4MULA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(naphthalen-2-ylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 93
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mulA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mulA01
2PZ8A 1O0BA 1YULA 3UK2A 4MULA 3COWA 1QU2A 1KP2A 1BS2A 5LM3A 1NUPA 1EJ2A 3AKZA 1MBZA 4A91A 2A4MA 3MUEA 3AFHA 4PBRA 4CDMA 2A1TS 1QU3A 3HFJA 4ZT4A 1K97A 3RK0A 1N2GA 1K92A 1WXGA 3RJZA 2HMAA 3ZJUA 1J20A 2QTRA 1N1DA 1EFVB 3HGMA 4YMIA 2YXNA 3CA8A 4AS1A 4GU5A 3H9CA 3P0JA 5KCMA 1JMVA 3N8HA 4NATA 4NAHA 1NP7A 1Q77A 1NSYA 3FI0A 4XSVA 4EFKA 3KT0A 5HUHA 1JZQA 3G59A 4ZCTA 3CVYA 3QTTA 4MUJA 1TYBE 1O96A 2J08A 4U8HA 3N05A 3ND5A 1T9GR 3DV2A 5LLTA 4BWVA 1YIAA 4JFAA 1OBHA 5J58A 2H29A 1PG2A 3TNJA 1GTSA 1QQTA 4XFJA 1F4LA 2CYBA 1KQNA 1WQ4A 2RE8A 2PZAA 2QUJA 1NURA 2E21A 1N2OA 3H97A 4OUDA 5J5AA 4XFDA 4MWEA 1O97C 1QJCA 4ZCQA 3G6KA 3P0IA 4EG7A 2CSXA 1PFWA 1GAXA 1NUQA 3TZEA 3TQIA 3FNRA 2D54A 2X1LA 2NSYA 2DR2A 2CYCA 2A7XA 4QRDA 1WOYA 2BYTA 2D13A 3AG6A 2A88A 2CFOA 4NX2A 3OP1A 2WB2A 3A4IA 4EGAA 4S1OA 3H99A 2VTBA 4GRIA 4WNYA 1WXIA 3RFFA 3CVUA 1F7UA 1KP3A 1LI7A 3SZ3A 2DLCX 2YWBA 1R6TA 1F7VA 1G8FA 3RK1A 1J1ZA 1H1TA 3IVXA 3FDXA 3HMQA 2CV2A 3X1KA 4X0EA 1J09A 3C8ZA 1KH3A 1WXHA 1NUSA 3F3MA 4HPWA 1OWOA 1IH8A 4MLPA 1I2DA 4EG3A 4YBRA 5DB4A 1U7XA 2NZ2A 1VLHA 1MJHA 3LE8A 1KAMA 1MAUA 4NAUA 1EUYA 2CT8A 1MC1A 4DDMA 3UY4A 1WXFA 1ULHA 1S4MA 3L93A 1I6KA 4WSOA 3VGJA 3UOWA 3PNVA 1TYCA 1Y42X 1PFUA 3IUBA 1CT9A 3N2YA 2QTNA 1O96B 1F9AA 3ZUGA 3P0HA 2QUHA 3K32A 1KKUA 1RQGA 1O97D 2IP1A 1B6TA 3ND7A 1R6XA 4G5YA 1IQUA 1Q15A 2RD2A 5HG0A 2PG3A 4YP7A 4MUGA 1WQ3A 1COZA 3FG9A 2DETA 2J4DA 1H3EA 3TQOA 3X1MA 2XRYA 5TEVA 4MW0A 2X0KA 3PNYA 4OUDB 3SYTA 2BTEA 1DNPA 4PBSA 4L2IB 1JGTA 1WY5A 3IUEA 4CT0A 3VRHA 4YP6A 3IMEA 1GTRA 1PFYA 4F3RA 4J76A 1N2IA 1QNFA 4U7JA 2QUIA 1NUTA 1M8FA 3COYA 2JA2A 3INNA 3SP1A 2ZUFA 4CQNA 1KR2A 1QRUA 3IOBA 1IQ0A 2VTBB 3IMGA 1JHDA 1X6VA 4MWBA 4MUFA 4K0RA 5KHAA 1NUUA 1O95C 1O94D 4DNXA 1JECA 1T6XA 4JZYA 2B7LA 1N78A 1XNJA 1OWPA 1QTQA 2GOYA 2IJGX 4NZPA 3IH5A 3I05A 1QRTA 3A2KA 1P7PA 1R6UA 3CVXA 1I6LA 3COVA 3HZRA 3M5WA 2WQ7A 1N77A 1ILEA 3MMXA 3CLRC 4MW4A 3ISJA 5BNZA 3PXUA 3HL4A 4MUIA 2R5WA 1JZSA 3CLUD 3KT8A 1D2RA 3RBAA 4KR7A 1KORA 1M8PA 5DASA 3H05A 1YI8A 2OQ2A 3A04A 3SZGA 1M8GA 4DDKA 3H9BA 4MWDA 5H7XA 3NV7A 5EKDA 3U1VA 1ZH0A 2QJTA 1IRXA 3QE4A 3A05A 3MLBA 1PFVA 2E89A 1GZUA 4MUHA 3Q12A 2A86A 4PBTA 5F23A 2H2AA 4ZCSA 2YWCA 2QUKA 2G36A 2EJCA 1EE1A 2QTMA 3PNBA 1J70A 2E18A 2A84A 3GUZA 3ILVA 4EG6A 1O94C 1T6ZA 3MLAA 1N2BA 1XNHA 1TQ8A 2AZXA 5K0TA 1LW7A 3HV0A 5IJXA 3AG5A 2A1TR 1IHOA 3IMCA 1KH2A 1M1ZA 3KT6A 1ZH6A 2V0CA 4AQ7A 4MW6A 2AKEA 3P52A 2PFSA 1IVSA 4EF6A 2QJOA 4J75A 4ZT3A 1JIJA 4FZJA 1N2JA 4DLPA 4MUKA 4MW2A 2V0GA 1VBKA 1KH1A 3CLUC 4MW1A 3SDBA 2DEUA 3IOCA 2J5BA 1GPMA 2ZP1A 3L92A 4ND6A 4Q16A 4EG4A 1PG0A 1U7DA 4KPUA 1O95D 2HGZA 1WJGA 5DEOA 1I6MA 2OV4A 2EL7A 1TEZA 4MW5A 4RUKA 4KR9A 3Q10A 1MB9A 4K03A 1G59A 5H16A 4ARIA 5TGTA 1JILA 5TS2A 1YIDA 3TS1A 3CLRD 1OD6A 5TEWA 2GM3A 4PY2A 1MB2A 1JIKA 4KKVA 4RPIA 3IOEA 4Q93A 3CLSC 1V8FA 3FWKA 4ZT5A 2JANA 5J59A 4E1AA 2HZ7A 3G5AA 4ZT2A 3PRHA 1OWLA 1Q11A 2WSIA 3ZGZA 1NYLA 4H3SA 3DO8A 3TZLA 1JIIA 1H3NA 2PZBA 4HJRA 3DPIA 1N2HA 1YUMA 3FHJA 2I1LA 3SEQA 1VBNA 4OJMX 1KQOA 4CDNA 2ZUEA 1SURA 3D6UA 1KAQA 1FYDA 1LI5A 3UMVA 1EXDA 2A1UA 1K4KA 3ELBA 3RHSA 2E0IA 4ND7A 1N75A 1WXEA 5FO1A 3CLTC 4JXZA 1YUNA 2PIDA 4ARCA 3JXEA 4L2IA 4MQ6A 4F4HA 1O0CA 5AHWA 1KQPA 2Z09A 1V47A 3LCJA 5FO0A 1U3CA 1GN8A 1MOPA 1WKBA 2D5BA 5DK4A 2X1MA 5FNZA 3KT3A 1O6BA 4JXXA 2PXHA 3LOQA 1GLNA 3ND6A 3VU8A 4MVCA 3AL0C 4G5FA 4MAFA 4NDAA 3ZJTA 3IODA 2CYAA 1JEDA 5IHXA 1ZUNA 4R0NA 3NBKA 2WQ6A 1O5TA 1XNGA 1G8GA 3ZIUA 2DERA 1FFYA 3KFLA 2DXIA 3ZXIA 5KWVA 3D6VA 3SEZA 4UZEA 1EFVA 3BL5A 3UC5A 4YP5A 1TFUA 4ZT7A 4QREA 2DPLA 3AIIA 3MXTA 1MRZA 1VBMA 4I6JA 1OBCA 4KPUB 4R2LA 1HYBA 3FY4A 4ZCPA 4QBTA 5HUJA 1T9GS 1G8HA 4KR6A 4MVYA 1M8JA 1M83A 2XRZA 4I6EA 3CLSD 3CR8A 4MW9A 3ZXSA 1ZJWA 4P2BA 3X1JA 2YY5A 1OWMA 2J07A 1EFPB 2X3FA 4EG8A 2CV0A 3S3TA 2QJFA 1MAWA 2AG6A 4DE5A 1U3DA 4MUEA 4ZT6A 1U0BB 1VL2A 3FOCA 2TS1A 1JEEA 1X8XA 4HK4A 4MVWA 4MW7A 4UZFA 2CV1A 3E27A 4DJAA 1J1UA 2O8VA 1H3FA 4TS1A 1NI5A 4MVXA 3CVWA 2O5RA 5JBNA 3K9WA 3GMIA 1A8HA 4G6ZA 4EG1A 2JAXA 2Z3VA 1IQRA 3IVCA 3DLAA 2C5SA 1N3LA 2J09A 3FIUA 3N9IA 3QTBA 4HJXA 3OTWA 3COZA 4U63A 4MWCA 1T6YA 1QRSA 4I6GA 5K0SA 1UFVA 3CVVA 3FETA 1TYDE 3ZJVA 1J21A 3CLTD 3NBAA 1EUQA 2Z08A 2DUMA 2IELA 1XJQA 1Q19A 1N2EA 2A1UB 2CUZA 1TYAE 3Q4GA 1OWNA 1M8KA 4DDHA 4MUNA 1EFPA 3FH0A 4R2MA 5LFAA 1K4MA 3IDFA 2VXOA 1WZ2A 4ZCRA 1NZJA 2GKSA 4JYZA 1IFXA 4EG5A 3GLVA 3IVGA
chains in the Genus database with same CATH superfamily
3SSNA 1O0BA 2XCUA 4IQ0A 3ZY2A 4F9FA 1QHGA 4Y3UA 5B3JA 1S4QA 4DQLA 2A0FA 1PLKA 4EVIA 5BQPA 2LUOA 4FUTA 2DUJA 1N5LA 4FLMA 5H02A 1L7AA 1T9HA 2G1UA 3LFUA 3DMPA 2ZQ5A 4C30A 3A1VA 4FIDA 3SFVA 4O29A 4BO8A 4D98A 1RZUA 2I29A 5CW2A 3ED1A 3C6KA 4RKYA 2A92A 3H65A 2ZTHA 5E9AA 1Q3TA 3I2IA 3WY9A 4MMYB 4A2QA 4CDMA 1A8IA 1PGPA 3RS9A 3RK0A 1ZRNA 1N2GA 4MUYA 4P3KA 3RJZA 3TNDA 1VJDA 1ZGHA 2IL1A 3B8EA 4P80A 5DX0A 2WFLB 1PT8A 1YUBA 2IYSA 3AY7A 3DMTC 3LUHA 4LOJA 4RZ3A 2ZIXB 1TU3A 3ZDXB 1ND5A 1Z5OA 1CUVA 2I4MA 1TZJA 1DRKA 2PSSA 3AJRA 3I23A 1WEKA 3KJXA 1NP7A 5HZHA 1NSYA 3FI0A 5EI5A 2QMUA 2F8TA 4ZI7F 1NP3A 4ENTA 3OWOA 1U6KA 4RU1A 3JQ8B 1Y8QA 2OKCA 4ZAVA 4N8DA 5D86A 1PR6A 4AFNA 3CVYA 1EFHA 2A59A 2CLKB 1L5GB 1Y9EA 2EF1A 1NUHA 1RCUA 2WJ6A 4OHMA 4KQHA 3NWPA 4TSKA 1KZ1A 5DM0A 1K6EA 1E8NA 2AYZA 4JBNA 1OBHA 5JS2A 5B4VA 3NKLA 2BZ0A 3TD6A 1W0KD 3PEWA 1LB1B 4OSEA 2GXQA 3E18A 2QN7A 3GPDG 4DNPA 3DL2A 4KDEA 5JRZA 2R9VA 5AO9A 5E6UB 5C5IA 1RI4A 3AEZA 4Z3DA 2BMWA 2K7FA 2G8NA 4MS1A 3ZCXA 5AHKA 3P2EA 4YI5A 1EM8B 5AKHA 5LWHA 5AUOB 2H6EA 5IVHA 4XFDA 2DR0A 1O97C 2X4IA 3HI6A 3OE7A 2QRZA 2AF4C 1NYQA 2ZRHA 4GIBA 2FFAA 5DHQA 2BI7A 1X87A 4MINA 5AM0A 5J2UA 2G3YA 4AY6A 1NHGA 5BWMA 4I4NA 4H0FA 4P6VF 3TZEA 1A9PA 1I4WA 2Q50A 3OCZA 1P0QA 4CLXA 1FDSA 2NO5A 4HLUC 4PIVA 4WL0A 4GNRA 4WBNB 3EEOA 2JJ1A 2XDQA 5HIJA 2J0SA 3GIDA 4OX9Y 5KYGA 2ZM5A 3D7LA 1YKFA 1WDKA 1PTJC 1XDBA 2Z95A 4J16C 4DV5B 3U1VA 4CQJA 4XGKA 1WKCA 3UA0A 2FSGA 3PD7A 3UWSA 4E2YA 3ZXUB 1H1LB 3NHRA 3OZXA 3JQAB 4ENWA 2BEWA 1S5PA 1GR1A 4V0RA 3T8YA 1TJPB 3GDWA 4RGQA 2G82A 3FN4A 4RV4A 3QEMA 3BE8A 5DGCA 2WU8A 1KP3A 3IPAA 3MGAA 4AJ4A 3T61A 1O9HA 3NHAA 4YI3A 1NWHA 1U2DC 4CM7A 4JOCA 4IWXA 4HC4A 2D74A 5ALHA 4KQ6A 2H1RA 2JA1A 4JT4A 5IVKA 3B38A 3BA1A 3V5NA 2GK7A 4F4UA 3EPKA 3TLJA 1W35A 1HC7A 1O08A 2OBYA 3LP5A 4FJ1A 3SQOA 5FPKA 3N7UA 2BFFA 4MIOA 3VR6D 1CQXA 2KPOA 2B30A 3MD0A 1EUDA 3PUXA 2Q3CA 1D2HA 4QFMA 4C7OA 2EHJA 3L1VA 3NKFA 5F3RA 1N6LA 5ALXA 2BDEA 1JTEA 1YOVA 2YZGA 3D6AA 2QP3A 3O9MA 1O4WA 1ZI9A 3OFSA 4K28A 3JAKB 3HXLA 4HX2A 5EIAA 4HSEA 3W5JA 1WSWA 1WP4A 2RI0A 3DF7A 3LE8A 1I4TD 3S1SA 3SEAA 1MAUA 1QH9A 1U1FA 5I7RA 1JFTA 3R9XA 1ONSA 1LTKA 1NLYA 4ND3A 2NU6B 1EQ2A 2II6A 4G1VA 2ZU6A 3UWPA 3UY4A 5EJ9A 1OIVA 3HRIA 3HDHA 4DA0A 1Q12A 3LCRA 5LPNA 1A69A 3JVUA 2G7MC 4LJ9A 1A3CA 1R8JA 3UOWA 4XDYA 3EDRA 5JALA 2PPVA 5EZYA 4LKRA 1KY4A 1Z28A 1J2RA 4KB5A 5B7GA 2HUPA 5L6MB 4UE3S 1DBIA 1ZI8A 3BWMA 3EODA 5GGXA 3R7SA 1F9AA 1ODSA 1TA0A 2R25B 3DLTA 4LHZA 1F20A 4RVSA 3K5HA 1KKUA 2I76A 2W2LD 4OHBA 1YFZA 4ZGWA 9LDTA 1PV2A 1X39A 5EMNA 4D57A 3CSDA 2DLDA 2YYSA 1GSOA 2B2XA 4FOOA 3GQBA 1TKAA 1SVLA 4EGSA 4KYIB 3V9PA 4LZWA 1NN3A 1MAAA 1L7OA 4HV4A 2QE6A 1QG6A 1NLMA 4LZNA 1JDPA 2DH5A 3AHHA 1ENZA 3F98A 1B3RA 2BTEA 2CNDA 3VQTA 5AJUA 3BGOS 3EQ2A 4FJ2A 1TPZA 3LQFA 1QK3A 3NM6B 1GPKA 1WETA 1T0BA 4JKOA 4B6EA 1PFYA 4BNJA 5IKEA 2F8MA 4WD3A 1RQ7A 4J76A 1P2FA 2QG9A 3V1LA 821PA 2X58A 4ZHQB 3MK31 1N2IA 1VMKA 4TGLA 5HRUA 4D9MA 2NM0A 1HT3A 3TDKA 3KJZA 3U4IA 4C1BA 3BD6A 2ZE6A 1XZJA 1ZM7A 3WNCA 5LUBA 3ZGOA 2Y1KA 2C61A 3F46A 1W1IA 3WL5A 4BB9A 5HBRA 2I3ZA 1Q0RA 2FJUA 2XWJI 4J9UE 2OMEA 5EVCA 4QYTA 5IU6A 2LIVA 5KWJA 1LPNA 1BDMA 2AOXA 3EXEB 3ANMA 3PUJA 2PRYA 1GN9A 5BXYA 1QH1A 1VHJA 4UTVA 1E6WA 4E6EA 4OSPA 1I9CA 1H2WA 3Q41A 3FOWA 1DCTA 4O0LA 1NUUA 1P39A 2YUTA 3HO8A 4FXPA 3OPNA 1VDZA 4Q9HA 4JR1A 2NVUB 2B7LA 4TS9A 4ZYXA 1VRVA 3PQDA 4HB4A 3VPHA 4ZYZA 3UMMA 2IJGX 2CNLA 1T1JA 2VKTA 2VSFA 3OCVA 3H4TA 5BUZA 1WVIA 2C77A 2O2CA 3G8AA 5GIOE 1PAUA 1WY7A 3UM9A 2OESA 2CLOB 4ZIRB 1H4TA 4YQYA 4CR8A 3B1KA 3Q15C 2YW2A 1OPXA 3QVJA 1RFLA 4FYHA 4H60A 4TTJA 5I7WA 5CXSA 5ECGC 1VIAA 5EQTA 3A6ZA 3GOQA 4N5NA 1LPPA 4OXIA 1DJOA 3DHYA 3QPBA 4GVLA 4L8WB 1JT2A 3Q8XB 3RUEA 3X0DA 2EGHA 3L7MA 1KORA 2EIXA 4TWIA 5KINB 4W5OA 1M6YA 5CBKA 3TK1A 3BTVA 1YI8A 3DV0A 4Y6PA 1II0A 2OO5A 3KKLA 2DY1A 3LJKA 3EDMA 5FORA 3EEYA 5CDUA 4HEQA 3DULA 5FL7D 4KK4A 1YB1A 3DC2A 2B1QA 1BOFA 1FY2A 1VP3A 4OHWA 1D2EA 3AJDA 3KALA 1OROA 3RBVA 5DHUA 4BAUA 3OUTA 1JFVA 2AXQA 1FUEA 2HWYA 2AN9A 2PKQP 3CT6A 1WW2A 4I5GA 4U0KA 4W9NA 2A86A 5HF6A 3R7WA 5AKGA 5JS1A 4TLAA 4DC0A 3AJEA 3K6SA 2QTFA 3E2MA 2ODPA 4EGQA 5KYWB 3KG2A 2YWRA 4YJ2A 2GEJA 3RYCA 3HWSA 4H27A 4KIWA 5CCXA 2I55A 2HCBA 2RAFA 5DH9A 5CAEB 4O63O 2QRNA 3EXHB 2WIDA 2YV1A 4H6PA 1YB2A 2REQA 2XA9A 3CISA 4MIEA 2BMFA 2OUIA 4NPAA 5FBWB 2NZYA 2AUMA 5KIAA 2BM9A 3E9RA 1E9CA 4BC0A 2VJYA 3JWGA 2JLAA 1OT3A 2PEYA 4G26A 5YASA 4DMRA 2NUAA 1I2MA 2Z04A 3C24A 1HQDA 3F5FA 4JX8A 5A3QA 1JKJA 4I9NA 5FBLB 1FMJA 4KMSA 2QRGA 1QZTA 1EXNA 1Q50A 3JRXA 4Q4JA 5EE0A 1DB3A 5EINA 2ZYVX 3IXMA 4PGMA 4HEA6 4YH1A 3QVGA 1T2AA 2Y0PA 2IBTA 3L92A 4IV5A 4J0KA 3QKUA 1EA7A 2UVPA 5JZ9A 1E9SA 1M72A 3ACBA 3H1PA 3MAGA 4K5QA 3T1OA 4HTAA 4FEEA 1A5AB 1L5OA 3NH9A 4QWWA 3I5UA 3CV3A 3CTMA 2HJWA 4Q4DA 1RZRD 4N3GA 2DPXA 3R6WA 1CUWA 4MXDA 4Z9BA 1D4OA 2ZXFA 4PLTA 3VH3A 3TQCA 4JP2A 1GPYA 1DBVO 4K6CA 2O8EB 4NRDA 5JJLA 3GAZA 3ZBPA 3B82A 1GFWA 5KNCA 1TMYA 1YGYA 2HHCA 4UBKA 4G0VA 3G8DA 4A1FA 5SY6A 4PAMA 3C3PA 3EUAA 4GI5A 5F5NA 5I9NA 1R9NA 4QASA 4QGHA 2FWIA 3VOBA 2AKAB 1BAPA 1J33A 1HRDA 4EFNA 4XYBA 3RYIA 3PFWO 3VHLB 2YY7A 5CEJA 3WO1A 4LZLA 2C97A 3K0AB 3IEVA 3IALA 1DDGA 1IOWA 3KXLA 2O48X 2VDQB 2GI4A 2QORA 3L1JA 3MT7A 1WW3A 2QZPA 2R7KA 3D3JA 3A2NA 4GZ6A 4O4IA 4RZSA 4C0JA 2HW8A 2ZSUA 3H1BA 1ZUNB 2NV0A 1U3TA 4ZOLF 5FI1B 1LI5A 3AETA 3TX2A 3OT5A 3X2SA 4JEIA 3SZOA 1NDUA 3HLKA 4TQAA 1VCIA 3GCXA 1GP2A 1HZZA 4Q01A 4B71A 2VHCA 1M34A 2K4MA 4Y9UA 1MV5A 5IT5A 3GXOA 1HLDA 5KJ1A 1PQ4A 1LDMA 1NVFA 1ULUA 4AYTA 2XX3A 4C21A 5FWYA 2JLVA 1VSQA 2IXDA 5FOQA 2Y92A 3HCDA 5DHAA 4TV8F 3ZY5A 4BMOB 4YX9A 1SG9A 4BQRA 4NCKA 4JVLA 3O8QB 4XJVA 1SVIA 5B6PA 3F1LA 4EHLA 2YZ7A 4LVOA 1UPFA 3GDOA 4NSNA 4REOA 5EP2A 1YFKA 1FYVA 1M6WA 4JLNA 4O4LA 1HL7A 1AUOA 5DGHA 3JY6A 2NUTB 1KIMA 1NW5A 3RO7A 4JLSA 4E1VA 2NO9A 2Q0QA 5DFAA 4MA5A 3I1FA 1M2VB 3A26A 3EW9A 5K8JB 1UOQA 3E2PA 4H7KA 4HDQB 2C7RA 1CUCA 4JHLA 5KYYB 3KSUA 4YT2A 1YHZA 3BKXA 3EH1A 3EPJA 4M0MA 3U3RA 4Q12A 2PJRA 2VN8A 4IR7A 4ZOCA 3KYDB 1RXCA 1UXOA 4NOMA 3ZXIA 5B2EA 3KE9A 4JLKA 3DZ8A 3T9FA 5BW0B 1K3FA 4IILA 3TTVA 2DHDA 4CRWB 3UJCA 5K8TA 5ELXA 4E94A 3AHEA 3HCRA 3OLQA 1TFUA 4G0NA 3I9NA 3L82B 3SFTA 3URMA 1SQ5A 1XO1A 2EBUA 1CJSA 2WA1A 3ZCVA 1NRJB 2NMVA 4IINA 4FGZA 4G85A 5BQXA 2PYZA 1OBCA 4OXYA 1Z15A 1EAMA 3WK7A 3I5XA 3WNDA 1UXJA 1WABA 3AU8A 2PS3A 4GOJA 4HTFA 5JZBA 3FOZA 4IJ6A 5G02A 1MR3F 7MDHA 2XCTB 1P73A 2GJKA 1T2NA 2CW5A 3TSZA 5ALDA 3NS7A 2CJWA 5IM4A 1ICIA 1FTNA 5FADA 4XFKA 5I9BA 2WJIA 1KYIA 3E03A 1OXTA 4M0KA 4OUKX 4ZT6A 1DHRA 1U0BB 1CDDA 4NECA 1G21A 1VL2A 2E2WA 2FZ5A 3FE2A 5AOCA 3R7DA 5BN4A 3NDBB 4N7RA 1UPTA 1SU8A 1ZGZA 2V8OA 1E3WA 1JF8A 2W7TA 3DNPA 1E8MA 2CXSA 3DFIA 2NPOA 5JPIA 5KU7A 2WD7B 3ZVMA 3CB2A 3I1IA 4BV8A 1A2OA 1JX6A 2WZDA 3DDCA 4LNHA 3X43A 1V3UA 1NJ6A 1YL5A 1JU3A 3KX2A 2H4JA 4KE6A 4QHYA 1PJCA 2XSZA 1Y3FE 1YJXA 2ZLBA 3HG7A 1Z06A 4YC7A 4C4SA 4DRXB 2WJGA 1CDZA 3PF9A 3EIQA 1SAYA 4IVPA 5C4MA 5KNDH 2ZZMA 2I33A 1LS1A 3GRZA 4R05A 1PSDA 5FP0A 4O8CA 1E1DA 1W87A 4E14A 1E4VA 1BGXT 2VJPA 5ES3A 4ZZ1A 1ZO8A 2MSNA 3G8BA 3NBAA 3GG9A 5F4ZA 2DWQA 2FPSA 1DC3A 3B1JA 1N2EA 1GTVA 2HTEA 3B85A 4BRWA 2I2BA 2OXEA 3TEMA 3V7YA 2AG1A 3KB1A 5J2UF 3IP1A 4QELA 1NFQA 5EGNA 2WTXA 3RIEA 1Y7IA 1BFUA 4EHBA 5E38A 4EY5A 1IN5A 3KPWA 4MUNA 3FH0A 3GRCA 4RENA 1XQYA 1E69A 4P92A 4ZC8A 4ZAZA 3S2GA 5KUTA 1WTAA 4A0GA 1C9EA 2RJOA 4P22A 3PT9A 2AL7A 3AEKA 5F73A 5FYDA 1F17A 5JDCC 4DQUA 2AQIA 2QRVB 3WNQA 2P9HA 4YWHA 4M53A 2VNJA 2FXVA 4DV7B 3QLUA 1ITZA 3ESRA 3GN1A 4OQXA 4FE7A 3GJ4A 4KQ2A 5KX5B 2FP4A 2HNAA 5DBIA 5IH7A 2F3PA 2I7VA 2B34A 1ZWKA 4EMTA 2F55A 4R1OA 4D4HA 3B5IA 2Y1CA 4JROA 3ZLTA 3LBYA 4FYXA 4UBJA 4EZEA 5IFLA 1NDHA 1E5DA 1ZITA 4NC9A 1DBQA 3HKBB 2W2TA 5D7BA 1QB7A 1YJ5A 1QIFA 1VG9B 5K3BA 2VYQA 4Q7MB 1S7GA 4W1RA 5FOWA 3G9ZA 3GT0A 1YQWA 1VHTA 3R4CA 5FTWA 1QSGA 4DADA 4TS4A 1K97A 3QV1A 1ECBA 3FTDA 4EG0A 4FQ5A 4I5EA 2G9QA 4XWGA 4BKRA 4D4MA 1RAFA 2GH1A 2HMAA 4IKOA 1J20A 4ZEXA 5UKDA 2B1RA 2O2YA 1Q1NA 1DJNA 1LRKA 2PBLA 2TECE 3DHVA 3WHIA 3P0JA 2PBRA 4ZI3A 3MOGA 1JMVA 4EEZA 1CP3A 4QJ3A 3DP7A 3KT0A 1MO2A 5CIYA 4L0DA 4KQMA 2XB6A 3PQ4A 1JZQA 2D06A 2Z4RA 1G16A 1XVIA 5FPSA 3TX6A 4HGYA 2ZUEA 3PV0A 3LF1A 4U8HA 2J08A 5CT9A 3B60A 1HY3A 3WRXA 2HWUA 1EFLA 2OD9A 1E5XA 2Z6UA 1ZGAA 3A9RA 1CIPA 1PGJA 4QPJC 1HETA 1TAHA 3KJIA 3WYAA 5A2QA 2IYUA 1RPNA 4CMEC 1U2TA 1JN0A 1ZLYA 1IU9A 1GO2A 4R84A 2R6GA 3QF4B 3ZU3A 4NE9A 2OP1A 4DMKA 4MV4A 1TUBB 1HG1A 1NURA 2O1EA 2WHPA 3EF3A 4GLLA 5CT8A 5DRTA 1MT0A 2I1QA 5FBKA 3ZYCA 1TJ3A 2WUVA 2E1RA 4RO0A 5JJCA 3PGKA 3RV3A 2DHEA 1DIOB 3P0IA 4E33A 1QUEA 3TDNA 1RQ2A 4PCUA 4WLEA 5T4BA 1GQ2A 3K1AA 3HB9A 3WE7A 4FDVA 1R3DA 1F8XA 3N2IA 4M1OA 1A76A 2W2OA 3CI0K 3N59A 1IN1A 3I8XA 1JG4A 2FI1A 2VDOB 3C0KA 4EP1A 3LUPA 3JAWA 5B4UA 5FIUA 3FCUB 2BZ1A 1B8OA 7ABPA 3W5VA 2BHLA 3A7EA 2C7VA 3W4IA 4EUSA 1QE3A 1Z62A 1KYXA 3FR7A 3ILYA 2PU7A 3QUSA 5LA6A 4LGCA 4NJMA 4HG2A 4KJXA 4QBIA 4AMZA 4Q9KA 1VG0B 4WESA 2ZB3A 1D8AA 4A23A 1G5QA 1N7GA 2QRJA 4X24A 4A3SA 5KREA 1Z7YA 4DAOA 1OMOA 2A9RA 3IUPA 1E2LA 2EZ4A 2HA5A 2PE5A 5IAGA 3DCYA 2AD1A 2OV3A 3JX9A 1UBLS 5ULLA 4EI9A 1F7VA 2V6IA 1RWNA 1IZ9A 1L2TA 2O7SA 3QELA 2RGUA 4WVFA 3HMQA 3ETEA 4JD5A 2Y67A 3KSMA 2CKMA 2H2IA 4I3FA 3QA9A 4TKLA 2V4MA 1Z17A 3BQ9A 4IAOA 1L1EA 5G3YA 4BIMA 4FGWA 2Q3MA 1A4RA 2X8JA 5A3VA 4UHEA 1BO6A 3AEXA 3SC6A 3DZDA 4MPJA 3ZKAA 5JYCA 5HQJA 2Y1FA 1E0SA 4QODA 1Z5VA 3L7OA 3MTAA 2AC7A 1RLTA 5CP8A 3X1XA 2E49A 2NG1A 4JA2A 4QLBA 1EUYA 3UUGA 1OLXB 4ZDJA 4I1OA 2NACA 5KOJB 3Q7IA 4H4EA 2WVHA 2WD9A 2P3OA 2Y6UA 1JAZA 1QYWA 4AYXA 4LVUA 4KLAA 4R1QA 2IZ1A 3VGJA 4DDVA 2RC5A 3OI7A 4UOQA 3HY4A 1VCNA 3OKCA 3WLRA 4K9MA 2ZVJA 1IDN1 4LNUB 5BYJA 4R0MA 4FCTA 1HSZA 2QTNA 2WEKA 4UFOA 5FFFA 4KRFA 3LLVA 2BONA 5LQSA 5EHNA 1CFJA 1J2TA 5DTJA 4L5AA 3UWOA 1I13A 3LOPA 5A4DA 3P0HA 3H75A 3DE7X 1SG0A 4RK4A 1IG0A 5K8UA 3BZUA 2QY9A 4A4DA 4GBGA 4HT3B 4C2UA 3PJDA 4IVRA 4HGZA 3G82C 4K8RB 5F3WB 5I4KA 4P7JA 1Q15A 2RGNC 3BGDA 2ZJ6A 4KFSA 3NRCA 4D56A 1TVMA 3NDRA 4K87A 4OP3A 3FPHA 5HUQA 4B84A 5D51S 1E63A 1KAGA 1ZONA 4OUDB 3LQQA 4S2UA 1DOZA 1G7TA 2NO0A 4FKBA 4OGKA 4ALLA 1W85A 3KL4A 3VDMA 3BFVA 1TFRA 2BH9A 2MSLA 2Q6OA 3NI2A 4LF7B 3FNQA 4NDNE 4XW2A 1K7CA 1YE8A 4FDTA 1PK9A 2JHGA 1E64A 4HPJB 1S0UA 3IMEA 3GJYA 1D0SA 2IY9A 2VDWA 1MN6A 4L78A 4Y2SA 1GNPA 1LNSA 1WG8A 1RXSA 5AKXA 4CLDA 3VOTA 4WY2A 1A50B 1RYZA 2O1XA 2P40A 1DQYA 3AOGA 3IQEA 4V2UA 5LN1A 3BMNB 2ISCA 4PWYA 2CL0X 4P98A 1GILA 2A9OA 2ETVA 4U7JA 1OKKD 1MJGA 1KJYA 1L5FA 1LLDA 3L9WA 4ARBA 3TXYA 2FB9A 3VO9A 1Q3KA 2FE1A 5LVAA 3DBOB 5LZ4A 5BSGA 3HUFA 4GW3A 4ESOA 4ND5A 3ZWVA 1IQ0A 2QY6A 2B94A 3L41A 4A16A 3DLBA 2E4ZA 2GEUA 2BEVB 4CL2A 1E6MA 1G2QA 3EXIB 3FWZA 5D3QA 4B43A 5FPYA 4MWBA 1LSOA 4JC8A 3KQQA 4MO9A 3CSUA 2ATXA 2RK3A 1O0SA 2QD2A 3UJHA 4GKBA 3AI3A 1K0FA 4BLPA 3MYYA 4FBLA 1AB5A 2EKPA 3FAKA 3OPYA 1OI4A 3X1ZA 1ZN2A 1I7LA 3FDJA 1N0VC 3KAQA 1QTQA 2FX3A 2YXLA 3IRVA 3DFZA 4LI0A 4RVFA 4BVFA 3LP6A 5C9ZA 3O3NB 1JA0A 3UOAB 1UJ6A 1N77A 5FOVA 5F3DA 3IX7A 5C1IA 4DDWA 1QGOA 3K31A 3WGYA 2C2MA 3GRRA 1RVV1 4UD6A 4YRAA 3H8VA 4ZAXA 3HB7A 4UEWA 2PDAA 4GPIB 1TMKA 1T8RA 3KT8A 4KQ1A 4ZI7B 3L01A 3QEOA 4Z8XA 5IH3A 3CX4A 1WF3A 2O2SA 3K6RA 2QF7A 3AY0A 2CLMB 3ZHVA 2WM8A 4N54A 2NYUA 3ZLBA 5C7IO 2GEFA 4LF5B 4GVPA 1YOBA 4DDKA 1N25A 2NZUG 2PK3A 2O7QA 3BXZA 3CZMA 3GVXA 3OP4A 3OQBA 3RT9A 4BX2A 1XZBA 4ATNA 2QJTA 2J3DA 2PX5A 3QIAA 1IRXA 1ZRHA 3CM0A 3CXUA 2HWKA 3DHNA 4UHKA 1GUBA 1UEXC 3V4ZA 1WHSB 1EGMB 3MAAC 3R0IA 3AF3A 4XVQA 2XIQA 5F23A 1UBTS 1UZUA 4KIUA 4UHCA 5CT4A 1EPUA 2J67A 5A5EA 1ANKA 3D7MA 3OQPA 1R4NA 2OUKA 2V7BA 5M04A 2HQRA 2R1TB 4G0OA 3PHCA 1U2RA 3RROA 3KE8A 3LG2A 5DBGA 5J40A 5HVNA 1PKEA 1J0CA 2HADA 4I50F 4BTLA 5JASA 3GX1A 3PPWA 4O4HF 1JQKA 1P19A 1RAIA 4HS9A 5K45A 3Q98A 3WB9A 2W90A 2YH2A 4L76A 2GPJA 3BMQB 2R4TA 4ZWNA 1OB5A 2FPKA 1QFSA 1Z12A 4UUBA 4X1IB 3G23A 4M7RA 4MB0A 1DQZA 4UAJA 2VNAA 1MG0A 3V1TC 2BR4A 3P9QA 2AKEA 3R7LA 1Q74A 1W1WA 2BD0A 1GNVA 2PBFA 1LWNA 4QNNA 2IPAB 2YS7A 2JH3A 1JIJA 4HNHA 4J3JA 2X5OA 4MI1A 4J9VA 3G2OA 4EB6A 2I2CA 2CWDA 4TWJA 4XQ9A 1QVZA 4YRFA 2G72A 4PF1A 4BAZA 4MPPA 1LDYA 1XF9A 4BY9E 5CURA 1PO7A 1YRYE 3QBDA 1EZ1A 3HSYA 2C2KA 1R88A 4I7EA 5JEDA 5K0JA 4X71A 4Y2GA 2H07A 1SO8A 3ZLVA 5T8KA 3HJFA 3N1UA 3V55A 2JHPA 2FZVA 3A9WA 3C8HA 1CB7A 1HORA 1X3LA 1WV0A 2HF2A 2I4LA 2YWFA 3AB3A 3C8UA 3I8SA 3QWIA 1DEOA 3PDWA 4H7DA 2MHCA 4IHAA 3T12A 1VPWA 4H7FA 1AHNA 1T4CA 2YV4A 3GGCA 3NHMA 3R3SA 4HOYA 4OHXA 4MCIA 3ME5A 1X7WA 4AKTA 5EMMA 3AR2A 5FFMA 2C4TA 2NU8A 3T7RA 1I94B 1DKRA 3ANNA 4U2DA 4TTVA 3KJFA 5EAIA 3SAJA 4J4TA 4IQ4A 1EK2A 4KEAA 4E5NA 2ZS7A 3KKPA 1GAEO 3TRFA 2QX7A 3DBIA 2YFHA 5AI8A 3R6GA 1CZUA 2YNMC 2GEVA 3BHMA 1JYEA 4KKVA 4XX1A 4K6HA 4RDHA 3DVRX 1ZOLA 3MC1A 4MYHA 2RJ3A 4COOA 3ER8A 2ZYIA 1C7JA 2WTAA 5DHSA 5LFAA 4CKZA 1M2GA 4EY6A 2H11A 1GL3A 2L69A 1JEQB 4P08A 1C9MA 3CX6A 2UUOA 2IKQA 1PS0A 4KWHA 1X8KA 3AW8A 3CE6A 1KI9A 1IMOA 2J5QA 4RIHA 2I1LA 3OT4A 3TLAA 2B61A 5K3FA 3REGA 4B47A 2AN5A 1RKBA 3I9V1 3T7SA 2HXGA 3THRA 4X85A 1F2UA 1MENA 2CVFA 8OHMA 2VDJA 5COAA 1V43A 1H1DA 4PPNA 1B0ZA 4P4SB 4M9CA 3UHJA 5K0BA 4LTNA 2FZKA 5JQGF 3BX1A 4LMAA 2EU8A 4IDDA 2WWTA 3AERA 4A2CA 1LLUA 2VTEA 1RRCA 2ZK7A 5FQNA 3OQOA 5JIBA 3EIUA 4W7HA 3ZY3A 1RLIA 2FPMA 4YMWA 2H06A 1KTVA 2WR8A 2XIJA 3VNBA 2O54A 1CV2A 3AR7A 3PFNA 4IO1A 2YHIA 3BSFA 2ZBRA 3MWGA 1J8FA 5L8VA 3RGGA 3VAAA 2Y3IA 1WS6A 4JOQA 4M99A 2HMVA 3F3KA 4NFHA 1V16A 4YCDA 2I67A 5HS6A 5IX8A 1SG6A 3NONA 4DTIA 1HDRA 2PIAA 1K5DA 2IS6A 3IR5A 1FW6A 3I04A 1B16A 2XOKD 4JYAB 1EHYA 3JYOA 2KJQA 2YBEA 4CEHB 1U8AA 4RETA 1CC1S 1R0WA 4O33A 3S2SA 1HFWA 1WPGA 1BE6A 1XCJA 2LNDA 3A9SA 4MITA 5AKLA 4RTRA 4MV8A 4JP1A 2QDXA 2C7PA 4KXXA 3DPSA 2A9JA 3AEYA 1DX6A 4NEGA 5GIPE 1OFUX 1WXXA 3PUKA 1WZUA 1A5TA 1CJVC 3GMSA 4NH4A 4OGGA 4UBNA 5LQMA 2XBMA 1YB5A 4JUBA 5DNYB 4AKGA 2FSSA 1L7RA 3HEMA 3KHSA 4C5BA 3H11A 5F2NA 4EARA 2L19A 2EQ5A 3KQPA 4XOIA 4BJ5A 2F7SA 2HSJA 2XUGA 3EFEA 3RNOA 3GJRA 2XT0A 3I8OA 4R2KA 1I01A 5JD3A 3AF0A 2YCLA 5BPHA 1NVVQ 1G8HA 1D6MA 5GZ6A 3PQ8A 1Y7TA 5DM60 3GLIA 4QO7A 1NF8A 3UUFA 3QP9A 3WIOA 2Y1XA 3SE7A 3LKVA 3H1EA 2OSBA 2EGUA 2J3MA 1XAGA 4GI3A 5JO9A 2GCIA 4HRXA 3QE0A 4J6EA 1QDEA 4B9AA 1T8SA 3OU2A 2ZRCA 1JEEA 1LI4A 3OWXA 4I55F 1P2TA 4UZFA 1J0AA 5TQ2B 4RY9A 3WI7A 3EVTA 3E27A 1XJ0A 4WJKB 4QUBA 3LYLA 3ZWXA 1P6XA 2BFMA 2CXQA 1UIMA 3H2SA 1ZD1A 4H6WA 2NO4A 7ADHA 1V5WA 1IJBA 4NJEA 1XRJA 2IEDA 2VRWA 1IEWA 4H9GA 3IEXA 2EFDB 4DB2A 4B85A 3K73O 4FHDA 1T9KA 1YCDA 4L5BA 4WW0A 1Y5IA 3K5IA 2QE7A 4P32A 4YJKA 5I5GA 5DV9A 1CS0A 3E1GA 5ESDA 4GYKA 2ZUWA 4OHPA 1GQQA 4QVKA 1MU0A 2VHTA 3ZWWA 4F9EA 3JQGA 1SKMA 4WKGA 1FPMA 3QU7A 1APBA 2GRAA 1R4MB 2PAFA 4OLJA 5DIZA 3Q4GA 4C0LA 4P84A 4NMWA 4Y2TA 3WWZA 5IC6A 4GR9A 2Q3DA 3AT1A 4LK3A 2I3DA 1VB5A 3ZDCA 1PZMA 5KAMA 1H69A 2QMQA 2QZ9A 3AKYA 4M1SA 5H59A 3DD5A 3EULA 4R2MA 2AMVA 2F3QA 3O84A 2RK4A 5BUCA 4KFTA 3EXFA 1XRMA 2JDIA 3UFXB 4DGQA 4Z1MD 1YQUA 2GZ1A 1NZJA 1T36A 2W5UA 2XKJE 4XLTA 5AVOA 5C8DA 2J3EA 1DBWA 3L7NA 1MV8A 1THMA 4NESA 5DEIA 1KZGB 3K9BA 3CX3A 4AJ9A 5BNTA 4F04A 4Z8YA 4Z9XA 4YRBA 1LW6E 3GEGA 4JT9A 2JS7A 2EOAA 1BGVA 2ZTVA 1XTSA 1WULS 3EIHA 5CA0F 3FYCA 1IY2A 3V1KA 3NASA 1DDOA 3ZKWA 1C8KA 1VE5A 3DZKA 3G5MA 3I9KA 5AMXA 4X94A 4X93A 2QX4A 2XLCA 2DTDA 4OK3A 1KJQA 3P9RA 1A97A 3PXAA 5KNBH 2PUFA 1HX7A 3OOSA 3MUEA 4M1WA 4YXFA 2YTZA 3DZFA 1F38A 4CMJA 2C5HA 5DNWA 3TSOA 2FLVA 3HU1A 3IAAA 3JYLA 4JLAA 1NM5C 5TJ9A 2TMKA 3GZNB 1ZM2A 1GPNA 2EFEB 5JCPA 1E3MA 3PIDA 2Q1XA 3KQYA 1UC5B 2EXXA 3D1JA 1KC1A 2WF6A 2PR7A 5ES4B 1EFVB 3JQDA 2GS9A 1GZ3A 3ELDA 1G63A 1ZJ6A 3WWYA 4YCMA 16PKA 4F92B 3K71B 5TQJA 1QG2A 2WIBA 4DDTA 2R5FA 2IS1A 4HBZA 3N6RA 4ZVKA 1SBHA 1ZWLA 2H2GA 3QTTA 1Q6ZA 1EVIA 3WMFA 1V8PA 2AC2A 2NYRA 2PSDA 1P4HA 5KDDA 4BWVA 2Q28A 2FUNB 2QPAA 1J0DA 4RCYA 1Y81A 3C3YA 1H2XA 4E6PA 2OT3B 1KRHA 5C80A 3JQEA 1TT7A 1DE0A 4H31A 4G37A 1BG6A 1INLA 1T10A 3DP9A 1KOJA 2XQJA 3H2KA 1RTKA 5HE9A 3SCZA 4DN6A 4ECAA 2OWEA 4YYEA 3VBCA 2RE8A 1JEJA 4RFVA 3ZDDA 4NU8X 2GVNA 2ZAOA 1H2ZA 1TTPB 1RAEA 3ML1A 3SS8A 1KOGA 1BVYF 4ZOLB 4CKCB 1YRHA 4WQMA 1QGUB 3U3XA 3S5UA 3DMTA 3DE5X 4D4JA 3F0TA 1PJBA 3MYRA 2VOJA 2YJTD 2RHHA 3U5ZB 2PKRA 1ZMTA 2RI1A 2X23A 2WYWA 3M6VA 3N0RA 3QNWA 4ZGGA 1YVDA 1VLMA 5HDQA 2HFKA 3NW9A 2EAUA 4PQRA 4AZ3A 3DYIA 4NNOA 2W6CX 2DR2A 2J0UA 2X9VA 1TJ4A 1EWTA 3B1FA 4CTMA 1V1MA 1FP4B 1QV6A 4J2HA 4CEIA 2P6NA 4OL0A 5K8LA 3MIIA 1CNMA 1FW8A 4YJHA 4H1WA 5CM9C 3ZWCA 1K0UA 2PT6A 2XH8A 3U9TA 2Z58A 5FPHA 2PUWA 2F9FA 3GEBA 2I2DA 2CMFA 1PVDA 1V7QA 1E7SA 1BKYA 1KHTA 2AMFA 2GDJA 1FRFS 2HCRA 3PYMA 1PSZA 2GAIA 3R0JA 4IZHA 1EDDA 1U0SY 2YJ6A 3LUFA 1L5NA 1X2BA 4S04A 4DAEA 1DS6A 4B4DA 4E5MA 4TZ0A 1WU7A 4MYSA 4UUOA 1H1TA 1RXIA 3I1YA 1P3DA 4Q1CA 1TIKA 4NEHB 1TZ2A 4PX5A 1H23A 4FYPA 3GLHE 3MZ0A 2ORYA 3F8SA 2AJBA 2YOHA 4GKJB 3DDZX 4HLUA 4D3FA 5IDYA 2BCJQ 2ZT6A 4TLDA 5DJ5A 3PDIA 3W8EA 3R3WA 4RULA 4BPBA 2J9FB 2Z6QA 3FNHA 4DV3B 2ZB4A 4Z9AA 1M6HA 2YOGA 1NT4A 4MLPA 1PTJA 2EHDA 2Z4TA 2I3AA 4J16A 4TWZA 4YUXA 1C7RA 5JYEA 4DARA 1ZOIA 1LU9A 4XTCS 2M98A 2H92A 3TQQA 5JD6A 9GPBA 1X7YA 1H8HD 3CRRA 2ZIUB 3HBFA 4KHZA 2E6KA 1B8PA 3L02A 3P9SA 2DBRA 3H2IA 4D02A 1U2DA 3C1TA 1AE1A 1VIMA 3KVRA 3Q6NA 4IS3A 1GGMA 1J8MF 1FS6A 3IFSA 4QWMA 4LZOA 3L9XA 1QVRA 1V48A 4OYLA 3H6KA 1T8PA 1L5LA 4QGAA 4E21A 3SY8A 1QKKA 2YC2C 3OM1A 3IUBA 1CT9A 1XA4A 3QVLA 4S0XA 4AUEA 3LDGA 5JAUA 3BGVA 1Y8QB 2ON6A 3ZIDA 4QOIA 1NATA 5JSZA 1IB6A 2H7VA 4CKEB 3ZUGA 5U4QA 2X2PA 2WJAA 1QQBA 1QFZA 5IFKA 1KFJB 1R6XA 3IVAA 2JLYA 1M0WA 3AJ9A 3A4TA 3OETA 5FA8A 3HC7A 4ZKDA 1IQUA 2GJSA 1A1SA 3BWYA 4Y2RA 3TZQA 5HG0A 2VJOA 3EVAA 2VC2B 4H1UA 1TEVA 5JD5A 3P96A 1D9XA 1FP2A 4MS1B 4XR4A 2ZYHA 4FB5A 2XRYA 4U9HS 2WLSA 2PZKA 4LX8A 4MX8A 2UZ1A 4FMPA 3ESYA 1HOTA 5JFTA 3TBKA 1T8UA 2WQZA 4BMZA 3MJSA 4YUAA 3BCRA 5AW8A 1HRKA 4KN5A 4ALKA 2KW5A 1CUDA 3J7TA 5J2UB 1L9XA 3FWHA 1UK7A 4LE0A 2GBFA 1CJCA 4BDTA 4ERXA 3I6QA 2VSOA 3K5PA 4M49A 1U4OA 4CMKA 4JYBA 3MELA 2LWIA 4J94A 4A26A 1M73E 3IDZA 1SKAA 4LRWA 1SUFA 1M66A 2IHVA 1ZR4A 1G6HA 2HUNA 4QUHA 4RNDB 4X3PA 1NI3A 3DTVA 3C7AA 4MR8A 3FPKA 1TE2A 2BCEA 3WLTA 4BGDA 1AH2A 1BN7A 2XDQB 5LMCA 2RH4A 2MYPA 4HAZA 1JI3A 2NTVA 2QDKA 3AF2A 3PSAA 4QDOA 1ZL0A 3PRYA 3GJ8A 1OV4A 1SU4A 2BEWB 2YICA 3DLCA 4C2BA 5CXQA 3GJSA 3MN1A 5JBNA 1XPUA 3G1UA 3KEFA 4RDIA 3L0BA 1TO2E 3QEMB 1S96A 4G09A 5KVAA 1QU3A 2W6NA 3UWMA 2D5LA 5EIEA 1JU4A 4E32A 2Q3LA 1O94D 1S2DA 2WAMA 1KKLA 4RD0A 4DLAA 1N8TA 3PX3A 4QU8A 1ZG3A 3RVMA 2HJRA 3G02A 3PC7A 4OJNA 3VNSA 2BFFB 3SZMA 1P7PA 2A53A 4L16A 4W5HA 2C9YA 1I6LA 3COVA 1WUHS 2MMGA 5FI3A 3CVXA 1EP1B 1P44A 1EUDB 2WV7A 2YASA 3FTNA 3KZNA 4UM8B 3ZHTA 4CV2A 4C7OB 7YASA 5DN6A 5FPQA 1YOVB 1M1XB 4XQCA 1SUIA 1V5FA 1YCHA 3KKZA 3PXUA 3W04A 3WSVA 4EGJA 4DOMA 5KQSA 3AIMA 4KR7A 1UBJS 3OH8A 3WLIA 1EJBA 3R9XB 4XE5A 3W5IA 1F9EA 4FJ0A 1UWKA 3W6UA 3MGGA 3H9BA 1EU1A 3EEBA 4ZRMA 2J1LA 3BM5A 3CKMA 3W06A 4WEQA 4EPXA 1MC8A 4F3CA 1G4AE 2BFNA 2GCPA 4EYSA 3SOPA 1TX4B 4F8EA 3SOZA 1OZHA 3GP8A 1F4VA 5EZYB 4FT4A 1SA0B 1GZUA 1DVRA 2ID9A 3G9TA 4KSBA 4PONA 5KTNA 3Q12A 1NN1A 3PQ3A 4P3YA 3VTAA 1U80A 1B0UA 3FLAA 1J2YA 4QDJA 5JW6A 1LVHA 4DA8A 4RH1A 2YRWA 2BSQA 4ND2A 2D1SA 4MGEA 5FUMA 3FX2A 1U2GA 5DO9A 3PNSA 3ILVA 3O1HB 3T3PB 3GQBB 2RD2A 3AI1A 1B4DA 4CCWA 2Q8PA 1Z74A 2OCDA 2EGGA 3O75A 3CH6A 3TXAA 4HUJA 3DV9A 1W36B 5EPUA 1IMJA 1OXVA 2W2XA 4CTJA 2G5CA 3OM9A 3WBJA 4DRYA 2UYHA 1T3HA 4IIEA 2ZR9A 3G68A 5JXHA 2ASVA 5DOZA 3IMCA 1D6JA 1KH2A 1M1ZA 4L4SA 1REQB 1GCAA 1N9ZA 4MW6A 1E6CA 1WUTA 1P17A 1KMNA 1D1TA 4H3KB 4YQZA 2V59A 1UBCA 4AZ0A 2HO4A 3L6BA 4HX5A 3E3AA 3QY0A 4JVOA 5KOHB 4ZAGA 1Y6RA 2QYHA 3FCCA 3N6XA 4GKAA 4DBVO 1DAOA 1K63A 1V1RA 3EZNA 1PNRA 4KO8A 4YRGA 3KM0A 1YHNA 2OQRA 3BWEA 1ZCBA 5H68A 1AV7A 1UKAA 2XTNA 3EJWA 3KKQA 4JP3A 4BFUA 1YS7A 3GJ6A 5AHXA 4KVFA 3SMVA 1KFEB 1KS9A 2FZLA 2JGAA 1H0KA 1T3LA 2JIRA 3C3EA 3EGVA 4RF4A 4BL5A 2RGAA 1Y8RA 3GO4A 1CBUA 3KXIA 1GSAA 4GGMX 5DVZA 3SBDA 6LDHA 5HHTA 4KR9A 1GA1A 1QLJA 2ODEA 1G59A 1QH1B 3OFVA 3QX3A 1VJGA 4TSRA 5TGTA 1C1DA 2OGSA 2BZSA 4AJEA 1E0KA 1SKBA 4ETWA 4U39A 2O2JA 1YIDA 4RF2A 2BHRA 4ZVTA 1JW9B 3LBFA 3WXBA 5LQJA 3KTOA 3OOJA 4UOZA 4O2LA 5TGDA 4B46A 2QX9A 2UZAA 4JJIA 3VR2A 1BS9A 1OLOA 4UHFA 5LZ9A 2QAIA 2YJ3A 1Z4JA 5KKNB 1UMBA 3G5AA 1FFGA 5JCJD 1NBAA 1D1PA 2NGRA 4L7VA 4ROTA 3VKHA 2HZBA 2JZCA 1ZS9A 3DO8A 4BJ3A 2PZBA 3NC4A 5J43A 5IT9A 1XMQB 421PA 2RHOA 3LDFA 2R1VA 3QYFA 4Q1BA 2SECE 3F90A 1XZLA 3A6JA 2HSEA 4L8YA 3R7FA 1HDCA 1OFUA 3I92A 5KSYA 2BHTA 1Y4DE 2JBWA 4LV8B 3FPFA 3DV0B 1U3WA 3PFGA 4R8MA 3ADOA 3GRUA 2ZYDA 1FSFA 1OI2A 1IEXA 3ZVRA 3FUWA 2H0QA 1L8OA 1Z6ZA 3QG1A 3QFTA 5ETJA 3AF5A 1RP1A 5TE9A 1JDJA 2OZEA 3UPTA 3IBGA 2R6JA 3DGFC 3EXG2 4PZCA 4CODB 1UJNA 4F2WA 1ZJ4A 5KSWB 1L5QA 3BQMB 4KYUA 2W70A 1PZXA 3R7WB 1MA0A 4FSHA 3K6SB 2FDRA 3H83A 3IBTA 3DAFA 1JYFA 2X8LA 2M6LA 4Q7QA 2QTVA 1GRQA 2I03A 1VHDA 3HNPA 3PI6A 1GADO 3V3KA 1KQPA 3K16A 5AXAA 3G1WA 3FFWA 3HI4A 3OCYA 4YJ2B 3W3ZB 1K5HA 5BUQA 3RYCB 2FKNA 1G2PA 1SXJA 4W8GA 3UAWA 4V1CI 2PKQO 3KT3A 4TKZA 2D5AA 1MTOA 3ULKA 4JXXA 3L0DA 1M0SA 4MVJI 5A6SA 2B21A 3EVDA 1QGAA 3LOQA 1GLNA 5AKZA 1BQEA 1H2BA 3TSAA 4G5FA 2IEYA 5ALYA 5AVYA 2Q9BA 3Q2KA 1CD5A 1UPCA 1Y1RA 4RSRA 1IRIA 3SS7X 2W71A 3JPYA 3K05A 3NM4A 3OZ7A 4QFBA 2NUAB 3N0XA 4LFCB 4QDKA 4O2RA 1QF9A 3PR1A 1JKJB 1MGOA 3A0RB 2ZWAA 2VUHB 2DC1A 4D96A 2A67A 3D0KA 2CBZA 4UZEA 3C5VA 2PR2A 1FXUA 3BL5A 1D2MA 2YN4A 3FTQA 5ECDA 3VO8A 3LZ6A 1G6OA 1N34B 2BLNA 2GZAA 3EUEA 1HKHA 4BZXA 1FVFA 4HXGA 3E8XA 3QVGB 2CE2X 2CSUA 3TECE 3ILXA 1O4VA 1XMPA 3EWNA 2UVPB 3PXBA 5AM1A 3BREA 1JFFA 2CFTA 4LK2A 1SPBS 5JS7A 1X77A 1TQ4A 1UWCA 3DO6A 1RBYA 1RE1A 3GG2A 4JMPA 4WPGA 1VPEA 3LCCA 3LWDA 4YJ3F 1ZJWA 3QYJA 4CZ2A 2JI8A 3K9CA 2YY5A 4LISA 1C50A 1OWMA 3EZGA 3AQIA 2FEMA 2C2WA 3AHIA 3NHJA 4EPTA 3U7FB 3QBTA 4YRPA 3IOMA 1Q84A 4G2NA 3D7SA 3SYKA 3ROMA 5K2OA 5F9MA 4J0JA 2WM2A 2XDYA 2WV9A 3OJEA 1OXUA 2CV1A 4L9SA 1ZU5A 4WFKA 4R5MA 2FEKA 3JR7A 2IY8A 4RD6A 1RWVA 1M2FA 5CFLA 3UAXA 3H5IA 1A8HA 4RPGA 1X7HA 3WGTA 1Q22A 3TI7A 4ML3A 1TCUA 4I1SA 4JJ4A 1UBNA 2AK2A 5DZSA 9LDBA 2ZPAA 2EEZA 1GWNA 5EHZA 5JS8A 4B3MB 1FFXB 3QFFA 3EBOA 3OQIA 4KQJA 1UPUA 4NPHA 4QUGA 4O4IB 2RGCA 2Z2IA 3RAFC 4EABA 3OSUA 5FULA 5K0SA 2OHHA 4O2AF 3SJ7A 2XV1A 3NDPA 1M1NA 2PD4A 4Z4HA 3ROGA 4IMIB 2BGNA 2COEA 3K96A 1S9HA 3BVPA 4MS4A 4W5TA 2AG0A 3JZAA 3AETB 1IM8A 3CY6A 3HKDA 4MAAA 2IV7A 5BSTA 4NBSA 2XMZA 4H2DA 4HNRA 3WJ1A 5C7YA 3CJQA 3H6GA 1M2JA 5A5DA 4KKXB 1KMCA 3W3AD 1M34B 4ID9A 1L5RA 2RHMA 3IO5A 3V34A 3ZX5A 3OFNA 3KETA 2F3UA 4MEBA 1Y5NA 2CXUA 3OCWA 3KUXA 5FWYB 1JALA 4F1WA 2O3JA 2ORVA 1WEHA 5CFMA 1G2OA 1ES9A 3IVGA 1NE2A 1Z2CA 2NTEA 4C0AC 1AV6A 3SN6A 1WBJB 3E7XA 4XIFA 1M33A 2XW6A 5LXTA 1QU2A 5L45A 4YRSA 4TL6A 2QW8A 4PSKA 5L4LA 3F6CA 1T35A 1DIGA 1H0SA 3HL0A 4LJYA 4O4LB 1Z37A 1SEPA 1E2MA 1UL1X 1X1RA 1AHPA 5SZHB 1A9OA 4ISBA 3KUDA 5J5CA 1U0RA 4RLFA 2IUYA 1JLRA 1FYXA 4YAJA 4DSZA 1MBZA 4LDAA 2FPGB 3CPJB 4JUDX 2NSHA 4TXJA 3DMHA 1KIFA 1PUIA 2FUCA 4KNVA 4QDXA 4D9CA 1BDBA 1NIPA 3WA7A 4ZT4A 3KELA 5JDCA 3R5KA 3EIEA 3ETCA 2R65A 1EE9A 3HR4A 1LV7A 4CCYA 3P8ZA 2IYQA 1YS1X 3H9CA 4I36A 4XASA 5KCMA 3GD7A 4NMXB 4AAYA 4DIKA 2C78A 1B15A 2C00A 4HDOB 4A8PA 4DC9A 1HMPA 1C7EA 4OB6A 3Q5GA 3A1SA 4LPSA 2VZ0A 1SRQA 4B83A 3G59A 1YT5A 5I48A 1TYBE 2W2PA 4XXHA 5DP1A 3N05A 2H4HA 3FJ1A 3DV2A 4HTFB 4INAA 1RU3A 1L1FA 5LQCA 2Y0BA 2QEQA 4HDNA 5FB3A 1QYIA 1BHSA 1P0IA 5K6TA 4EB3A 4G8BA 2W2VA 5LJIA 2CJWB 2H29A 1B76A 2Q4OA 4BFCA 4MI9A 4EIWA 2B9VA 5CDHA 1F4LA 2I0FA 2OYSA 3ZQKA 3C7DB 2AG8A 1DCKA 2C29D 2QN8A 4UTPA 3I12A 1AC5A 1YL6A 2P68A 1TM3E 2A1IA 1WQ4A 2Z2XA 3L8HA 1G21B 1XD9A 4KV9A 3WZLA 4C3OB 5EJMA 2PZAA 2QUJA 4LDQA 5BN4B 2AT1A 3ZIAD 5HS4A 1ODIA 3AOEC 4ITRC 2YS6A 5CX1B 4HATA 2Y1GA 1DWQA 4GH5A 3V9AA 3OF5A 4FZVA 4MWEA 4EY8A 3RFXA 2XD9A 1QAOA 4W1QA 2O0KA 1DAEA 2J30A 4UMFA 3ZVNA 4ZDIA 2KBFA 2W6OA 4IPTA 5DLQC 4KI7A 3WK4A 4ZGBA 4X64B 4BO4A 2GR7A 2BMJA 1IONA 1ZZGA 4FHFA 2ZJFA 1JHQA 4QD3A 1WPXA 4RVNA 4W9MC 4GXNA 2NO1A 1EP9A 4LJRA 1Y80A 1XKXA 2JEYA 2VATA 2B8EA 3BWBA 4K9PA 2CDCA 1YZQA 2D13A 2IYLD 1E94E 1SKYB 3AR3A 3D43A 1QG4A 2ZVQX 3M33A 4ZAFA 4CMEA 6CHYA 2A0XA 4RV5A 4C04A 1HYEA 2O6LA 4RNCA 5JZSA 2SCUA 3KD2A 1OH8A 3IT1A 3RS2A 4KIGA 2VTBA 1Z4LA 4RL4A 3OOHA 4V0MA 2HHHB 1RLJA 1YZTA 4LZZA 3S7ZA 2DLCX 1LI7A 3AEKB 2EZUA 3VISA 1GOTA 3V2UA 3ESXA 3M82A 1KYWA 3L43A 4EJ2A 2R2AA 4MVJG 1CPYA 3V46A 4DR1B 3OKFA 2P9ZA 1I3MA 5CYGA 5M7EA 5FQOA 1L7BA 4TKVA 4PG6A 1AZTA 1LRJA 2FP4B 4J0EA 1B14A 1E0JA 3BXHA 4MVJF 1JE1A 3JZDA 4IHJF 5JY1A 1ML3A 1XL1A 1I8TA 1HFJA 1POXA 1YONA 2R8BA 2ID7A 4W5WA 3ZNOA 4HPWA 2A7QA 2WU3A 3GWZA 2AMYA 4Q37A 5J23A 1ZIOA 5L3SA 1NBME 2HA7A 4LZAA 4JI3B 1VLHA 4KO3S 1JEOA 2BP7B 2VH5R 4WN3A 5FLYA 4QU9A 1B0PA 1Y33E 2DUUA 1XZEA 3WLKX 4IGKA 4XD7A 1CQJA 3QKIA 2JLSA 4JVNA 1OXBB 2I1WA 1DWOA 2XB9A 5DYWA 1N5KA 1NBMD 1ULHA 1S4MA 4B33A 5JH7F 1Y1TA 2QSYA 3CZ9A 4HDMA 3LNCA 3T34A 1S3GA 2VRBA 1L8QA 3ER9A 2D1YA 3FMFA 3MTBA 4MKRA 1N6RA 3NRJA 4N39A 3SXPA 5G1PA 4EY7A 5DGIA 5I3ZA 1NPDA 2QAGA 4UU7A 4ZVQA 3F7NA 2MSCB 4EYQA 1W0KA 1Z0IA 3OECA 2X2FA 4V0KA 3AKDA 4B75A 1B1CA 1U99A 3MCTA 1F60A 2OL4A 2VCHA 1ZM9A 5EMKA 1CY8A 4TLLB 3S0JA 1RQGA 3K8OE 3IAM6 5HMLA 1BJTA 1RS0A 3AHGA 5LQKA 3HCOA 3HM9A 2TYSB 4ETIA 2ZR8A 3CR7A 1CVLA 4C9BA 2VS1A 4GMDA 4YUVA 2QVCA 3WIBA 2IF0A 6AT1A 4OAOA 4PQGA 1XTZA 7GPBA 3FA2A 2QW0X 3LLCA 4ZI5A 2HU7A 4EPYA 3N2NA 1SJ9A 2C4VA 2H1HA 2QTWB 2WHPB 3C97A 2X0KA 3BHIA 1L8LA 2ZOSA 1P7VA 3FYHA 4YNBA 3IPXA 4PBSA 3IAHA 3N0TA 5DBOA 1OHHA 3LQYA 4GEKA 4JIMA 2XR1A 3K1AB 5AJWA 3R6LA 3ONNA 1TLLA 2BKXA 3QYAA 2HPAA 2PGJA 5EXPA 4ND4A 5K6RA 5H81A 1ISHA 1Y34E 3JAWB 3RJ5A 1P81A 3GQVA 3LF4A 1DO0A 1SWVA 4GS5A 4OMDA 4JASB 2FEWB 5LA6B 4BNYA 3ZGVA 4EYGA 2VXCA 3AR8A 3CTPA 1ZP6A 4NJMB 4PVDA 4PYKA 5ALGA 5E2AA 2VP5A 3IP6A 4MYRA 4ASUD 1FLVA 1W59A 2FEOA 4AXXA 5A4FS 4WESB 4Q3CA 4ENPA 2H2HA 1KVUA 5CHYA 1XXLA 2I4OA 2QNIA 2X0NA 5B1SA 1M5TA 5HM6A 5JYDA 4PCAA 4ER3A 2BKVA 4FX5A 4MYDA 4HL6A 3B3FA 5HP4A 4X1KA 3EUWA 3KLPX 2O8FA 4GLOA 4PIPA 3VR6A 3BUSA 1I0ZA 3N87A 5BPFA 3KKKA 3P9KA 2I2AA 2R79A 1W93A 3DW3X 1V5IA 1AKWA 2JLBA 1RCFA 2ZRAA 3B1WA 3BIJA 3QELB 3MPOA 5BSVA 4UCFA 1UAAA 4I1UA 1JLKA 3FVWA 2AN1A 3PIIA 4EI2A 5K3SA 2MT9A 4OX9B 3OO0A 4H7PA 4U7FA 3VR3D 3ZI7A 3U1TA 1FC0A 5JJIA 4YWJA 1G7RA 1HE8B 3TI9A 1QTIA 2RB5A 5KMGA 3U4QA 2X8JB 3BWXA 3PJGA 3CLRC 4O2BA 4CMIA 3RC2A 2PV7A 4AG5A 2WZBA 1HWYA 4MW4A 2D3WA 2GD1O 3HV2A 2Z30A 1TTTA 1S89A 1EFRD 1BWSA 5LB2A 1JQBA 2P2NA 1E58A 2CBXA 1BD3A 1M8PA 4JGIA 3M34A 5G40A 4AY3A 1YI1A 2ZRFA 5LYJA 4YV1A 2P90A 2C2XA 1GKLA 1QLWA 1ELOA 4AB1A 1FMLA 1BVUA 2C7GA 3BOSA 1TRKA 3DOIA 3PPYA 2CFCA 4MUAA 3RS4A 3T35A 5GOZA 1NF2A 2W2LA 4IIGA 3P27A 5HF5A 1N1MA 3P2MA 4ZEWA 5EUMA 4MR9B 4DW8A 5E2IA 3I2FA 3G7NA 2C9CA 1FMTA 3Q1KA 2WJPA 4WKNA 4EKDA 4WXHA 1YB4A 2A78A 2H51A 4B87A 3AR4A 1IZZA 3KXDA 5HJ7A 3S1LA 2HK9A 4F4CA 3SX2A 2OECA 3AP1A 1PFQA 2P1DA 1G20E 3T7EA 2YHAA 5FXMA 4DA4A 1XHFA 3ID6C 2I3BA 2IOFK 4DNFA 2E6UX 4AG6A 1QIIA 4H1VA 1O94C 1T6ZA 3UGKA 2AZXA 3IAXA 2CN1A 1FFWA 1LF5A 3X3HA 2W93A 1WKVA 2Z1DA 1W85B 1H9AA 1XI2A 2ORED 3QJ5A 3S1AA 3Q40A 2EIHA 3TLGA 4DMFA 1ECJA 3CO0S 1J23A 1CVRA 3KOOA 1SHUX 3HYTA 1EBFA 2GLUA 3WRYC 4J75A 4PAWA 1O58A 3QK7A 4ZT3A 3ROEA 2VDWB 1Z47A 3DLIA 4GPTA 2X5KO 4GP9A 4MKIA 4MYCA 4WZZA 5SV2A 3S4YA 3WTCA 4OG2A 2WWVD 4BP9A 5C3UA 4IZIA 2BGTA 1LFDB 2QYOA 1NLFA 2FMKA 3IQZA 2WF5A 4XH9B 4XIIA 3REFA 2NVOA 4B6QA 5AH0A 2P1RA 1DO8A 4O3MA 1EK1A 2FOLA 3PPXA 1GTJ1 2SBTA 2WU4A 4NKRA 3IS3A 4IMJB 1XP8A 5AOAA 4C7XA 4OYRA 2XXAA 4G24A 1OASA 4GE3A 1P1KA 1K7XB 2WJ4A 3QU5A 3O4RA 2QROA 3QX8A 4YMUA 3K2BA 5CLIA 1KO8A 3V2GA 4Q6WA 1NOIA 1VCMA 2CXPA 4L4RA 1F06A 1VL0A 4QC2A 4EJ6A 3R9WA 3EVZA 1GNRA 4UXHA 4M6WA 4OXNA 5CLQA 4ZALA 3UK6A 4KK3A 3MB8A 5SYAA 3E9NA 4L9AA 1HLGA 3OPYB 4DEXA 4LHSA 2GSWA 4A0RA 4UKDA 1B74A 2MYUA 4MRNA 5C34B 4BC1A 2XCQA 3D0OA 5IVDA 5IKMA 3EMVA 2HZ7A 3PRHA 3OHPA 4CG1A 3K70D 2NZ8A 5DWDA 3SK0A 4DV2B 2P8JA 4V24A 2C20A 2IX9A 3K0HA 4MWZA 1E2KA 3DPIA 1KYVA 2QNBA 1XE3A 3AWDA 3RS0A 3B2QA 3TPZA 4A0QA 3M2PA 3FMGA 2OK7A 3M7IA 3WMGA 2ZWIA 4MGKR 1QHXA 2X7XA 4Y0AA 2Z2JA 2FVYA 1SURA 2P9JA 3VPSA 4QA9A 2GEDA 4L0QA 3NHKA 5CVUA 4MNTA 2Q2OA 1DKLA 3LZCA 4IL5A 1E1KA 4JU9A 4MP3A 2UUCB 3A10A 2OCXA 4MCJA 2YRXA 4MA4A 3WSWA 4BQSA 2Z43A 1N7IA 4B1FA 3OQMA 2MSDB 4G4GA 2YNMA 1WXEA 5K51A 3KVYA 2IV3A 4KCGA 1PNQA 3UT5A 5FO1A 1TKRA 4BWYA 1E5VA 4F21A 1MZPA 1NNEA 2FMIA 4QO8A 3VJRA 4TV9F 2P75A 3JXEA 3LKDA 4IIJA 2AWOA 3TSWA 1FJXA 3G2IA 1R4NB 1UDXA 3PCTA 3G2NA 4EELA 3FBTA 2Z09A 5JANA 1MIOA 3C7KA 5AVXA 2QRQA 1GN8A 1O87A 1QP7A 4HWOA 1BS1A 3VPGA 4XKJA 5KNCH 1Q14A 2X1VA 5KJFA 3H5OA 3P4YA 5HQ3B 4OI4A 1G4HA 4Z6KA 4IOLA 3INTA 1T8TA 1VPVA 4KPFC 3W8NA 4Y9DA 1SBIA 1N9KA 1KK1A 3NBKA 2RHGB 3NC1C 3PEYA 4HSGA 2ZT7A 1D7AA 4EPWA 5LXTF 2A54A 4KFUA 3WJ2A 1TLFA 2V65A 4TRNA 5A7FA 4JV5B 3WRWA 1JR3A 2MU1A 4ZD6A 3SEZA 1KETA 1P77A 1MO4A 4EB6B 1CQWA 2PS9A 3FPBA 5BRNA 4OA5A 4EKNB 1EM6A 2YDXA 2CXXA 3LXUX 2VHVA 4UUQA 3SLRA 1RZRA 3IP7A 3AIIA 1FP7A 2VPYA 4DTCA 3ZHYA 2VF7A 1F8UA 2CLFB 2K87A 4KO2S 1RWKA 4LY9A 5ARDA 3VSDA 5JVDA 2E4VA 3DMNA 4CFSA 2HWWA 2HRZA 4DCTA 1JH8A 1UZMA 3FOAA 3H2GA 4F93B 4M9XA 4AXBA 1CY4A 1P9NA 1OREA 4M87A 4IH9A 1I5OA 3MMZA 4PANA 1T4CB 3UT0A 1DBSA 4RANA 4C0WA 1X7WB 1X9GA 1NL3A 1TVCA 4WZAA 1EK0A 2NU8B 3VOAA 3KQNA 3THXA 4U6NA 3OIGA 3CF4G 1XD2A 4EAAA 5IT4A 1E66A 3MBIA 4C6TA 1TI7A 2BUCA 4XUCA 1QCDA 3CSSA 3ZGYA 1SCNE 1J1UA 3LYHA 1FLNA 4MVXA 4ZV9A 1JPUA 3E7FA 3LPCA 3GMIA 1TUGA 1VA4A 3CCBA 3VC7A 2QP4A 4P5PA 2JAXA 3X1DA 1RAGA 3E48A 4Q15A 3ZX4A 1GNSA 1WXWA 4DCJA 3ANXA 5EHQA 1TZMA 3Q9UA 4E46A 4ZEVA 5KNDD 1JHVA 1JTVA 3PPVA 3VR5A 1J00A 1DEHA 1T34A 2SKCA 2XY4A 3GLFE 4F12A 5K3FB 3GF4A 3N70A 4X65B 4QVGA 5EUCA 2FZWA 3ER6A 4LRXA 1BCSA 3KZKA 5CX4A 5EP3A 5LP6F 3IL2A 1F2UB 2IELA 1XRPA 3S2IA 4KV7A 3S81A 4B32A 4M0UA 2AXPA 3HCWA 3JQ7A 1NRXA 3G49A 4NK5A 4LC0A 4OFZA 2J6BA 5ADVA 4U7TB 2PQ6A 2BOVA 1DXQA 3AERB 3MJHA 2ODBA 2XTJA 2GJ8A 4K86A 1L7QA 1MXFA 4RKRA 1KI3A 4D7AA 1DELA 2BFDA 3JWPA 2XI4A 1K8XB 4E3ZA 2AW3A 3LSYA 4TROA 1VL8A 2B3TA 5KVCA 2B4TO 2GO7A 4YN3A 3UB4A 1MO3A 3MUOA 2FLKA 2J32A 2YHIB 1ZISA 4GMGA 2F1IA 2PSJA 5JCZA 4ENSA 4GP7A 2YV5A 5IUJC 3F4KA 4DLWA 4MULA 1V16B 3UCFA 5C5EA 1LSSA 1IN4A 1P33A 2I80A 1O6FA 3A8TA 4KH1A 5F35A 3RVNA 1OGIA 3PC8C 1PHRA 3OZAA 1UEJA 4LWZA 1GEEA 4HP8A 3DF9A 1C0EA 2YJ4A 4GBMA 2OLJA 1R27A 1A8UA 4PYQA 3ODGA 2ZJAA 4U00A 3KB2A 2PX4A 2A4MA 4UUPA 3NGMA 1PG5A 3CN9A 4TMFA 3UBTA 5ICCA 5ED0A 3K0SA 2GAAA 1C7IA 4ZJUA 2AFIB 1SC3A 3N74A 4BU1A 2X7HA 1K92A 4WT7A 5JMTA 4NLLA 5JNVA 2DOKA 3HB1A 2LD4A 3HGMA 3ZU4A 3FMVA 1NR1A 1RRGA 2FTKE 2W6ZA 4QZVA 2GN6A 3VPBA 2G9ZA 1FTYA 2J7PD 4WK2B 5CLGA 5B7QA 4GD3Q 3Q8KA 5FRDA 6PFKA 1N1GA 2F8LA 3W6NA 3T1HB 2PMEA 3TL3A 3JQAD 4P3PA 3LOUA 1UBKS 3W2EA 3FUTA 4MB2A 4UXJA 1L5SA 4MWDA 3GLIB 3HYCA 3K09C 1ADFA 3EF0A 1KOLA 4FI3C 5JMPA 2IYZA 5AW9A 4IVNA 1NC1A 4EK9A 2FMTA 4IBOA 2EZ8A 1I7DA 1QFMA 4B81A 4POOA 2XNDD 3RTBA 4BNHA 3LGXA 2V3WA 4E2ZA 4P36A 4QU0A 3FZGA 2CLHB 1NM5A 2C4NA 5G4KA 3LHDA 1JDZA 1VRWA 5E9WA 1JDSA 5J5AA 3EB9A 3RKUA 4BBZA 4EW3A 5J2TA 1Z35A 2FN7A 2YWXA 4JGBA 4ZCQA 1RD4A 1PL8A 1D03A 1ZICA 4B35A 1MB0A 1UPAA 1SQFA 5IDQA 3R40A 3PEUA 2QZSA 3FNBA 4IX1A 3SX4A 2ILVA 3OA2A 1M7BA 4NJEB 4ZDKA 3TMAA 3IKTA 1J8VA 2CNWD 1ZXBA 4HAUA 4TUYA 1KR5A 4WADA 3C4QA 4BIIA 2IPXA 3HABA 3SX0A 3JATA 1XMXA 4A15A 1KZHA 3RS5A 1HNZB 4Z7OB 2AG5A 1CCWA 3KLBA 4QRDA 4U02A 1V4NA 5DSXA 1CS0B 3QFCA 5CT6A 3SQDA 1WPQA 2FSFA 1OI7A 3K7EA 4EHAA 1EP3B 2ONYA 1H6AA 3TVYA 2B4AA 1VYUA 3U4MA 2Q5EA 1G8KA 3JQGB 1EAYA 2XUJA 4S35A 4JLDA 4YTEA 5DTMA 4JQOA 4L28A 3O74A 1PNOA 5FWXA 1JUDA 2XXJA 3T5AA 4DLLA 1QHNA 2VZ8A 3TNLA 1RM0A 1XLTC 4WFJA 4QKQA 2AXNA 3CIOA 5HIMA 2PUDA 4YDHB 4FFVA 5CB0A 2H3HA 1VYHA 2OHGA 4I1YA 4MSUA 1F7UA 2DG2A 3DQPA 3TW0A 3TGPA 5LBTA 3UAZA 1Q7BA 1VLLA 2W42A 4NAVA 3C6BA 3GIWA 2AV6A 1T36B 3L6OO 3R0VA 2HHLA 3DCJA 4JSRA 4CETA 5I7UA 3V97A 3ZE9A 4QOJA 4UM9B 3PTZA 2XGMA 4EB0A 1SGWA 3CUVA 3A31A 3OWHA 5D2CA 3E3NA 5DIFA 1N5RA 1SU6A 4JBWA 3ZHZA 2Y4OA 5KSZA 1ADYA 3WDKA 2I71A 3ZKWB 4YPFA 3ZUPA 1D1SA 4KZKA 3ZU2A 1N2SA 3IUYA 1CS4C 1R8QA 2DFLA 3T5MA 3QBJA 3C16C 1ECCA 1DFIA 2JFYA 4M0PA 5CGQB 1U7XA 3NXSA 3D4LA 4WZBE 1MJHA 4DLVA 1NJGA 3PWSA 4RJKA 4JJ7A 3NP7A 4NAUA 4I14A 1DEAA 4JJFA 5EIFA 3SM3A 5A06A 2PX3A 1ULTA 1MRNA 1LDNA 1A96A 2C4WA 4Q39A 1NY5A 5EKXA 4C0QC 1NMSA 4N1AA 4ZKEA 1NYTA 3GPLA 1YS6A 1QFJA 1TZBA 4IDAA 4J03A 4G0ZA 4WSOA 4I8DA 4O2BF 3HKCA 4OFXA 5AD1A 2OHVA 1RYEA 4YCCA 4ZQCB 4CVNA 4WXYB 3SHOA 2HKIA 2VP6A 1MQSA 3ES9A 3PEEA 3RS3A 3OZFA 1NXQA 2AS0A 3HCAA 4LY3A 4BKQA 4CN8A 1I1OA 2MDTA 1OFHA 3BB3A 1EJ0A 3R77A 1D07A 1BMQA 1LDBA 3WNBA 4BRUA 1FRQA 4L72A 3WHKA 4DLRA 4LAFA 2QTAA 1BWPA 5JG7A 1SD2A 2O59A 1AQUA 1UKEA 2Q2QA 2Y1LA 1PRYA 1E1YA 4HMPA 3SJBA 2P2YA 4KG7A 1JKMA 4YQFA 3DR5A 4HB0A 1HXHA 1Q1QA 1SVNA 4WGGA 4UDYX 4HVCA 5TF0A 1ECPA 3TQOA 2JH9A 1R5BA 3QITA 4NBLA 4DCUA 1UBMS 4EWLA 3BF7A 4UTNA 1SWWA 2AHOA 3KKEA 3ORHA 1WY5A 1YZYA 1OTHA 2B8NA 2SKDA 3EBLA 4BLWA 2R60A 4BNZA 1XTQA 4U6QA 1X3SA 4KQXA 3GCZA 4AY5A 2GHIA 4AJPA 1LY1A 5LBUA 4F3RA 3WR5A 2PX6A 4AZ3B 4B80A 3GA5A 3KHTA 4RQUA 3RI3A 4N49A 1JVNA 3ZZUA 5H3LA 2V97A 2VDLB 1DO2A 3GAAA 5JJ5A 1V1MB 5TMDA 1XEAA 3II6X 4D4KA 3ILHA 3IYLW 4ND8A 3ADDA 3F7MA 2C5BA 4CEIB 3IA7A 2WWGA 1U5CA 4P0TA 4PYRA 2BFAA 3ZLJA 2Q6TA 4YJHB 5C1OA 2X0JA 3T52A 4TZ6A 2DULA 1G41A 1FX0A 2J0EA 2QRPA 1I3LA 2VYND 1FXWA 1X92A 4QTUB 4RKEA 3Q7QA 3VH2A 2UYCA 2OP0A 2Y66A 5FOTA 5AW6A 1P7CA 5JATA 2IYVA 2D0IA 4OIMA 3M9LA 4WXPA 3VVBA 2O2EA 3LTEA 2C4MA 4BPRA 1NW7A 5FBHA 2PXXA 4FCCA 3V8QA 2O2XA 4LRSB 6REQA 2VSQA 4OGLA 1KEKA 1I2CA 1UBEA 4UHDA 3TEFA 1CDOA 3AZQA 3I05A 3NIDB 4P35A 1AQIA 4HVLA 2OM6A 2YZKA 3WNVA 4PG5A 3SC2A 2XAUA 3L0PA 5TARA 1AF4A 1OAOC 2VPIA 4IUCS 5DU2A 2WLTA 2P4HX 1JT9A 2PZFA 3BD9A 3PDIB 4CR7A 1ECLA 1SIWA 3TIXB 4WCDA 3DT9A 3UG6A 3ZDZB 4C5AA 3S2YA 4B4UA 2G5ZA 5F2EA 5BNZA 2EQAA 2ZGVA 4PZAA 4XCQA 1XNQB 2XB2A 4JSTA 5HCNA 4U2BA 2O2DA 4IDFA 1KA9H 3V8BA 2JD2A 1X7YB 3VHXB 1JG7A 5LNK1 2GNPA 3A1EA 3V8RA 3A04A 4BQPA 2RB4A 1EVEA 4WJLA 2PVSA 3IVMA 4YMTA 3FMPB 3RJMA 1EFKA 3HJBA 2BBWA 3NV7A 5KO2A 3ROXA 4FYVA 2UYOA 3HNOA 4QL3A 1K8QA 3BWVA 1DCFA 1SZCA 3G2QA 4DUGD 3DYBA 3A05A 3E22A 5HGXA 2HRQA 2GZRA 4I5FA 3U39A 3LIPA 4OKIA 1ZQ9A 4JEUA 3HN2A 1I7QB 3LZDA 4ZCSA 5JSZB 2VP3A 2Z4SA 4QG3A 4GEGA 3KOZA 2J6CA 5TVGA 1P7ZA 2PKXA 3GRAA 4E12A 2JGDB 3NVMB 1YQTA 2WJVA 3ETDA 3EIFA 2WFMA 4NONA 1NNI1 2E4YA 4Q34A 2NV2B 4LXTA 2VJAA 4AL4A 1WMAA 5CDYA 2E18A 4UHBA 5MN6A 3K35A 4QRIA 1J99A 3T3DA 1HM5A 1SZPA 3GEDA 2O7VA 2VA9A 3AL3A 1RXYA 2HY7A 1YZNA 1W5BA 1W5AA 3DBHA 2A1TR 1A9ZA 4IO0A 4OAQA 1IHOA 2QD5A 1XX6A 3R4VA 4IRXA 4UD2A 4UCXA 2UZ4A 1JLHA 2CDBA 1PHPA 4GBJA 4KBYA 2XGGA 2OO7A 1SQSA 3CF2A 3FZYA 3D3NA 4IDOA 4F9TA 4Q3KA 1Z6AA 2XVMA 4MUKA 3RU9A 4WNIA 4IM7A 5HFAA 2C2YA 1KH1A 4FS3A 3A3NA 1DTEA 2AIRA 4FSXA 4E2FA 4PN3A 3MAJA 1JBKA 1SBZA 1ST3A 1LKZA 2PS1A 2WSSD 2Y0DA 3DTVB 1Z7BA 4MR8B 4LSGA 1NV8A 2OV8A 3EPRA 4C4YA 1HOXA 2EP7A 2P41A 1WCV1 1BSVA 1P1JA 4FWBA 4OMFG 1J07A 1DKQA 3HN7A 4B3HA 3F7TA 4B76A 1N9GA 4RH0A 2IIBA 3I76A 3K1JA 4J1TC 4XQ0A 3U7QA 1C2YA 1R6DA 4INJA 4YMGA 2FG7C 4RUKA 1Y9DA 4LHWA 4X1OA 4F06A 3MWJA 3C3KA 4D3SA 4B3TB 3HJHA 1HDIA 1GU0A 2H0RA 3A2MA 4UASA 2YJNA 1FDIA 4XRGA 1WA5A 4ZICA 1VXRA 5JECA 1ISMA 3ETJA 3UUWA 1E5LA 3TS1A 1U1EA 2J3JA 2PH1A 1C3VA 3RSOA 2NP6A 1IN8A 2QR2A 2WP8J 3BK2A 2R3SA 5CDTA 3RARA 3U16A 1LTHR 3IOEA 2PRJA 2Y1EA 1JWLA 1KAHA 5EKSA 1Z33A 3IHKA 3ZTTA 3L7IA 3HDGA 1NI4A 3DWEX 2R4UA 2FV8A 2QD3A 4KTTE 2HHAA 3L8FA 1RYDA 4MWTA 2A3RA 3D9QX 3GEHA 3H7IA 1ZI6A 2C8KA 3FHJA 4EBBA 4RTKA 1MB3A 4DEYA 2FWMX 3U19A 1Y8ZA 2X1HA 1R10A 2VPQA 4FGSA 2CLCX 4TRMA 3IP9A 3HO1A 4PSUA 4YO7A 3EQZA 2F9LA 4NOKA 1FCJA 2VWGA 3YASA 1KAQA 3ZNNA 1UMDA 2C84A 4MR7B 2A0YA 2O6HA 1OC2A 1T2FA 3AI7A 3HRKA 2IFTA 3HDJA 4J1QA 4DPKA 3C15C 1PGQA 1NQTA 1WZIA 3GPIA 3HEBA 4IQGA 3HXTA 5DE3A