X8BA 2O7QA 3OCCA 2AA3A 2V0NA 3QQPA 3SQWA 3FHOA 4MX8A 5JEDA 3IV7A 1OHHD 3C48A 4AIIA 4LK3A 4NBWA 1QV7A 2W2MA 4OA5A 2PKRA 3CUEF 3SYTA 2Z6AA 4ESOA 5JSQA 5FBZA 2GH1A 2QZ9A 1KMNA 3I9NA 2W2KA 3LBHA 4L9SA 4NMHA 5ESRA 3V8VA 5JARA 1GWNA 4RKRA 2FDRA 1Q1AA 3IEUA 3V4SA 4G26A 5JXJA 3OLQA 3V9AA 4RM2A 4DMKA 3GFRA 4PLWA 2NPIA 3UGJA 5EIHA 1CLEA 1V4BA 3ED1A 1U28C 1EGQA 3LTEA 5FV7A 3T4XA 2FWPA 2DGDA 1M2GA 3BVPA 1M1YB 1YIOA 1ULZA 4GGPA 4HAIA 2GM4A 1PTJA 3HJFA 1LRLA 2QMOA 4IO1A 4K9QA 3H18A 3L77A 4PQGA 1ZJ6A 3B38A 5KC8A 4Q05A 3BORA 2PT5A 3V2IA 1MLDA 1QLJA 4K5QA 1FUUA 1TUEA 4IR7A 4PHCA 5ALTA 3VSDA 5A4MS 3AILA 4P4GA 4KIFA 2BSQA 3DYIA 5ALFA 4YAEA 3AVUA 3RUAA 1D5CA 3LF1A 4QUBA 4QGGA 4LYYA 2FR0A 4J7CA 5JLJA 3F9IA 1PEKE 1DGQA 1Y1SA 4UREA 1XZJA 2FETA 4NCXA 3FKJA 1E3MA 1T2DA 2P6MA 4UHJA 1TUBB 5AW9A 5C9ZA 3M5DA 4PG5A 1FDSA 4TTTS 1G4HA 2W90A 4PANA 4NG5A 2WKSA 3DBLB 2Q5OA 3VH2A 2YOGA 2VUSA 4CNBA 3C2QA 4EEXA 1HGXA 3EC2A 3UWKA 4P80A 3P2JA 3MSXA 5HUJA 4C0HA 2KB0A 5TPWA 3NUQA 3ZWKA 4V0QA 3QITA 3MCVA 1FXWA 3GFBA 4GP6A 4IWYA 4YAUA 1I94B 1W29A 4CT4B 2X4GA 4IEFB 5E6UA 2E87A 4QODA 4UE3S 5IVPA 3DL0A 3W2IA 2JI6A 1O6BA 4CCSA 2I6GA 3N2KA 1HDYA 5HJ2A 1T8UA 2FUG6 3TKLA 5JD3A 3TLGA 5L3ZA 1Z63A 3F49S 1OXUA 2O8NA 4UM7A 5DYNA 4Z9BA 2QM3A 3OCUA 3OOHA 4ILEA 4FLFA 2W0MA 2C7OA 3RYFB 1KRWA 1XDUA 4PS0A 5IVIA 4JLKA 3ORSA 1J70A 2V7BA 4O4JA 5LPNA 1DIBA 4C0LA 3NIBA 4NQRA 3QW2A 1QNLA 4L50A 4U39A 4B1FA 4UPEA 5IEJA 4FGJA 1XPOA 3VYUB 4A6DA 3R9XA 1G20E 2VXBA 4JEHA 3LOQA 1AIPA 1JW9B 4RHEA 1LPBB 2ZFUA 5CK5A 1WZIA 1EI9A 4B87A 4C3UA 2Q6IA 3E7WA 1XFDA 5AM2A 4K1LA 4AYWA 3AL2A 4D92A 3UA0A 3EZGA 4LW8A 5EIBD 1G5PA 2BM8A 2J48A 5L95A 2Q5CA 1S2OA 2PVPA 2XNDD 4QD3A 4YT8A 5JI2E 2D5IA 4XDZA 1J8FA 4H3SA 4QELA 3RRXA 1RMQA 3GFQA 2O2EA 4JI4B 1MDBA 1XEWY 2HJWA 4FLEA 1KR2A 1VG0B 4EZEA 1A4XA 1ZOIA 4QXRA 2XRZA 3Q1LA 2JAQA 2Z9CA 4AC9A 4DLXA 5L7TA 2OR3A 1KR5A 3DMDA 3FGZA 3QMWA 5DM4A 1X1BA 1G17A 2QE6A 3FWPA 4LECA 1NBHA 5DFAA 5K4AA 3U1TA 3WK4A 3MQFA 3IAXA 5IKOA 2H1IA 4U9IS 4F3YA 4MIEA 1H93A 1RAHA 5CDFE 3N58A 5LU8A 2C92A 1WMAA 3GEBA 3UFBA 3GAAA 4XIFA 1CRZA 2H29A 4J1TC 5CXXA 3KM0A 4Q3LA 2ORYA 1OBHA 4DQXA 2QAGB 1G9TA 3PUYA 4QYWA 4N6GA 4F5YA 2NXWA 3EUAA 1PZXA 2YHAA 4JELA 2PZGA 1KI1A 2L69A 1G7CA 2BM0A 3UB2A 1PEAA 4REOA 4CNQA 2JASA 1RRFA 1CF9A 4B47A 2XCIA 1QS0A 4PRKA 4TWIA 2ONJA 4EARA 1OYVA 4MW7A 4DLNA 4TM7A 3LOUA 4H3KB 1BKDR 1N2CB 2RH4A 2ZIEA 2PN1A 3C0KA 3DVSX 2OM6A 3QMVA 5DSXA 1R4ZA 2PZLA 1T2EA 1W1IA 3MD0A 3GVPA 4Z0TA 2F62A 4RPHA 4ZPJA 3WNBA 2OV4A 2C78A 3CW2A 5GOZA 2EGHA 3NWEA 3EXHA 3ZCUA 1KVTA 1Q0SA 2C4NA 3LXMA 3NC0C 4XOUA 4GX5A 3HEMA 5AW0A 4K81B 2R5WA 3KJHA 4WNAB 2HADA 1ISMA 3EXFA 3PC8C 2B4RO 3VRHA 4A82A 2VJBA 3HKCB 1XA3A 4QGBA 4GLLA 3GGDA 1VHDA 1RWXA 4U9UA 5TQ0B 1FRVA 2AYZA 3UZUA 5CYGA 3DWFA 4PTLA 2CFRA 2CLFB 2D0PB 1NSYA 2RHGB 3D7KA 3NNDA 3DB1A 1QFYA 1RWOA 1COWA 3A27A 5JWOA 3EARA 1BCSA 3T5PA 3PVZA 2GK7A 3DHVA 4KQHA 4L8YA 5AK6A 4BZQA 4XUEA 4E1AA 3OY2A 5I7SA 3WLAA 1T5TA 3HB7A 2P90A 1AB5A 5TT0A 5GONF 1FU4A 1JPUA 4PIMA 4EP1A 2YHIA 3GEGA 4H6PA 4MWOA 5LMNB 3K8OE 3PE3A 2OXRA 1C9DB 3SJUA 1HA3A 1MRZA 1I3NA 4CQMA 4EATA 1FSFA 1VPLA 3ZTTA 2AD1A 4Q18A 3Q6NA 4J0EA 1T34A 3UHOA 2XXAB 4Z0PA 3U40A 4A03A 3JCZA 3NHRA 3A4NA 3UW3A 4G1CA 1Z0SA 1DEOA 3UJ9A 4HDKA 2Z3ZA 4P34A 3A8TA 3CX3A 4PAGA 1U0HC 2EHDA 3HMKA 2P6RA 2BDTA 1JAYA 4CM8A 2B9EA 2QRNA 1DJOA 2VA9A 5FNVA 1I1NA 4KE8A 1XROA 4PGMA 3SX0A 4E7OA 4S05A 3QPWA 5EP3A 3WS7A 3DPSA 2C2MA 2RBEA 3B3JA 3C5VA 4JFAA 1IUOA 3IR7A 1GAWA 4TTQA 4X3OA 2CHEA 1CXZA 2OCIA 2AW5A 4C4SA 5J4HA 2PZJA 1CDZA 2JGFA 2DKFA 4ID9A 1UPBA 4JR0A 1FTYA 2BKEA 3DXXA 3A3OA 4X1KB 4GLOA 5DOVA 3MBKA 3PCXA 4HX9A 4EB3A 4HDNA 3ZUGA 4WLEA 3GGPA 5TVKA 1GG9A 2I1WA 1JQ3A 2IX9A 2YMMA 1EE1A 5PNTA 2WAAA 4BO8A 1QG6A 3EIFA 1CP2A 4G0XA 2O0JA 2I65A 4AF7A 1H1LA 2XOKD 2B5WA 4YP7A 2JJ8A 3GNQA 4IOJA 3IMGA 2HN9A 4MWZA 1QVZA 3QUSA 3FOFC 3WV4A 4DWVA 3UJHA 2F3TA 2J7KA 2XR1A 5LCXA 2G5TA 4BLOA 3GGGA 4IXNA 4RDHA 3ZCVA 4CV3A 4UBMA 1KO4A 1R4AA 1EINA 3HUTA 1C9KA 1NW3A 4BLUA 3HZZA 2IH5A 3STVA 1OPRA 3GGSA 3GLIE 5DB4A 4OLFA 5D85A 2GPNA 2ZRAA 3ANLA 1G6HA 4OLJA 5BY2A 3LT4A 1MB0A 5IAGA 3DKPA 2PWBA 2FN3A 3TM4A 2AQ8A 3GT0A 1G5IA 2FN7A 3IMFA 1XGKA 2CLEB 2O20A 2QQEA 4D4HA 2ONCA 3UWOA 2HA6A 4M1EA 2R4QA 2CVHA 3G1WA 1BWQA 3CUKA 5D2CA 2DQYA 3AIOA 1N3IA 3KYDB 2JATA 3UAGA 1S89A 3M5CA 4D9CA 2W2LD 5E4YA 2CT8A 1VRWA 4UBJA 1Q0LA 2F3UA 5IT0A 3RVDA 5A3SA 2DETA 3AVQA 4QBIA 2FDCA 3LSYA 1KGSA 4HB0A 5DBEX 2Z58A 1CY8A 4KYUA 5ESWA 5JW6A 4CG2A 2VL7A 3KZVA 3DBRA 1C8VB 1H1DA 1BQ4A 2H59A 2ZBPA 2GRAA 3BEOA 3QJ5A 5IAJA 3W5UA 2R8ZA 5DN6A 5H80A 1R0LA 1GNLA 2GLUA 2HLHA 1OZFA 3A6EA 1EU1A 2NOAA 5BOVA 4JI6B 5L4NA 4BEWA 4N41A 2WYOA 1PJAA 1L7XA 3WB9A 4OYRA 1NZJA 1VLLA 3C5CA 5FTKA 2QAJA 1TLFA 4CIYA 3ADDA 2EFJA 2Z1MA 3NM6B 4MCHA 1L5FA 3C7TA 1CUCA 2JEZA 2OQRA 2D3WA 2RBKA 2D1RA 3H3FA 1CUFA 1GUAA 4PGAA 4Q3KA 1XTQA 2C88A 5BUQA 2BDUA 4E0BA 1ZCFA 3JQ8A 1P4HA 4Q00A 2W48A 3GH1A 4YT2A 2BGLA 2CLKB 2LRHA 1Z4NA 3DTVD 1H6DA 4R2WA 2J7PD 1IZYA 3UB4A 4F2DA 1MJGA 4C7OB 4EGJA 2AEFA 3ZDEA 4K26A 2FPUA 4I9FA 5I45A 3U6BA 3MJFA 3WFIA 3ZCXA 4C29A 3JASA 3NIFB 1NW8A 1MABB 1FRNA 2P2NA 3LYHA 4ZOCA 1RPAA 3WL7A 3D6AA 1T3LA 3THXB 4IF4A 1VIVA 3GFOA 2HBRA 2P30A 2Q6OA 3DNMA 3LWBA 3H4IA 3GR6A 1VLQA 1C7FA 1QANA 5U4QA 3WQBA 4M76B 5AW4A 5BT9A 1Q7GA 2FX5A 1KXJA 1ODJA 1SVLA 2FW8A 2ZCUA 3K0FA 4W5HA 4EK9A 4PIPA 4Q4CA 4ND2A 3U1BA 1JS1X 1QE5A 2GZAA 1QG0A 2OYRA 4D81A 1IZ9A 1FXWF 1QJ4A 3QZUA 2PUEA 2LD4A 2GZMA 3PR1A 4PE5B 2OBMA 2R86A 3PD1A 3PITA 4LY6A 1S2DA 2V7GA 1YKSA 4RF3A 2O4UX 1QB8A 2IS6A 3EMDA 1PZNA 2BUAA 2ZI5A 3ASUA 4LV8B 4I7EA 4JVSB 3TM5A 3AT1A 3U31A 3FB4A 4ZHQA 1GGVA 1VFPA 5K99A 4CCYB 4IG9A 4M7RA 1K8QA 5FI0B 3B9BA 3LO8A 4AWAA 3N2GB 5F2EA 4RHYA 3SM3A 2XWBF 4JLWA 2R3SA 2AI2A 5LP6C 1EDDA 1KZ1A 1WD7A 4M22A 1PLLA 1I5EA 4ZU3A 2IYAA 1QHXA 1X7ZB 3DV0B 1T9CA 2IXGA 3V34A 2WG1A 3VZQA 4O4JF 4BQFA 3ETJA 1NQVA 1JR3D 4QFDA 4P54A 2FCAA 1GSIA 2WJAA 5LUBA 2R2AA 1QGUA 3A10A 2HXYA 5DXAA 2OORC 4D4KA 3K8QA 1RZRD 1OB2A 3TX2A 1GNPA 1GADO 1TJ5A 2XYVA 3NBKA 3AUKA 4RHTA 2DUMA 2ZVPX 3S29A 5AJZA 5CT4A 1USUA 2ZYVX 2NUAB 4P5EA 1NXWA 2ZAOA 1J2RA 1K5GA 5HM6A 3TN7A 3H19A 5FWDA 3SMVA 2OHVA 3C87A 3T7AA 4URZR 3EA0A 3KKKA 1NW6A 1VJGA 3DZKA 4BFWA 4F45A 3M6VA 5C52B 4KWCA 3NG1A 5TGDA 1R0SA 5FV4A 1IRIA 2RHDA 1UT8A 3HJUA 2HBZA 2QTWB 5B2EA 3E4DA 5IAEA 1NNLA 1FDTA 1FFCA 4YRLA 4R2MA 1AUXA 2IUEA 3BQ9A 1USKA 3MUOA 4QU5A 5ALIA 3OCJA 2FR8A 3NR2A 3K6SB 2G76A 2JK1A 5DO9A 4EF6A 2Q6KA 3QI7A 1KQGA 1K8XB 3OCVA 1JDNA 5CBKA 2VTKA 3B89A 3HSYA 3WQRA 2G5PA 4KPYA 5H9VA 1CV2A 3SHWA 4Q7EA 2VDKB 3T7IA 3AC0A 5A2QA 3OZTA 3OUTA 3PUWA 1FL9A 1ENPA 1N5MA 3AX6A 5EWMA 3UHJA 4U7DA 1N7HA 4REMA 4Q1CA 4RE5A 4KNWA 2HA0A 2HCRA 4MINA 2Z3VA 4BMPB 2FP3A 3LUKA 4MVJG 3FOZA 1ZJWA 3ASZA 1LI4A 3ACCA 1M5RA 1THTA 3LA8A 3RNOA 1E92A 1O8CA 3IC5A 3NXSA 2JF0A 3MYRA 3TDMA 2UZ1A 2UVPA 2QTBA 2O0HA 3GZJA 3HBLA 3KT3A 4A3SA 4ISCA 1XVLA 3TNYA 3TEJA 1FFXA 2B8JA 4HADA 1VBNA 4M0UA 5DGTA 1EUQA 5E7MA 5TQJA 3L4JA 1ZHFA 1CUGA 2ROQA 3PZRA 4W8HA 4EKNB 4D8XA 1O9GA 1U3DA 2OE2A 3GUUA 1I7DA 2I2CA 1TMGE 1D09A 1E3IA 3PIDA 1I14A 4FMPA 5IUJC 5C1BA 3Q3JB 4AZVA 3NRBA 4FP9A 3Q7PA 1YQWA 1RQGA 3LBAA 1RRCA 2AIRA 3ABZA 4G36A 3PFIA 2Q2WA 4ARAA 3NT5A 2GF9A 4GRIA 1GA1A 2XXJA 4HMPA 1XOIA 3O3NB 3PSAA 4UE6A 1MG0A 2IDZA 1WW8A 3B1JA 3WDMA 2OGTA 4N3CA 2XA1A 3I34X 3CHYA 4WCFC 1R3DA 1GZ5A 2V7EA 2WEKA 4ECAA 1JIQA 1V71A 1N1DA 4MI3A 4JI7B 4ARCA 2YFHA 2N1MA 1COZA 1RYDA 1Y34E 1M1YA 2NZ8A 2P0YA 2QD1A 1IB0A 1OBVA 1PGPA 2XV1A 3EQ2A 4PFJA 2P79A 3ZS8A 1W25A 1NN1A 1XDZA 3JD0A 1ZHOA 2ZETA 2H52A 3R7FA 5IANA 4DXAA 3TEMA 3DKRA 4MP6A 4QYSA 1WO8A 3NWPA 4R2JA 3PF8A 1RPZA 4KQ6A 1SC6A 3O92A 1DV1A 3MT0A 3SHOA 4UOZA 1CZOA 2VQEB 1AKMA 3L6UA 3NOQA 4MUYA 2CBXA 4J2HA 2IEDA 4GF5A 4FC7A 4MI1A 4DLBA 4F12A 3FOCA 3NJ4A 4M0PA 4BNDB 2JZCA 1FQJA 3GPDG 4ZT7A 5SY9A 1TQ6A 3DCIA 2WDPA 3EW7A 5HFNA 4HZIA 6LDHA 3KQKA 3KQNA 3PQ8A 1SHUX 1J07A 2JCVA 2QI9C 3H6HA 1PJ3A 2ICAA 1K88A 3GGOA 4UZSA 5JS7A 1TCBA 4B45A 5EXDA 2B4AA 5BN3A 4F9TA 3W5VA 3NRJA 1C5KA 1M6VB 3DBLA 4HRAA 4MQFA 4TYQA 1WXGA 3HABA 4WPGA 4PNHA 3W5JA 3M49A 2WMOB 3B82A 4MV3A 2WRZA 4A0SA 2OPBA 2C77A 2RK3A 4RIEA 1EYZA 4RGYA 2IUYA 1OROA 4FDAA 3KYIB 3HCWA 2O0KA 4V3BA 5AI6A 1V2HE 3UFXB 4JXZA 4J0GA 4HDMA 3OT1B 2A33A 4IS2A 1YR2A 5FOTA 1NSFA 2CDCA 4EYOA 3BTVA 4BCDA 1V96A 2JGDA 3NQ41 1OOEA 3NBMA 1Q0HA 3LGSA 4XB6B 1TCCA 3WAKA 5JZ9A 2HT1A 2EGUA 5EE1A 1JYSA 2AFIA 4Y1GA 1K27A 2NM0A 3GRRA 2ACKA 5K0ZA 3CVYA 4JCCA 3L7DA 1U65A 3IKLA 2OZLA 5JCOA 1VIDA 1GLGA 1NYQA 1JTEA 2OLKA 3NO4A 1B0UA 1YK1A 1L5RA 2F1OA 4FOLA 3OZWA 1OGIA 3NGXA 3OWHA 3RYHB 1RLUA 4I3FA 4ZI5A 3HDVA 4OK5A 3GLHE 2A0YA 4GNRA 3PQ6A 3CN9A 1Q83A 2PKXA 3O7WA 3UMRA 1ODTC 1X42A 1RVV1 2DWPA 3CW9A 4KQ1A 3VYWA 5B7PA 3PPWA 1KYIA 1M33A 2V6JA 1X74A 1KOLA 2D2XA 1U0GA 2WDZA 3KEOA 5DYIA 3X2EA 3IE1A 2I9KA 3P9SA 3SXUB 1LRKA 3IT3A 1JEYA 2ZR9A 5CVJA 3EZ7A 4TS1A 1A27A 4D8WA 4E3WA 1WP9A 2X0IA 5IJ9A 5BWLA 2P9EA 1W59A 2NX2A 1TYCA 1JNXX 1WHTA 4FHFA 5CX1B 1VSVA 5CXQA 5TQ0A 1WDKA 4YCLA 2CFIA 5JJLA 4DT1B 1KAQA 1QP8A 2ZSBA 4JQOA 4KWHA 4MZDA 3EPLA 1RWQA 3MZ0A 1TA9A 2CUTA 5FNZA 5EJ5A 4F85A 3W6PA 5IPFA 4F56A 3SDZA 1U2EA 5AKGA 4BFVA 1D2NA 5FUBA 1EHYA 3TD2A 4LCBA 2P3SA 1OIXA 4KH0A 3DHEA 3LUDA 4M60A 4AICA 1HR0B 4WQMA 4Q1BA 1W34A 2AFVA 4BPBA 5AW1A 3CKYA 2HPAA 2O2ZA 3VNQA 4B34A 3B3QA 2ZDGA 4U2CA 1N2IA 3GJ8A 4O08A 1ISPA 3AVXA 5ILOA 3PJRA 1LS1A 4MQ4A 4LGYA 2JDID 4P9NA 4AKEA 3ZHTA 3MGKA 3CR3C 1JL3A 1L5MA 2ZJ2A 3DZHA 2ECFA 3IVMA 2FQWA 1V6CA 4I1RA 4ITVA 4IQGA 4TLAA 3B51X 4DV0B 4I5EA 2H0RA 3ITNA 3ZE0B 2GZHA 4I1PA 2J3DA 5CYPA 4KWTA 3KQQA 2QZPA 5E9JA 3JVDA 4CMGA 2ZBVA 4WNAA 2FK7A 1YFKA 3SQDA 5JI3E 2MSNA 3HKCA 5LB4A 1USIA 3U62A 2FK8A 4GO1A 1R5BA 1U7TA 4PLHA 1ECJA 3RVQA 3IP3A 3UTDA 1T5IA 2P6NA 4ZHQF 1ZCJA 3P4UA 4AECA 1JG2A 1NKTA 3I1IA 2AC7A 3D6TB 4NDAA 1S2GA 4JI0B 1E1NA 5I7FA 1ZU4A 2MU1A 3KZMA 4QQKA 2ZUEA 4MRNA 1RRKA 1UQTA 1W76A 4J8PA 4XCVA 4C7JA 2WWTA 3DUWA 5H4HA 4BFYA 4MLDA 4IH9A 3MGBA 1PJLA 3C14C 4ES6A 1J8YF 2QRHA 1FSZA 3OEHD 4LOKA 1CR1A 1QBGA 3VTZA 2BLNA 4ZMBA 3TECE 1DC3A 1G8MA 1N5LA 2Q3LA 3U2QA 4M21A 5JNSA 4EA8A 2I6XA 3FXAA 2VC2B 4UTOA 2GPTA 2I03A 4B83A 2RAPA 4M87A 4R98A 1YS7A 2LZ0A 3OO0A 2PV0A 3RYTC 3LHSA 4HY3A 2BAGA 1KZGB 1Z4QA 2YWFA 3CZ5A 4EPVA 4XWWA 1HK7A 4C4OA 2QROA 4NENA 1E1KA 3DEAA 4ZJUA 1R0XA 4WVFA 1T9BA 4M83A 1J9ZA 3VR3D 4AMZA 2HJRA 3NYWA 1UP4A 3HRIA 1M5UA 2BMJA 4CDRA 1RR6A 4MWCA 3QKTA 3A1EA 2ISSD 3IAHA 4RPLA 3TEFA 2IL1A 2EOAA 2XQKA 1YBMA 2HGZA 4D9KA 1M34A 5K4HA 1Z6TA 1UL1X 2DZDA 4QJIA 2QU8A 4RA6B 2G2SA 3F78A 1B43A 1V1MB 1G38A 1VE3A 2QUKA 3AW8A 4GT1A 4IDNA 2IIPA 1O95A 5H3HA 4YRZA 1MJ5A 5FPKA 4HWSA 4QU8A 5AT1A 3BWXA 4N01A 1TKAA 5DNEA 2ARKA 3GHHA 5G0WA 4QECA 2YCLA 1QHHA 3B2QA 3OKPA 3KJXA 2ZYDA 1ZM3A 1FMJA 3NX4A 1X3LA 4HF7A 3DZGA 3JZIA 4RETA 3ISVA 3KOYA 5KC9A 4KN8A 2ZUTA 2PGXA 2G4CA 2BCJQ 3A37A 1GGMA 1YMUA 3AESB 4FGSA 4WMLA 3SQMA 3W5SA 2VAPA 3DMTA 4JFRA 5CB4A 1Q17A 1GAJA 1Q3HA 2OCYC 4HQKA 2QLMA 4NBTA 5COBA 1RU3A 5EXCA 2E4UA 4ZVQA 1VPWA 3MTQA 3WLQA 2BEVA 1EFLA 3VR2D 4LVCA 2WF9A 3LQ1A 1P75A 2IF0A 3G9XA 4UM5A 3RTDA 5BRAA 4ZI2A 1KZ4A 1M7HA 3VJMA 1BS9A 3GLVA 1W9HA 1PV4A 2EZ4A 2PUWA 3BXOA 3P5SA 1JHDA 1H65A 3ZV4A 5IAAA 3E7PA 4WJKB 1KMCA 1HL7A 3FPFA 3N74A 1UUFA 2PWPA 2X76A 4OB7A 1NN5A 1KJZA 1RHKA 4PIVA 4CKXA 1GCGA 4CTMA 1F6WA 1I6KA 2ISCA 3HSKA 4GUAA 4PBSA 1Q15A 1S5PA 1NLUA 2ZWPA 1HNZB 3F5MA 1E1YA 1G4AE 4RVGA 3UPUA 2Y0PA 1FJ2A 1QRRA 2VQ6A 3SR4A 1P77A 2H92A 4AJHA 4GSYA 4JROA 3HYRA 4R01A 5BN5B 2VXYA 3L0SA 4RA9B 3RHTA 5AM3A 3JWIA 3HGTA 5GGXA 3RVMA 2XWJI 3UTCA 3K9BA 2I2BA 1T0BA 4MLZA 1U80A 4NX2A 5FAXA 4FW9A 4ZYLA 4QHYA 4PV7A 3UUEA 4OXYA 2NU7A 2D13A 2OHJA 3GDHA 1KJ9A 2CVFA 1CNEA 2FWIA 2L18A 2HF8A 1FSPA 2JLBA 4AKSA 5AOCA 2FZ4A 1RPTA 2ZKIA 5E3JA 1QAQA 2FOXA 1N5IA 3FSEA 3U44A 4JBYA 2C9YA 1XAJA 3IH5A 4WZBB 3RC1A 4WBNF 4L02A 1HT0A 4BB0A 1IEWA 5HGXA 2OB2A 4LS3A 1L5KA 2D2EA 3O91A 2QRQA 4MDFA 2G5ZA 2CWDA 2HX1A 3D5TA 3OP4A 1E1RD 4W5RA 1X7HA 1XKXA 2PRKA 4LXGA 1RVDA 3DO6A 2NWQA 5BXQC 2C94A 4J07A 4RS3A 1WTAA 5C4GB 3KO8A 1ZEJA 1CKEA 5AUOB 2JGNA 4C7OA 4TV8A 1ZVKA 4P98A 4WFIA 1MABA 2G0NA 2O9JA 3I9KA 1E3QA 3MTDA 5BSHA 1JEDA 1B14A 2GPBA 2JZOA 1F8FA 1VDZA 4IRUB 3LP6A 3OP1A 4BO7A 3I3SR 4IYRA 2OAEA 4MWGA 1E79D 1Z2OX 1M2OB 4QJBA 2UVQA 3ZZTA 2GCNA 3SS7X 4GSLA 5ARDA 4OM7A 2R6DA 2YN2A 3K8YA 2DFPA 4PEVA 3X2FA 3BGVA 1ZN8A 5AMXA 3PUJA 3HDHA 2PWAA 5IVKA 1MT0A 4KWEA 4BMZA 5AVRA 4DXHA 4W5WA 5KWJA 3VR4H 2GN6A 3INNA 1U3TA 3IEKA 1NJ5A 4CLOA 3CFYA 3I73A 4BKQA 2NO0A 1OBOA 2I80A 5CFZA 1WXHA 2Y1GA 2GZDA 1OWMA 3SJBA 4MQEA 2PVSA 2CUKA 3H86A 2DT8A 3PL1A 1UPUA 3N2GA 3MILA 1M75A 4RDIA 1K66A 2AD5A 1G0OA 4JLSA 4MVWA 5EMJA 2ZRCA 1DAMA 2IXBA 3H8WA 3QEAZ 3BDIA 4AT1A 1Y4DE 1X7ZA 4WBXC 4I9HA 4RTRA 5FEUA 4BV9A 5JSUA 4B35A 2WSYB 4DV2B 4AJKA 5EKXA 4EAQA 1KOGA 3PJFA 5KWEA 1AO0A 1RE0A 3CKKA 2X8JB 1MAWA 1EQUA 4J1QA 3CZMA 4K87A 5FA5A 1M73E 3ME5A 4X7MA 5MGBA 2XF2A 4ALLA 5AVOA 1GKKA 2AT1A 2ZZKA 4KODA 5K8VA 1KVSA 1Q22A 1U7WA 2NUAA 1PHRA 3PDIB 3WICA 4FBMA 1YZLA 4ZOBA 5EJEA 3HYNA 1OFUX 3C3EA 1GDHA 3JSXA 4HPXB 4LYDA 4ZAWA 1XRSB 1H2AS 1BX0A 4MAMA 1W4AA 4A6EA 4NV3A 3CKMA 4IIXA 1JYEA 3DVQX 2BRUC 1W85A 2C84A 3U4QA 1AGYA 1EK5A 1VE5A 3BGSA 1ZA2A 1Z0ZA 4RO0A 3L93A 1WM1A 1LTHR 2QIPA 1JVNA 1KSHA 1L5VA 3LC7O 4MIYA 5FBWB 4V1CB 1DAGA 5HF9A 3ZOZA 1C81A 3HS3A 1SVUA 1DIOB 2CXPA 3C4QA 2V4ZA 3K6SA 5FULA 4OAPA 1PE0A 5DBIA 3WRXC 3FCSB 4YVFA 1R6TA 1XWIA 4IFBA 4ILKA 5AHRA 5ETJA 4Y6QA 1Y82A 4P4LA 4II3A 1SB9A 3TL2A 5K0SA 5LL6P 4G5FA 1B76A 1DKUA 1P1RA 3KQYA 4FXOA 4QTUB 2FUNB 1GV1A 4IX1A 5CJJA 4YJ2B 4Z53A 2HMTA 3V3TA 3H13A 1RRVA 3A25A 3GRAA 3LK6A 3MTEA 4N9WA 1SZJG 1W73A 3CMMA 2ZR7A 3PCRB 3VU3A 5L3SB 2XX3A 1ZI8A 3IO3A 4Y2JA 5SYAA 2BGMA 4MUXA 4NBNA 2WWFA 2XA2A 2XZLA 4BVBA 1DMRA 4AJEA 3HYLA 5H81A 4NU5A 4JUIA 3V1NA 2UUOA 4O59O 3PK0A 4N0DA 2J9RA 1M7BA 3DJYA 1MJHA 2CDNA 3DP7A 4LOIA 1OV4A 3ELDA 3EGWA 2QMUA 1YL7A 4J9UE 4RY2A 1T6ZA 5DLDA 1YJAA 2QAIA 3B5IA 4E5PA 7GPBA 1ZN9A 3EQ9A 4KBGA 1AMUA 1VE7A 3WNDA 2RGCA 4E6EA 3ENNA 5TF0A 2IYEA 1A9QA 1SVKA 3A4TA 3JQAD 3S5UA 4IDDA 3Q7RA 1N5OX 2OO3A 2W43A 1HEUA 4JVNA 3T5MA 3ETHA 5CPFA 4GVPA 3ZJVA 2QYOA 3PNOA 1G3RA 3N5CA 1MO6A 1T2FA 1YBAA 3BD8A 4IINA 5ALLA 3AM5A 1GRNA 3GYGA 1E7MA 3I6YA 4TLMB 3U09A 4XLZA 4NLLA 3WFJA 1UJ4A 5EPUA 3VAAA 1BC5A 1Y5NA 4CKCB 5BWBA 2GK4A 3HB5X 5F73A 5JE8A 3B1KA 4PBTA 1R1DA 4DA6A 3IT1A 4AN4A 2QLFA 2YS7A 4M8LA 5I48A 3V1KA 1E5LA 5GM2A 3TR0A 2QLBA 2PD6A 3I61A 2ECPA 3RI3A 2FXIA 1TZJA 3SKVA 3J80A 2J0QA 4HNQA 2ZBUA 2VBFA 4V0RA 3OFNA 2YY7A 4AJOA 4ERXA 1VHTA 2QLJA 3OFSA 2O8FA 1E2IA 2VF8A 3GD7A 4I99A 2Y6VA 2ZT6A 3H1PA 3T3DA 1FDIA 2VP2A 1UBMS 2FMXA 2WJZB 3GRUA 2JCGA 5FLXA 4DB4A 1CZUA 4EQZA 2PAFA 1KZHA 4TXHA 1ZW1A 4AWXA 4BNDA 4ZVNA 2R85A 2X3UA 1XU4A 1U0TA 4N65A 2YJGA 4LAFA 3EF1A 4C6SA 1LW7A 1TAHA 3MUNA 3OAAD 1ZK3A 3VKUA 1DBVO 4YA6A 4UDYX 4CKYA 2ZYTX 3FX2A 2QU7A 1TF7A 3UA3A 2HU2A 1KJQA 5JAIA 4TTVA 2XCSB 4Q9HA 2UV8A 3R3ZA 3U3XA 1XDWA 2FPPB 2ODTX 5BYAA 1DFHA 2AW3A 1RMTA 2FSVC 1GGJA 3EDCA 4KE7A 4F3KA 4F4DA 4MKGA 4PYIA 4R3UC 4J6FA 5C5IA 4P4NA 4G5SA 3CSSA 3INTA 3NMUF 1YQTA 3WLHA 3WLSA 5DHSA 4CLHA 2HQOA 1MOQA 5CB4F 3A4LA 4R54A 4U0JA 3T0IA 4PLTA 1STOA 1RWPA 4G0PA 4MRPA 3S1LA 3MGAA 3TLEA 5AOAA 4FEGA 4WBSA 4YLGA 2V97A 1MOZA 4O4LB 3ZJYA 1SKYB 2E4XA 2XE7A 4FJ1A 1E77A 1YRBA 3C8HA 1NQAO 4D26A 1LQ2A 2QVXX 4JVMA 4P83A 3SSOA 3Q2KA 4FKZA 4W9NA 3PUZA 4RTNA 1W46A 4L76A 3CZQA 1Q6ZA 3LDHA 3I04M 1FNMA 1HZZC 5KTPA 5U9CA 3B3FA 3P2KA 4UBKA 2PSDA 1OFVA 1R9GA 2FEAA 3BBPA 3D31A 2PSJA 1GO2A 2RARA 1H3FA 1FP4B 2CYBA 2XDQB 3N1UA 3UG6A 2WHEA 4ZARA 1ZD5A 2BKUA 4BBAA 5IX8A 1TD1A 1JA0A 1YOVA 4UMVA 1ZGAA 4IIDA 3ESQA 1Z8DA 4BGEA 4P32A 4M1OA 4EG5A 1L8XA 3WIBA 1ZCAA 3GMIA 4FOPA 4PTZA 4ZVMA 3BXPA 4IGFA 1ZZEA 1MRSA 1WUHS 2JCXA 3GNLA 4KAAA 3F7NA 4HWPA 5DX0A 1I2MA 1P0CA 2HJVA 3EMVA 4JQYA 4AUKA 1M0EA 1JKJB 1TO1E 3CINA 3KLOA 4BZZA 3DZFA 3VJRA 1KJ8A 2WR8A 3R7SA 1GM5A 4K6KA 1E7YA 1GL9B 3FMVA 2YQ5A 3KOMA 1P0FA 3K8ZA 1TVMA 3M33A 3K0BA 5K0EA 1KGDA 3B1YA 5JVDA 1PYDA 2BIFA 3J81k 4FMBB 1XRJA 4DM3A 4F4IA 1WTCA 3RU9A 3VOTA 1JLRA 2M98A 5DXFA 4CU5A 3GWGA 2J3LA 1JH8A 3I5MA 4OCZA 1L9KA 4RHUA 1WW2A 4R1MA 3R41A 1UINA 1ZAKA 1RYNA 5F12A 1WL8A 1ZG3A 3ETCA 1KK3A 1TLLA 2WZCA 1PQYA 3FYHA 1HG0A 2ZSJA 3ON5A 1AOXA 1EXNA 3B20A 3MJTA 4RVOA 5T6MA 4TV8F 2BFEB 4EVQA 3ZCTA 1NHWA 1CBUA 3FLEA 4DBZA 3L82B 3ZZUA 1AKUA 4IIJB 1OH6A 3EDOA 1U04A 4YJKA 3T1VA 2W7TA 3QVKA 4CTJA 1V5WA 1C9YA 4E94A 3PKJA 3WK7A 2XEXA 5EJ8A 3W0LB 2ZYUX 3FTDA 3EX7C 4FWTA 1VJRA 1USGA 1UMKA 1FYVA 1OYOA 4I1IA 5C2JB 1EFPB 1M8KA 3DOCA 1X19A 3GEHA 4BLWA 2KE5A 4MH0R 3NH9A 3GQBB 5KYYA 1EAMA 5KTRA 1M6HA 5IULC 3AHIA 3SF8B 2XBMA 5GGYA 3Q9UA 4ZK2A 2Q1UA 4DZRA 1WCYA 1VA4A 2XUIA 1DB3A 2NSYA 2EAUA 1ZXLA 3GLUA 3E3OA 1D1TA 4KDFA 3RYIB 1VTKA 1YK0A 1BXZA 4I8DA 3UAVA 5HRCA 5IM4A 1M1YE 1QPZA 1A95A 2IV7A 3HXPA 1GNVA 4R8RA 3PDCA 2ATCA 3CLTC 3RK0A 1GY8A 1ORIA 1HFKA 3QBJA 3UPTA 5ANRB 5AFSA 5CD9A 4TTJA 4B3GA 1TW2A 1TU0A 3G0OA 2IE8A 1VI6A 1P33A 2BHSA 4I50A 4OHFA 5H0IA 3WKDA 1W0JA 3HO1A 3VA7A 4FSHA 1YDWA 4L95C 2O3JA 1V3TA 3BA6A 1OT3A 3HA7A 1M72A 2A5FA 1XDGA 3A32A 3HCAA 3KB2A 4OOFA 4OQMA 3S0JA 3ZE6A 4ALKA 4F91B 3KVYA 1MORA 2CJWB 2IYSA 2Q4BA 1GIAA 3ESXA 1OY1A 1V5IA 2XNSA 3LO5A 4FQ8A 4EM6A 2E18A 4TQ9A 2Y1KA 3SEFA 4F8EA 2HA2A 1RTTA 2GD0A 2X4IA 3OJCA 3O4RA 1YFZA 2PCJA 3DD5A 4MVJH 4XM0A 1K5HA 4J0QA 3A6JA 4D3ZA 3IT2A 4CRWB 4EW1A 3MTJA 2O3SA 3UH1A 2Z43A 4B3CA 2ORIA 3V4PB 1A5ZA 3WYFA 3B6EA 4A23A 1G21B 3G5MA 1SXQA 4MRVA 3H9GA 1I8TA 3II6X 3DFUA 3S2SA 4DE5A 3QFHA 2GVNA 4PONA 3SSAA 4E30A 4PX9A 1NIPA 8GPBA 2HA3A 2X0JA 3JVEA 4O4IF 2B20A 4UUPA 2PLRA 5SYNA 1J49A 2XCUA 4UNPA 4QPJC 4GPTA 3HA2A 2A1TS 3UUFA 2AFRA 1XJQA 3DUFB 2AFIE 2XB6A 1JQAA 2N46A 2Q9CA 3C1UA 3ONNA 4BQSA 4YRGA 4JU9A 4F3RA 2O2XA 4DXDA 1P1IA 1P1JA 1RE1A 4NJMB 3EFEA 2B4QA 2QN9A 5JBIA 1ZM7A 1HETA 4BFCA 4RZXA 4RVHA 5JAOA 1CYEA 1YQGA 5CB6A 4UMDA 1AHHA 2XUPA 1P60A 2R87A 2Q1TA 3EAFA 4Q3EA 4KACA 1EM8B 2IY8A 4A1OA 3VVCA 4YIHA 4MGKR 5D3MB 2BGUA 3BTUA 4K9NA 4NBVA 3FLAA 2IYOA 3K0AB 1SC9A 2Z6UA 2PU5A 2LDBA 4G23A 3TB6A 4GXRA 4A0RA 4YRJA 3KJEA 4FYHA 4GQBA 3AKYA 1Z2PX 2M2IA 3NAMA 3ILVA 1OU0A 3G49A 1VCNA 1WSBA 2C9CA 4L6AA 3C16C 4WERA 5EPEA 4AXBA 4QOFA 4NIMA 1KFCB 1VZ2A 1LDGA 1NVKA 4R2LA 3T5TA 1NVVR 4ME6A 5H16A 2CDRA 4BVLA 2OHOA 2Q3DA 3MMNA 2ZXEA 4E33A 5LU9A 1DSSG 2Q2QA 3SR0A 3FHJA 2VF2A 4Z9YA 4DJDC 3LBYA 4ZHSA 4YP0A 3OPYA 1IAQA 1YRLA 5IZCC 5LKRA 2VS1A 3G0GA 4Z4IA 1Z5VA 1Z5PA 5K7SA 3RFUA 2P2YA 2E5WA 3IKMB 4GLFA 1PNVA 1GPBA 2F1IA 2W6NA 3RC3A 2EFYA 3F3KA 1HE3A 5DNUA 3QJYA 5DV9A 1RBZA 2QSUA 4C0JA 4E5YA 4UAVA 4H18A 4YH1A 3P9QA 5IU6A 3PT9A 1QYRA 3DMPA 1Q2XA 2IZZA 2BBTA 3QKUA 2GX6A 3IBTA 4F38A 3SBEA 4N9QA 3EEYA 5DHRA 4F21A 1R0BA 4FGZA 4I2NA 4LHZA 5GJVC 2I1QA 2IECA 4WZBA 4YPFA 1C7JA 1K86A 2H16A 1FP2A 3R3JA 3WGQA 4INZA 1DCMA 1CY4A 3W8EA 3GJ7A 2WJ3A 4AFNA 5DTJA 2O8DB 2J1LA 4CUZA 3UUWA 5A0TA 2R751 1EP9A 2FI1A 4MMZB 1HDZA 2OC4A 3JQGB 4NYMR 1PTJC 2PKYX 2F8MA 3DYBA 4H08A 1XMSA 4KQJA 4DDTA 5J9FA 3MAJA 4ECEA 4C0QC 3ELWA 3EXIB 5BSUA 5HSGA 4IRMA 1IH8A 3ZLUA 1WEKA 2LVBA 3C3AA 4K2HA 3M3PA 4Q3BA 1JFFB 4NXNB 2EDAA 4A2PA 4LRSB 5DE3A 1AQJA 3C4JA 3DWIA 2Q4DA 5ALHA 1NXTA 1X7YA 2J6BA 3D2AA 1DBWA 1DKQA 2EKBA 3RU3A 4EYEA 2M1XA 1MHTA 3TVTA 1L4FA 3OFJA 4F5WA 4IDHA 3VSCA 3COYA 4PLPA 1YA4A 2C2HA 3FWZA 2YINC 1RLIA 1GKUB 4PWYA 4EGQA 5IYZB 3JD3A 1PR4A 2YCBA 2J30A 3H2IA 3O1HB 2JIOA 2ZRLA 3ANXA 2G80A 2P4SA 1FVOA 1OHHA 3AHJA 5G4KB 4X44A 2VOEA 1Q1GA 4M88A 2FX2A 5F76A 1N2XA 3G0HA 4D5EA 3TTTA 1A9OA 1Z82A 3PXAA 4WXYB 1RJGA 1T26A 3OEYA 4BLTA 3I1JA 3DXZA 1T25A 4IFIA 4JT2A 3J81A 3CEAA 3RRNA 1H5NA 3BD6A 3OWOA 4LE0A 2Z2YA 3QVVA 5ITVA 1NZDA 4DADA 1YQQA 1H5QA 2J3QA 3I9LA 2BLLA 1UMDB 4WUVA 3A6GA 2MSLA 3MINB 2RK4A 3PRKE 2YW2A 3ZW9A 1XB2A 1N2JA 5JQGB 3SZOA 1NHGA 5FI3A 1EQAA 1MQ9A 4DLLA 1YRQA 1QFMA 2FPGA 3DVLA 4NTZA 1QYVA 2X8JA 4B7AA 1QV6A 3W6UA 1OXBB 4XRGA 1CJCA 3V8NA 4PYOA 1M34E 1OIWA 1X8JA 1GU7A 4QVKA 1V45E 3O9ZA 1KH2A 1Y9JA 2BFPA 1P1CA 5KJ6A 1S8NA 2VNAA 3GLRA 4JJGA 2X9QA 3AIIA 3KJFA 4QSMA 1QKIA 3TZBA 2EBFX 3MJSA 2FN9A 4JBHA 3RSLA 4GZ6A 4WY8A 4M8NE 3MHTA 3LPMA 5JVDF 1TVCA 3AFIA 1AKNA 3HACA 1EFVB 4QDTA 3KJZA 5KX5F 1V1JA 4JXJA 2J5KA 4ZXFA 1ZM9A 3GFVA 5BQ3A 1TZBA 2JFQA 4RD0A 2HRRA 2CUNA 2J0VA 3UJCA 4RMNA 1B6GA 3OPMA 1W581 3BULA 2W2TA 4DIKA 4QQFA 3BK7A 1EVIA 3E8MA 4XYEA 3IVAA 4HI0E 5HK9A 5FR2A 1M10A 4BN4A 4KB5A 5AVJA 8MHTA 2C8VA 4Q3DA 1SUEA 2H00A 2P2GA 3WBFA 1WBDA 1DHRA 1F51E 4Y0VA 3ZE9A 3GFPA 2V5VA 2AC2A 5IWCA 4GPIB 3V1MA 3ZBQA 3BILA 5L3SA 4OUDB 3UICA 3KJGA 4P93A 3RTBA 1LPMA 3E3MA 3WQHA 1FYEA 1NP3A 3OUZA 4BYMA 2J31A 3OT4A 1Z4JA 2IXFA 4B44A 3CI0K 3AP1A 2MJLA 1YF3A 5TMBA 5K8LA 3NTRA 2A0UA 3VMMA 4EHLA 1TEVA 1TL7C 1DC7A 5B4UA 1SOWA 1HNXB 4CV0A 4JSRA 3TPZA 4PR0A 2A59A 3FE2A 3SYLA 3GARA 5HQ3B 2SCUB 4CQLB 5ALVA 2H5IA 1OLXA 2R8YA 2Z5FA 3GMSA 5T57A 2B9VA 1JG6A 1K7FB 2WJWA 2VK1A 3QA9A 3EXHC 5F64A 2I2WA 5FPHA 3X0DA 4BPRA 5L53A 4LZOA 3JQ7B 2YXPX 3SD7A 4J4BA 5DT2A 5C35A 2WUEA 5I9SA 1E94E 1Q91A 1TVEA 4GVXA 3P32A 4ZQEA 3W5BA 4A0GA 1LLQA 2XNDA 4HTAA 4DJTA 4RJTA 1XA4A 1KPIA 2E82A 4WVLA 4KPGA 1I13A 1CQPA 3JVVA 4U6SA 5HCUA 4PLGA 4D0NA 2V7UA 5IC6A 5CITA 3KETA 3OZCA 4I50F 1Z7GA 3FZNA 4RLHA 3QPVA 521PA 2NUBA 4XUCA 3LFUA 4IIFA 4YI3A 2VRCD 1JE1A 3L41A 4AM8A 9LDTA 2ZI3A 4L5YA 1XVIA 1X9GA 1BO6A 3B1ZA 4GUDA 1NN0A 2GETA 1MJGM 2GGSA 1A77A 1CX9B 2PZFA 3LQKA 3IHTA 3TD9A 3TIXB 1P44A 5HF6A 4PSCA 2WABA 1ONOA 3PVCA 4UTNA 2PYIA 1TM2A 2HIMA 2PNJA 2F48A 3WGJA 3N6RA 1TADA 2HJSA 4QOJA 4X63A 4L2IA 4P82A 4QNMA 2G17A 1ST3A 2JFUA 2P9GA 2ZDQA 1JT9A 3PEFA 2BEKA 2PL1A 1U4SA 3AP2A 3BCRA 4H27A 2R8PA 4HLUA 4O2BA 5TMDA 4L4RA 5MF6A 2HEGA 1ORTA 4ARIA 5CNIA 3TAXA 5IS2A 1LV8A 3BWVA 3T6KA 5C3UA 1IHUA 5FWXB 5EKDA 4NCAA 4UTRA 5KTNA 5FPPA 3IOEA 2FKAA 2ODQA 2PZEA 2MSEB 3JARB 7ABPA 2FEMA 2F1HA 3H0EA 1JFSA 2XD4A 1GLNA 2L42A 3MTAA 4KIJA 3WI7A 1PX2A 3GA0A 3NT2A 3WVNA 5FBVB 2W5UA 3C3JA 2JKZA 3LRTA 1K89A 1W94A 2FPPA 3JYQA 3VKFA 4GZMA 5TEWA 1JIXA 3KSRA 1VGVA 4WLFA 5IH3A 4BV8A 1EVJA 3COWA 4WXHA 2C4VA 2QD3A 3IP6A 3HUUA 2M32A 1R0YA 2YV1A 4YCJA 2GRJA 2OXEA 4DPMA 1L5WA 4MP8A 5B4VA 3TQQA 1UBUS 4UOQA 5EL0A 1EEXB 3S3TA 3U81A 4IKPA 3IVXA 4WESB 5B7QA 1LK7A 1WDLA 1Y7IA 2I6TA 3ETEA 3F2VA 4BNNA 4WNIA 1M6EX 1PEDA 2CLOB 5CGQB 1IZ0A 4CMEA 4REQB 5ELLA 4G37A 4BFXA 3AF4A 3PX7A 2ZRQA 3EEQA 3KHTA 4UFOA 1Z6AA 4PY2A 3UAXA 3KQSA 1X9IA 1I3CA 1KPGA 1E2NA 2QPAA 2C8KA 3EXG1 1LRJA 2DTXA 1WABA 3IPRA 3KU1A 4Q1EA 5ER9A 3SC2A 3HR8A 3HNRA 1EA7A 1WUKS 2H6EA 2JLAA 4TSFD 4TWBA 3KAQA 1LW6E 4UCWA 5HIIA 5DHFA 3RFFA 1SBNE 2IPOA 2VT2A 1OJLA 2FFJA 2P5TB 5FQNA 2II6A 3P5BA 1E99A 4EG8A 2X6TA 2MT9A 5BRJA 1NLYA 3CZCA 3L46A 4MQ5A 3QU9A 4QXOA 3NPMA 4WSOA 3ZEIA 1XELA 1JKJA 2C82A 3I8SA 4MTCA 3CJRA 3QVLA 3PXUA 2AWNA 2VJMA 1U2GA 2Y9PB 2ZJ8A 4NMXB 4CMCA 3MRTA 4GX2A 3DVRX 3S2FA 3AL0C 3SDSA 4II2A 2VWQA 4BNVA 1EVEA 3CG0A 4FFMA 4HGZA 1IL0A 3WRYC 3DAHA 3ZGYA 3L43A 1IXSB 1XVVA 4PG7A 1N8NA 2HL6A 2XOKA 3VDQA 3T9BA 4TZTA 2OP0A 3LOPA 2JPDA 4IX9A 3ZI0A 4YHHB 1CR0A 2WU4A 3RCBA 1NATA 1EVLA 3A58B 4JLPA 2GD6A 3TE6A 1PZHA 1OBCA 2GQ0A 2WSSD 4YJ3A 2AZMA 4YI5A 1FUEA 1UZAA 4V0NA 5FOWA 4BQQA 2BFEA 2CV2A 1L4KA 4Y6RA 3ZV5A 1ZH8A 2QN2A 1SOVA 1K1EA 1RQNA 3FTCA 1H4VB 1MX1A 4GM4A 4MYTA 4JYAB 1L7DA 3HU5A 1NR7A 4WN3A 2MDTA 3TSAA 2O0LA 3RBAA 1J0AA 2EKDA 2O5EA 4OV6B 4YRKA 1OASA 1XZCA 3NBQA 3LG2A 4S1NA 3D6FA 1IY0A 3OLCX 3OJWA 4BKOA 4LF9B 3W8FA 3M8KA 5D51S 2C4KA 5CLJA 3PFGA 3BL5A 6AT1A 1U8TA 2B2CA 5DX1A 1ZS9A 1RBYA 4CV2A 5JAUA 3G79A 1FLVA 1QYWA 4MR9B 2VPTA 3GQBA 4TKUB 1HDGO 2ATVA 3PU6A 2Q1XA 5JNTA 3SF8A 4OMDA 4FMCB 2W2LA 3I6MA 2V9PA 3LHDA 4LXYA 5CIWA 3IP7A 1T29A 1RDFA 3O8DA 4GEGA 4B8WA 4Z51A 1OI3A 4OXXA 3ZJ4A 1DOZA 4U2EA 2BFBA 4QBGB 4Y2RA 3IQDB 4BRUA 4C2AA 1QIDA 5B3JC 1EFDN 3DLPX 4Y2XA 1CDOA 5ITZB 4OP3A 1NV8A 1HBJA 5JSKA 3AVPA 2CVPA 1YR1A 2QEQA 1J8QA 1T8SA 3B1XA 3FNHA 4NFHA 5G1NA 4EMBA 1A8IA 2QLLA 2CXOA 4YCNA 2ZAIA 2N75A 5A0VA 1FE8A 4JSTA 2XECA 2W8BB 2WJVA 3N2EA 4I9NA 5A9SB 2JCBA 3VC1A 3HU1A 3FMOB 3W6OA 1YA6A 5LLDA 3UMBA 4H7EA 2BH9A 2JLXA 3UWSA 5EFOA 2P9QA 4GM1A 2HR1A 1KP2A 4RABA 2H63A 4R6WA 2KLHA 1A9XB 3A06A 4H7PA 1U7OA 1MQSA 4JLNA 4R9SA 5GIPE 3UN1A 4E03A 1J33A 3MPUA 4LWQA 2CJWA 1CRPA 1P1HA 4UHDA 3VMFA 1XTKA 4BO6A 4G07A 1KQPA 2H2AA 1DKLA 2P6UA 3EZYA 2J7PA 3RJ9A 5SY4A 3UGQA 2HDWA 1U0BB 2JLYA 1F2TA 2VN8A 1GAQA 2PRJA 1TK9A 1DOAA 1IN6A 2JVKA 3A9SA 3B60A 4UHHA 1EZZA 2CD9A 2LE0A 3OLZA 5DYGA 1LX7A 2HHJA 2Y71A 3R3YA 5J47A 4CFSA 1G21A 1DG3A 5A3JA 1O54A 2JD1A 1LPSA 5TC4A 5C1DA 1TZCA 1HV8A 3ABSB 4QU0A 5D1HA 2OK8A 1R0CA 3D1VA 2XUGA 3EF0A 2R11A 1CQIA 4KYIB 3OD5A 3ZE1B 3DEKA 3T7KA 4D0RA 2EZ8A 4BAUA 1LPOA 1R8YA 1A0OA 2ZJOA 5TVGA 1ESCA 5CJPA 5CAEB 3WGGA 1A7JA 2XE6A 1Q95A 3OIWA 4GICA 4BB9A 3LL7A 4EPYA 4LE1A 1AZLA 2GBPA 2FR8C 1LC3A 1UM9B 3T15A 1N3LA 1RXEA 5HYVA 2A78A 4HH4A 1Y5RA 1ZO8A 2ECKA 1OA0A 4GYKA 5M29A 5LMUB 3QVTA 4LYEA 4ON9A 4Z4GA 4CETA 2BHTA 3RUIA 2GO1A 1EM8A 4B6FA 2ZYHA 5BNZA 3HCBA 5D3MA 2VJYA 3N3BC 3OCZA 5CA0B 3GUCA 4ZQHA 2XNCA 2YJNA 4C2UA 3ZVMA 4PU0A 2EKZA 3RS8A 4KNYA 3JQCA 4XOIA 3PC4A 5AKKA 3RM3A 2WA2A 4L75A 3WB2A 2WYHA 1DBQA 5K8CA 4RXMA 1BGXT 1EIZA 1UJMA 1OFIA 1T9DA 3L1UA 4OP2A 3VI3B 3VQTA 4ZJPA 2AJ8A 1NXVA 4YCAA 1F7UA 4A6XA 3UOWA 3DCYA 3BWMA 1AKEA 4IDOA 4B33A 5LZ4A 4CEJA 2ZBFA 5LP1A 1K4MA 4H0CA 1FUKA 1SIOA 2ZPAA 3O1LA 4B3SB 2OENG 3ET5A 3C1TA 4EOGA 2XTZA 3RIXA 5E3HA 3QWAA 3CNLA 2DSNA 1O97C 1P5ZB 4QO8A 3STHA 1CYDA 1UMBB 1JJVA 1EB8A 2G4VA 5KCMA 2W70A 5JH7F 2G09A 3IMKA 1Z7WA 4AY3A 4CIWA 2IY9A 2CNNA 1RWMA 2YN0A 4QG7A 3ESRA 4ATNA 2J8ZA 4FN5A 3G1TA 1ZGZA 3F6PA 2CV1A 5EWJB 4AJ2A 2HRBA 3B78A 3OA2A 2Y66A 4QEZA 5DNWA 2IKQA 4E2WA 4EELA 2VATA 1U0RA 2XKBA 3PKZA 2VT6A 1Y5MA 2VXOA 1R10A 1P61B 1T15A 5HKKD 3O84A 2ETVA 5BO5A 5KOJA 3TJMA 2O8DA 3I01M 5DSTA 1I51A 2QTZA 4HPJB 4TLEA 1K0UA 2A94A 4LVOA 3ZWNA 4O2BF 1XCBA 2QUAA 4QE3A 1XCPA 4E4RA 3EODA 1W4BA 2BF4A 1E6KA 2K2QB 2OQIA 4XQGA 3TXYA 3PI6A 1JFFA 2W2PA 3CNQS 4I4IA 5BQ5A 3U37A 2E21A 4UCQA 4BY9E 1G3IA 5EQFA 3WO1A 4IVQA 4BE9A 4DSTA 4DTIA 4CN9A 1NY6A 4HNHA 4XWYA 1E4OA 3C74A 3TS1A 3QFFA 2H7YA 2CK3D 3RLIA 4DVGA 4JYCA 3QVSA 4BLPA 4EHIA 3ZOKA 2O6LA 4XCXA 1P3JA 1I80A 2BGJA 2IEZA 5AM1A 1L5HB 1RAAA 5DHPA 5E8JA 3HWSA 5EP4A 3L8YA 3P0FA 5CLFA 2EQAA 1DT5A 4D8VA 4BQRA 1HRDA 4Q7LA 3Q7IA 5IYZA 3OMLA 4KKVA 1FFBA 1Z5UA 1IUKA 1SVSA 3DB2A 3JQAB 2BMAA 5LYJB 1Z4KA 3HB4X 1EFAA 2YV3A 1A5SB 5HTKA 3PTAA 1SXPA 3H6GA 1H05A 5G4KA 3LKBA 4AK9A 3F5QA 3C24A 1FYDA 5GVSA 1BDBA 2FY8A 3C15C 3LBNA 2ZBDA 3EUWA 3D4LA 1CUIA 3BE4A 2J3HA 4IJ5A 1ABEA 5DOZA 1WX1A 1ZZGA 1VBFA 5P8WA 1CNMA 2REQB 3T7RA 1W36D 4RAOA 4N48A 4MUNA 3NHKA 1UMDA 4WOBA 1AS2A 1KY2A 5E0KB 4KTTE 5TRTA 2RI0A 5JQGA 4BOYA 4DIBA 1Q0QA 1OC4A 3AM3A 3SE7A 2I3DA 2FUKA 2YHUA 4C06A 5K0CA 3T5AA 4G4IA 1U63A 3VSEA 2GXQA 4J7XA 1QO0D 2ANCA 4LZWA 3JRXA 5JCOC 1U3UA 2R6GA 2ZCVA 3AHEA 1RP1A 3DGFC 1DL5A 1NBIA 3M9XA 4R9RA 3EGXB 4DDHA 1LQTA 3F6CA 1CWUA 2BCEA 2DCUA 1PK7A 2RB4A 1LZKA 1O08A 2D0IA 2FW6A 5EOVA 1QFSA 4S04A 2W11A 1JLLB 4B3JA 4E88A 3U3RA 4PSVA 1RT9A 4MKIA 2JFOA 4GOLD 1RW4A 1PSDA 1TMKA 1ZU5A 2PT7A 2WSBA 3L79A 4BEBA 3USCS 2GBLA 3UKJA 2E89A 3PCTA 4DYDA 2PNFA 4BLRA 4EY8A 1XLWA 4D9IA 3BRCA 1U8XX 4FS3A 4BO4A 1E9VA 4EB6B 2UDPA 4LI3X 2Q3BA 5IP5A 1EFVA 5DGXA 3R8CA 4EPTA 1RYZA 4DV5B 5TS3A 1AD2A 1GFSA 2YIJA 3A3NA 3VYTB 4YYEA 1IBCA 4ER3A 4DMRA 1S01A 1CJBA 1SWVA 2XYHA 2QKYA 1QMPA 2ZRNA 4LYJA 5C34B 4Y2YA 3S8EA 2F8SA 4JB3A 2J9GA 2EFDB 1B7GO 1E66A 5B57C 5JJ5A 1Y5LA 3LT1A 3B9QA 4RNCA 1RJFA 1XD2B 2MOKA 1DG9A 5EMLA 4YJ3F 3E22B 4EA9A 1VJTA 3L2OB 3M3HA 5J4KA 3ORFA 4OBWA 1FFSA 3ENVA 4X65B 4BQIA 2A84A 4CIDA 3ZDAA 1EWKA 2OBYA 2EJTA 1NBMD 1WMEA 4LZPA 4ODIA 3BG5A 3WLEA 4YJFB 3HYCA 2WT9A 4LKRA 1Z22A 2WZBA 4Z6KA 1Z6QA 1FNSA 2XCQA 4EHBA 1P4GA 1X8LA 1SURA 3ZNNA 5LMCA 5KNBH 1ZD4A 4BZPA 2XD9A 4M1MA 2VPZA 2Y0CA 4V24A 1CW2B 2H85A 2JVIA 4HLCA 2XUQA 3FD8A 3N8HA 4GQAA 3NKFA 4RENA 3C70A 4I5IA 1VKNA 2BFNA 2R7LA 4KX3A 3H11B 3GX1A 3NM5A 5BSVA 3SU8A 2C0QA 4RZUA 3OM9A 1W4CA 4LMAA 1K97A 1VYHA 2SCUA 3Q9LA 3QPBA 4CQLA 5DKFA 1Z29A 4HNUA 4HZUB 4F4CA 1OTHA 5DLPA 5B2ZA 2EBUA 3GA7A 3T38A 3RKSA 3AHFA 2BHNA 1VJCA 3MMXA 1CERA 1XKQA 1YNOA 1GYPA 2JC3A 3DFMA 5KYXA 4NBRA 2IEAA 3OOEA 3ECCA 1FUIA 1P1BA 4ZN6A 5ARBA 1JF8A 1O3YA 1DVRA 2VHEA 1JJBA 2FN4A 5I8ZA 5KQPA 1MTZA 2HNKA 1D2MA 3VOBA 1QQBA 1V6AA 3BRQA 1ZMBA 3AM4A 1XMXA 3IR6A 1VCIA 1MFPA 2GSDA 3LNCA 4HDRA 4WZBE 4BLVA 4CV1A 1N34B 3UKOA 1E7RA 3C6YA 2R8RA 2IS2A 4IDEA 4DDKA 3HDYA 4PO1A 2H3HA 3C6KA 5LIPA 1MRNA 2L19A 3QPUA 2PX6A 4GOXA 2O3RA 3CCFA 4GX1A 4PZCA 1KS2A 3JY6A 4AJ1A 1L6RA 3AEKB 4J0KA 1JEYB 4LDZA 4XDYA 2IYYA 5FWYA 4H7KA 1H0SA 5I7VA 3G8CA 4RCVA 1M8PA 4MGYR 13PKA 3BIJA 3A9UA 5ARCA 3IA2A 2PTHA 2FJUA 3OLXA 1JAHA 1T0JB 2DH6A 3O8QB 3WWPA 4P22A 2ZBQA 1B8PA 2PJZA 1QQ6A 4D0GA 3GHYA 2X6RA 3B2EA 1QP4A 3AZOA 5L7WA 2JDIA 3E1KA 1AY0A 1VMKA 2Y1LA 1QORA 2P9JA 2ZTMA 3C6BA 3IILA 3LC0A 2VSFA 3GUZA 1ZIXA 3KDAA 1T36B 4AJNA 1XX6A 3JARA 5E6RB 4J0HA 1C1YA 1VOTA 2ODNA 4PGFA 5JCXA 1Z5ZA 3LUBA 1P1FA 1P4JA 5A7GA 4M55A 4E11A 3FJYA 3BDAA 4E1BA 3QUCA 3ROGA 2ENWA 2C5EA 2GJAA 1AVTA 1I3KA 3L6OO 3H2GA 1E60A 3PWTA 3TOXA 3H5TA 3KV1A 1JTFA 4A2WA 4XVUA 5EZ6B 1ACLA 4MS1B 1Z2NX 2O50A 4KMOA 4AL4A 3MCUA 5CFRA 1WVGA 1TU4A 5HW0A 1O95C 5CGZA 3RD5A 3T7DA 1OILA 2PU7A 3A6PC 4X1OA 1O94D 4BJ5A 3MJCA 3PEWA 4RLSA 3K6JA 4WESA 3PEEA 4OXQA 1D2HA 4XQ0A 3K70C 3BIFA 3Q8MA 4KO3S 4MB2A 2WD9A 1XAIA 4YRSA 2JIDA 1WBBA 2BP7A 3CVOA 6ADHA 1Z45A 4EWLA 5T3YA 2FF5A 4U6NA 3T4EA 1ZD1A 3FUCA 3A4YA 3OEHA 4MV6A 4A8JA 3ZCRA 2D1QA 3ND9A 4MJXA 3DMTC 3EF3A 3RABA 4MS3A 4GBED 1KO7A 3EZLA 3TZKA 1GVHA 2I3GA 1J39A 4HFMA 1Z17A 5CBPB 3WKBA 3GAZA 4CM4B 3LUGA 3OX1A 4TMZA 2RHHA 1MR3F 2D1FA 4Z7JA 3M6MD 1Q77A 3DKVA 4KC0A 3TL6A 5JR3A 1BMDA 1USVA 3V97A 2V7WA 3I2YX 1H4TA 4U3JB 2QVZX 4KHPB 2BELA 3WAJA 2BM9A 3LT2A 1MVLA 3FMGA 4L1KA 3VR3A 3MBOA 2R7AA 1KMIY 2XYRA 4JLDA 5D00A 4WFKA 1U7XA 4WCVA 5KNCD 4RL6A 2GUWA 3F4LA 4JBGA 4YQZA 4DR4B 1GU0A 2O8CB 1P2FA 1G8GA 2GFHA 2PRSA 5IHPA 2I34A 3HWX1 2Q27A 1QCCA 3WHKA 3LY9A 1BVHA 4EBFA 2V3VA 1UT5A 5HF5A 2CB9A 2C9BA 4IXDA 4WOKA 3H7IA 2LCQA 1E0SA 3CF4G 1BE6A 3FFXA 3ONDA 4JL5A 3P52A 4WN9B 2G3YA 2G9ZA 4R7ZA 2JAOA 3GCXA 3EUFA 3P4YA 3D7RA 3QLEA 4BQOA 3ZXSA 3H6KA 2FVXA 4Q93A 3AVYA 3KOUA 1DBPA 2WV7A 1P81A 4ZP1A 1NNUA 1N6HA 1D4OA 2M6RA 5LM3A 1CRLA 1OE0A 4C4YA 4QPDA 2FEXA 3KSMA 3D6NB 2IV2X 1VL5A 1JMKC 4PX2A 1P17A 3ZI7A 2DLNA 3FFTA 1FTWA 1E2EA 2XRMA 4K86A 1V95A 7MHTA 1KU0A 1VPDA 3AZPA 3ID6C 1VKHA 3VR2A 3H1FA 3HFSA 3KLMX 4NQZA 4XSVA 4YECA 5JSFA 1ICEA 1H85A 3NYQA 3ANNA 4PTYA 4TLDA 1KOJA 4IQ8A 1VMAA 3CF2A 4IILA 5EEGA 1BKYA 1YMQA 3KEGA 3D8NA 1GPKA 4I1VA 2PXHA 4IVPA 1WHSB 3B3GA 2H4XA 3FMFA 3HFGA 3KEMA 3ZHYA 1Q3TA 2VPWA 3K73O 1Q14A 3DTYA 2E4YA 1PZMA 3N2IA 1B0ZA 1NURA 1LF5A 1XQVA 2HRDA 2VDWB 4MR9A 4PW0A 5AHXA 4OX9B 1YHYA 1NBWB 2B98A 4P4UA 5BN4B 3EGOA 4Q82A 2REOA 1AF4A 1TVKA 4NZZA 3W2FA 2VTDA 2Y05A 4G5QA 4HD8A 3HXTA 6CHYA 3GXBA 4RJ2A 2Y68A 2TYSB 3GMDA 3IHKA 2QR5A 5CDGA 1PI3A 5ITZA 1Z6XA 1KI2A 3QNWA 2FFQA 4MUFA 3ND5A 3PNYA 4WXEA 3SX4A 2F59A 2Q99A 1IY8A 5JYCA 1NVEA 1VG9B 2OO5A 4I0WB 2P35A 5IJAA 5C1IA 4LBYA 4I3HA 5A6VA 5KWIA 4NXMB 2XKJE 2P4HX 5HGJA 1F6DA 3KAKA 3RS3A 3ZQUA 2PZKA 5TARA 3VUEA 1NVDA 3WGHA 1T6YA 1QC5B 2UUCB 3G0IA 2A9FA 1XRRA 3Q5DA 4E12A 3LQ4A 3K1AA 1M2HA 3VKWA 1U9ZA 3VJLA 3FTEA 3RFTA 3D7NA 4H7DA 3CT4A 4RV5A 2FRDA 5FHRA 1OA1A 1KY4A 2WYIA 3NALA 1GGFA 2UYGA 4DLTA 1E1RA 1ZNQO 3VBEA 5HJ7A 1L1EA 1NC1A 2P8SA 4AQYB 4BFZA 1XNJA 5CUQA 3Q7EA 1NMSA 3ELBA 1SK9A 2H9AA 4Y1RB 3GBSA 1H2BA 1NONA 1KI7A 1T6XA 3WLRA 4MDHA 2D6FA 4LF7B 4ZVSA 2Y1WA 3NTOA 5U1PA 2FG7C 3O6VA 5KEIA 4ZMSA 4CIBA 3C5WP 2R5FA 1P62B 3EIXA 4EW6A 1GNQA 4DPLA 3A2MA 3EY4A 2H2IA 1E79A 4LBWA 2QTAA 1CVRA 2GA9A 5CFPA 1I24A 3BMQA 3LGXA 3R5XA 5D5PA 4DBVO 3WL4A 5TQ2B 5HP4A 3WHPA 5B4TA 2C5FA 2HYDA 2QV0A 2VBGA 3NDIA 2YV4A 3MB8A 1YULA 4TLBA 1YZKA 4CU2A 2ZTUA 3OPYI 3DE4X 5CAEA 1SVMA 4MIOA 5KAPA 1JG4A 3ONFA 4HAOA 4NYJR 2PQ6A 4CLEA 3SOPA 2J3EA 2QN3A 4TGLA 1UM9A 2NW6A 1SUWA 1XEWX 1IQUA 3NNSA 3VSAA 3N07A 4JMLA 4NZMA 4UZFA 2NACA 1ZAYA 1JZQA 5EP1A 4KXVA 1N92A 4G84A 4FQ7A 3L02A 4YUVA 3VR5H 4ZALA 4TWZA 3H9UA 1LC0A 1L5QA 1PJCA 2HF7A 3KKPA 3KTAA 3HGQA 3ZU5A 1GTG1 5EYPB 3FMPB 2RHJA 3V1LA 3JALB 5CA0A 4JGIA 2ZDHA 1HT3A 4EZBA 1UEIA 2O07A 3MMSA 2K2WA 4NY1A 1C0KA 2LCFA 4MQ6A 4UUBA 2QIOA 3IPCA 3PE6A 3A2NA 2DUWA 3A6HA 3UJ7A 1B2LA 1Q20A 3AI7A 1RWVA 3AQIA 4RULA 1OGYA 1GTMA 4HL6A 5E6SB 4RVSA 5E38A 1V8DA 3ADOA 2RJ3A 4RVNA 5DHUA 3RIMA 3ZHZA 4QTYA 2VP5A 2M9MA 3KZXA 3AG5A 3TFWA 4ENQA 1E8MA 4HAZA 3B13B 2G7ZA 3JATB 4QPCA 1RPJA 4JHXA 4WCFB 4MV5A 1YCDA 2A9JA 1KBZA 4RQAA 3FTPA 4R2IA 2UYCA 1U3WA 1UFOA 1X1RA 5IF3A 2YXBA 1P73A 4EZIA 1UMBA 1OWPA 2FZLA 3AF0A 1EZ1A 4MOWA 1DTWB 5A5FA 3CLUC 5BNIA 3K05A 1NI4B 2VJDA 4XASA 5DSZA 1Y8RB 3T95A 3N0RA 4GZ5A 1UCFA 4DY4A 1BA3A 1FJHA 3MLAA 5JDCA 3VV2A 4ML3A 4XIIA 1JLHA 4LNAA 2CHUA 2HU5A 3ILHA 1GRVA 4MW6A 2HWKA 2ZVJA 4OHVA 3OQIA 1QR2A 2WSIA 5C8YA 2X2FA 5CYOA 1I9CA 3FM9A 1EUDB 3T7TA 4AJLA 2XBLA 1JFRA 1FZQA 1PZFA 1XTZA 2WAOA 3FTQA 3K96A 4G63A 1RJ9B 1EXDA 2QX8A 3FBGA 2O2JA 4EG7A 4GOND 3GZNB 4NH0A 1WCXA 3D4BA 5C51B 3LVFO 1JNYA 1H2FA 1SH7A 1EX6A 4LNUB 2VDOB 1LTKA 2P1DA 5E9QA 1XRNA 1OV6A 1JZTA 1LB1B 2FPLA 1TF5A 3BXGA 1ZSYA 3GT3A 4RADA 2G77B 1UAYA 5JZSA 4YRDA 2QW1A 3CRQA 3U6KA 1PFUA 3IP9A 2E6KA 1C3OB 4KR9A 4JI5B 1TJNA 3G68A 3RSSA 4QLOA 2KPOA 3F46A 1T3HA 3RVNA 3RWMB 4F9GA 4DC1A 4DQLA 2AVNA 1PT7A 3IQFA 1L5HA 3VDMA 2WG2A 5FFMA 2JIZD 1FJXA 3HTXA 3L1IA 4M0DA 5JADA 2OOKA 1FFHA 4JGGA 1LPPA 2J3KA 2PSHA 1Z13A 2X5JO 4M1TA 3HKEB 4BMDA 4Y9DA 3JQAA 1PS0A 4ZO6A 3R7NA 2RAFA 3RWBA 3TDNA 4MYCA 4C7BA 2ZQ5A 3OECA 4DCGA 3GPBA 3KPVA 4DLZA 3BC1A 3C41J 4D79A 1YV9A 1H2HA 1Z2DA 3DOHA 3D4OA 2PG3A 1UJ5A 3C7AA 1ONNA 1J06A 2PMFA 2OQ2A 1R74A 1WXXA 1YU6A 3D8HA 4BX9A 2EF0A 5HCIA 3ZHQA 2WZQA 1OGJA 2O7RA 4KUEA 3T06B 3AW9A 5ALKA 4CMKA 1WY5A 1K08A 1N9ZA 3NPAA 4NBUA 4L4SA 4D4LA 4JC4A 2WYVA 1SA0B 2YWGA 5ALGA 2ZREA 1P39A 5G0VA 4XH9B 2OXTA 3AGQA 2QRLA 3DEIA 3EPRA 5CCXA 4B6RA 4IDAA 1JQDA 4C1NA 3AEYA 4WK2B 4MR7A 3H9CA 1VCMA 2WMYA 1N78A 3DOIA 1R8XA 5JATA 1KNQA 3ZNOA 3MAGA 4UVGA 4BMCA 4UEWA 3WRVA 3WQQA 2FNAA 4DWJA 3RK4A 1AKYA 5KB3A 2WD7B 3BSWA 3L01A 3PFHA 3QEMB 5LOVF 1G21E 1V7ZA 3HNOA 1NVUQ 2R8XA 1BDIA 3FTNA 4NJEB 1JXQA 1J6UA 1Q92A 4B46A 4D9JA 3MN1A 1P4SA 3AH8A 4GWKA 1J2JA 1VLHA 3JD2A 3JWGA 4JKYA 1BRTA 2YS6A 2OCPA 2EARA 3WWOA 4CFYA 1LD3A 4L0QA 2YOHA 4HBGA 1ZN7A 3OAAA 4TTRA 2Y4NA 4G9EA 1X87A 4I55B 2R96A 2X1MA 1Q7BA 4FFVA 4OOEA 4TMFA 5ICEA 2NP7A 3QKRA 3CIFA 5ED0A 3H2ZA 3ZDFA 4LF4B 4J29A 1ZGCA 3QE3A 1JAXA 2G3DA 4CM3A 2N1BA 1AUVA 1RJEA 5IN5A 3U16A 3CCCA 1PFGA 1QWSA 1CZLA 2QNIA 5K3CA 3R5TA 4OFZA 1SHJA 4EHJA 1ZM2A 3L0YA 1XD2A 1JVSA 3EPHA 1X92A 3QBTA 4HV4A 3QEJA 3IURA 3PHHA 2R97A 4HP8A 2JJMA 2INGX 4YIKA 4Z9XA 4I4TF 1EKXA 3N76A 3N2LA 1YGPA 1W88B 4AZWA 4LC1A 5LDGA 3GDFA 1A96A 2GM3A 2UAGA 4YJFA 1HOTA 2BZGA 1SZDA 4YRRA 4B6SA 1VYTA 5CIYA 4ZTUB 2WMNB 1L8OA 2FAXA 3EWSA 3AWIA 1GFZA 2I54A 1IFXA 3DW3X 1DQRA 4D98A 4BO5A 5KYUB 2VSOA 3O03A 2M6KA 3L0CA 1AX9A 1ZUHA 4RFVA 2V45A 3WX0A 1FS4A 3M1AA 4RJJA 5AXBA 2BFCB 5J2UA 4NAVA 5ICMA 2VQSA 3JZAA 1LV7A 2QYSA 3BHJA 4HPWA 2VSYA 4YEDA 4M8IA 3WBJA 1HE1C 3NONA 1ML3A 5K51A 4YYZA 5GVRA 3T3EA 3L4SO 1DBIA 4QNRA 2QUIA 5IG2A 4EY5A 4HZUA 2VRWA 3B6KA 4FZ3A 3U7FB 1E0AA 4HFRA 1KMQA 2D1YA 1N0IA 3FCEA 4JODA 5H4GA 2EW1A 3N8NA 5AKXA 3SLKA 3NDJA 3VM6A 2WFMA 3GPIA 5AW6A 4JJ7A 4MGIR 1SC4A 2RH9B 4OQPA 3O4GA 3U3OA 2A6PA 2AYXA 4FW8A 1U9CA 3G2IA 2QD2A 2VLBA 4PXAA 3EVNA 3UV7A 1C2TA 1VG8A 3CNNA 3WJAA 3AXTA 3NDRA 3D3QA 1OX4A 3GRKA 1LA2A 3SOZA 3U4AA 1ZIYA 3AFMA 3CMCO 3GOHA 2EV9A 4US0R 1RQ2A 5BP7A 4KQMA 4GDFA 3V8RA 1YB2A 3A31A 4YLYA 4DV6B