4MULA

Crystal structure of pantothenate synthetase in complex with 2-(5-methoxy-2-(naphthalen-2-ylsulfonylcarbamoyl)-1h-indol-1-yl)acetic acid
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of Inhibitors of Mycobacterium tuberculosis Pantothenate Synthetase Based on Group Efficiency Analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
total genus 93
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2013-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4mulA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mulA01
1NYLA 4UZEA 4KR9A 2HGZA 3P0IA 3N05A 3C8ZA 2OQ2A 4MW2A 1JEDA 1GLNA 1WXGA 2DXIA 3IOCA 4AS1A 2WQ6A 4JXZA 3OP1A 1O0BA 2RD2A 4ZCRA 3QTBA 2X1LA 3PNYA 3UC5A 5IHXA 3FOCA 1KKUA 1KAMA 4MUKA 2QUHA 4I6JA 3D6VA 3S3TA 4R2LA 5TS2A 1T9GR 3RFFA 3I05A 1S4MA 1QTQA 4MUHA 5F23A 1JEEA 2ZUFA 4ZT3A 2X0KA 1OBCA 3MXTA 4MQ6A 1NUSA 2HMAA 3PNVA 1J70A 4GU5A 3ZJVA 4ARIA 4MWBA 4R2MA 3ZUGA 1R6UA 1K4MA 3IVXA 1Q19A 1O96A 1OWLA 4MWDA 3AFHA 1N2BA 3DV2A 1WY5A 3F3MA 3M5WA 1KQNA 1BS2A 1EUYA 1VBNA 2CV1A 4ZCQA 1O96B 2AG6A 1N78A 2D54A 4OJMX 2DETA 3FDXA 3ELBA 1QRUA 3P52A 3GMIA 1GAXA 3AIIA 1J20A 1LW7A 3A04A 3G6KA 2OV4A 5TGTA 1KQOA 1TYCA 3IMEA 4EG6A 3CVYA 1EFVA 1T6XA 3IMGA 3VU8A 2A1UB 1M83A 3MMXA 2YY5A 1GTRA 4MW4A 1U7XA 2QUIA 4I6EA 2YWBA 1T6YA 1B6TA 5FO0A 1O97C 5LLTA 3A4IA 3COVA 2V0GA 3TZLA 1N2GA 1G8GA 4XSVA 4MUGA 5LFAA 3CVXA 1K97A 4QREA 1MB9A 3TS1A 1NSYA 4KPUB 3CVVA 2QUJA 1H1TA 2HZ7A 4ZCSA 1YI8A 2O5RA 1GZUA 2CYCA 3SDBA 1M8FA 3HFJA 5DB4A 1U3DA 2C5SA 5AHWA 4JXXA 1PG2A 2GKSA 1I2DA 5J58A 2IJGX 3DO8A 3IUEA 1XJQA 1MRZA 2J08A 1NUQA 5TEVA 2E0IA 4ZT4A 5DK4A 1NUUA 4ZCPA 1JECA 3H97A 1WXEA 1WZ2A 3U1VA 3CVWA 4K03A 4OUDB 1NUTA 1J1ZA 1M8GA 3CLTC 2CFOA 1YIDA 1TYAE 3CA8A 2G36A 1IQUA 4MWCA 4EG1A 1U7DA 4RUKA 4MUNA 4KR7A 3HMQA 1X6VA 1JGTA 1O6BA 3BL5A 3MUEA 1OD6A 4MWEA 4MVXA 2D5BA 4KKVA 4UZFA 3LE8A 3N9IA 4HJXA 1JMVA 2X1MA 2NSYA 1R6TA 1VLHA 1MOPA 4CQNA 2ZUEA 3CLTD 3GUZA 1GTSA 3IVGA 1MJHA 1O94C 4U8HA 3FY4A 5BNZA 3FIUA 3TQOA 4MW6A 2BYTA 3DLAA 3X1KA 1QU3A 1IHOA 2PIDA 4CDMA 1CT9A 1ZH6A 1VL2A 1JZQA 1KH2A 1GN8A 4ND7A 1H3EA 4MULA 2PZ8A 1WXIA 4MW0A 3RJZA 1ZH0A 2A1TS 1COZA 2PG3A 4HK4A 4G6ZA 3FHJA 3IDFA 1WOYA 2CYBA 3G59A 2IELA 3INNA 4DE5A 1PFYA 2CT8A 1O95D 3FG9A 4F3RA 1KQPA 1N2EA 1X8XA 3HGMA 4JZYA 5DASA 4MW7A 4YP7A 4A91A 4U7JA 3ZJTA 1IQ0A 3OTWA 1XNHA 3ND6A 4L2IB 3PNBA 4Q93A 4PBSA 1SURA 1MAWA 2YXNA 2X3FA 4PBTA 2R5WA 1YUMA 1QRTA 1QNFA 4H3SA 1KP2A 3KT0A 1K4KA 2V0CA 1MBZA 1N77A 4NX2A 3TQIA 3QE4A 1OBHA 3MLAA 1KR2A 1GPMA 2A88A 2CV2A 1KAQA 4OUDA 5HUJA 1JIIA 4EF6A 1IQRA 4QRDA 1U3CA 1FFYA 3GLVA 1Q77A 3KT3A 4HPWA 2H29A 4PY2A 3FWKA 4TS1A 3LOQA 2EL7A 2ZP1A 4I6GA 1T6ZA 1VBKA 1KH3A 4EG7A 1TQ8A 4JFAA 3CLSC 1NURA 3SEQA 4EG3A 1DNPA 2EJCA 1Q15A 2QJFA 3MLBA 4MUFA 2Z09A 1N3LA 5KCMA 1F7UA 1Y42X 2WB2A 1N1DA 2GOYA 4ZCTA 1O94D 1M8JA 1UFVA 1T9GS 4MVCA 4J75A 2VXOA 4J76A 2BTEA 1F9AA 2J5BA 4EGAA 2A1UA 4S1OA 2A84A 3E27A 3SZ3A 3UY4A 1NI5A 3UMVA 2RE8A 1J21A 1QJCA 4F4HA 1PFWA 3PXUA 3CLUD 2QTNA 3AL0C 1M8PA 1EFVB 3LCJA 3P0HA 1N2IA 1LI7A 4EG8A 3RK0A 2AZXA 3IVCA 4MLPA 1EJ2A 5IJXA 3AKZA 1TEZA 5KWVA 4AQ7A 2WQ7A 3A05A 2B7LA 1FYDA 1M1ZA 4EG4A 3COWA 3FI0A 3L92A 4MW1A 3UOWA 3QTTA 2E89A 1NUPA 1QRSA 4ZT5A 1N2HA 1A8HA 1HYBA 2H2AA 4U63A 2VTBB 1O95C 1H3FA 1XNGA 1U0BB 4ZT2A 4WNYA 5LM3A 3H99A 4L2IA 2XRYA 3N2YA 3PRHA 3X1MA 2AKEA 3CVUA 2D13A 4DNXA 5K0TA 1LI5A 2PFSA 3SEZA 3KFLA 2CV0A 1QU2A 4KR6A 4QBTA 2QUKA 4MVYA 1ZUNA 3D6UA 1N2JA 1MC1A 2J4DA 1N2OA 1G8HA 2J07A 2JANA 4ND6A 1KH1A 2A4MA 3NV7A 1JZSA 2NZ2A 4NAHA 1F4LA 1H3NA 3X1JA 1IRXA 1NP7A 4X0EA 2DLCX 3ZGZA 1ZJWA 4KPUA 2DERA 3FETA 4MW9A 5KHAA 3RK1A 4BWVA 5FO1A 4ARCA 1EFPB 2J09A 5K0SA 1WXHA 3HV0A 5FNZA 2JAXA 2CYAA 3SP1A 2I1LA 4NAUA 1O0CA 3ILVA 4DDHA 4MAFA 1QQTA 4ZT7A 5JBNA 1JILA 4YMIA 1N75A 1EXDA 3IOBA 4P2BA 3H9CA 3AG5A 3AG6A 5DEOA 4DLPA 1YUNA 1RQGA 3IH5A 3ZXIA 4DJAA 3DPIA 3JXEA 4CDNA 2YWCA 3HZRA 2A1TR 2DUMA 1JHDA 1IFXA 3KT6A 1Q11A 1J1UA 3ND5A 1ILEA 2JA2A 1PFVA 2CUZA 3CLUC 1PFUA 4G5YA 2DEUA 3ISJA 1I6LA 2A7XA 2O8VA 1XNJA 3IUBA 1EE1A 2IP1A 1TYBE 3VGJA 3RBAA 3ZXSA 2VTBA 1IVSA 3K32A 4MVWA 3ZJUA 1O97D 1OWOA 4XFDA 4HJRA 1F7VA 3SYTA 3CLRD 1IH8A 1JIKA 5H7XA 3IOEA 1WQ4A 2Z3VA 2PZBA 1OWNA 4NZPA 5HUHA 1WJGA 1WKBA 3UK2A 5J59A 1I6MA 3IMCA 2XRZA 1V8FA 4E1AA 2QJTA 4MUJA 3RHSA 3TZEA 1EFPA 1P7PA 4NDAA 3Q12A 3P0JA 4G5FA 1KORA 3CLSD 4JYZA 2QTMA 1R6XA 1TYDE 1ULHA 1K92A 4K0RA 4GRIA 4DDMA 1J09A 4DDKA 1OWPA 3H05A 1NZJA 3H9BA 1VBMA 5TEWA 1TFUA 3COZA 5HG0A 4WSOA 1KP3A 5H16A 2QJOA 4EG5A 1YIAA 2E18A 2QTRA 2PZAA 4MW5A 1I6KA 2TS1A 2A86A 3N8HA 2WSIA 3NBKA 3ND7A 4NATA 5J5AA 3CR8A 2Z08A 4PBRA 1YULA 1JIJA 3KT8A 4FZJA 2DPLA 2PXHA 1EUQA 2GM3A 2E21A 4MUEA 3NBAA 3FH0A 1G59A 2CSXA 3Q10A 3K9WA 3VRHA 1M8KA 3ZIUA 4CT0A 3TNJA 3A2KA 3IODA 4RPIA 3FNRA 4XFJA 3CLRC 2DR2A 4EFKA 5EKDA 3COYA 1MB2A 4YP5A 4MUIA 3G5AA 3HL4A 4YP6A 1O5TA 1D2RA 3SZGA 3L93A 1OWMA 1MAUA 1G8FA 1PG0A 4Q16A 1WXFA 4YBRA 1V47A 1WQ3A 4ZT6A 3Q4GA 4R0NA
chains in the Genus database with same CATH superfamily
5E4FA 1UK7A 1MO6A 2VEDA 3HL6A 2QTWB 2V3WA 4GXQA 3BE6A 4PCAA 3C7CB 4YAWA 3C39A 3RAEC 4XUGB 4MCJA 3A7DA 3FLAA 3TOVA 1G8AA 4CKCB 2XV1A 4B7UA 1ZUD1 2XGGA 3E2PA 1P3DA 1QBKC 1VLVA 2EJBA 2EF1A 1T8PA 1EK1A 1ZNWA 1FB5A 3CKKA 3SQLA 1W48A 1XTBA 3UCEA 4MJXA 3HG7A 3W3AA 4RE6A 1A9YA 1QGED 1RYYA 4FFMA 2VJYA 2HHLA 3IIEA 2JFNA 4LDPA 1PG5A 2JKVA 1HE1C 4IDAA 3BE5A 4PZLA 3ETGA 2J46A 2G3YA 4YECA 3W3AH 4CIAA 4F5ZA 4W5QA 2V5AA 1BDJA 2R68A 4DEXA 721PA 1HPLA 3O5AA 2BI7A 2GBPA 5TS2A 4DWJA 4RTRA 3EGXB 2X0EA 2F48A 4M86A 2YHAA 2O6HA 2X6QA 3FZYA 1IPFA 2W8ZA 3BMNA 3GJSA 4KXXA 3UXYA 1Q0TA 4R9RA 5LQRA 4LJAA 2F59A 1OXVA 3TOXA 3K70D 4MR7A 4TSKA 3LY7A 3BH6A 3WP1B 3ELYA 1OA1A 1ZX1A 3DMRA 3MMPA 4G1VA 4HUQA 4QNMA 1LSJA 5IKXA 3ZJVA 2PT6A 4MRMA 4JI1B 4Q4AA 3CUEF 4LOKA 4KSBA 1KI6B 4NZNA 4YWHA 3T6KA 3U81A 2QLBA 1Z4QA 2ZDQA 2AJDA 3WDMA 3GDHA 1P4HA 5AJUA 4MWDA 5DU2A 1VL1A 1C3LA 1QUFA 3B1KA 1Z62A 3DV2A 3R5XA 3VH3A 4IHAA 1I1NA 1EUYA 3CKMA 1HDXA 2G5TA 1VBNA 4D98A 3FOAA 1YVDA 4OXKA 5LA6A 1GUYA 3E3LA 2OZEA 2AG6A 3U0VA 2YWGA 4BBPA 4AZ3B 4BB9A 3NUGA 1B3BA 5M29A 3KR0A 2R6CA 2FW1A 2C2YA 2RG7A 2A35A 1AK1A 4TSRA 2RI0A 1OFVA 1B7GO 1QHFA 1U7ZA 1RD4A 4WX2B 1VSUA 1MOSA 3GW8A 3INTA 1Z68A 5NLLA 2OYCA 1DKOA 3UKOA 3E3NA 3BTUA 2H5EA 3T3DA 3VR5H 3JQGA 1MH1A 1U2TA 3RF7A 3B20A 1Y8RB 1TUGA 1XLTA 1Q2XA 3C6MA 3RVNA 5CLLA 4ZYLA 1T1JA 3K0KA 2O2CA 3NYRA 1P2TA 1AN0A 2IYEA 3I9KA 4UEQA 1JH8A 3LV8A 1AIPA 4RHEA 4JP3A 2XCSB 4OQZA 1GZVA 3BD8A 3CV3A 3OT4A 2YZ2A 1M2HA 3EDOA 4G63A 5C1DA 3T1HB 2IEYA 3QF7A 1QYIA 4X9XA 5FTKA 1W0CA 5M2QA 1EEHA 2ZIGA 1JVNA 3MCZA 4KG7A 1XP5A 2LKCA 1PSZA 2EWMA 4B3CA 3HRKA 5DSTA 3B60A 3P4YA 4YREA 4IUDS 3ZE2B 1LDNA 1PBTA 1I0ZA 1M8FA 2PUTA 2X40A 2C5SA 3OZWA 5KYUA 3WZ2A 2XZOA 1PG2A 3WMEA 2VP6A 4YXWA 4YAFA 2GQ0A 1RTTA 3RYHA 4DSUA 1G9TA 3KAJA 2NYRA 1GYPA 1KDOA 1QVRA 2YOFA 2E0IA 3G82C 3O94A 3PTZA 4Y2JA 1RRCA 4PPGA 4CUZA 2GF9A 2CHEA 1XTSA 3BRWA 5DGDA 5TVGA 4K2AA 1H2AS 4RV5A 1IK4A 4K03A 3L8YA 3RRYA 6REQA 4TRNA 3M2TA 3C85A 5IWAB 1U94A 2CFOA 2E82A 3PYXA 4J8PA 4AK9A 1GQRA 3W5BA 3K5IA 3KQKA 1C9EA 1W2GA 2IZ0A 3FNEA 2Y93A 4PLPA 5A9TA 1K2VN 4MGKR 4EJSC 2RBKA 3HRIA 1GP2A 1A2QA 1H0RA 1UANA 1LH0A 2CW5A 2GMWA 2SBTA 2A3RA 3ANTA 3HMQA 5L7YA 6REQB 2HR1A 1KRWA 4N5NA 3DAFA 2ZIXB 4RS3A 4LKRA 4YRMA 5KDLA 1LDEA 1C7RA 1EP2B 4RA9A 5JEDA 1L5SA 1ULSA 2WUVA 4I4IA 2JZCA 2WM2A 2X1MA 2GRUA 3HKDB 1TUIA 2CNWA 3DULA 4C9BA 4RJTA 5EJ5A 2CNBA 1VLHA 4QOJA 1DO0A 2O54A 2Z1NA 1XZNA 4BFCA 1WBDA 2FRDA 3DDUA 5BWNA 1VZ2A 2LTAA 3EISA 3NJRA 4MEAA 3KO8A 1NXSA 4KWCA 4RIGA 4DA9A 1ZIDA 3BAZA 1MW9X 2QXTA 3I9FA 2G7MC 4Y6GB 4C08A 4MW6A 1EAYA 1OIWA 2PRKA 2HX1A 4ND4A 1DC6A 2XMQA 1Q7CA 3LTNC 4KFTA 1VPVA 2WJGA 1U3FA 3TOCA 2BGMA 3DDSA 3P2EA 5EXXA 1JQBA 5HRCA 1QR2A 3I92A 4B6PA 4C3ZA 1DQPA 1ZH0A 3A0UA 5AK4A 3AIKA 2CXOA 3DLPX 2CDBA 4MARA 2PZKA 4C2TA 3JYPA 1COZA 4HK4A 4JJ6A 4KP7A 1ZUWA 3T9DA 3ZI4A 4BVEA 4RIEA 1Y3CE 3L84A 1XD2B 3LU1A 2I7CA 3T3NA 6CHYA 4YR9A 1ESNA 3KJNA 1EHCA 4HGOA 4QLAA 5LQSA 1A98A 3UB2A 4QJBA 4CFYA 3EHEA 1ZW6A 1EAMA 1N2CE 3HA7A 5JVDF 4DV4B 4WCDA 2NTVA 4RA6A 2I5PO 4BO7A 1JNYA 5JCJA 4AUNA 6GPBA 1TKRA 2QPAA 3NV9A 1GPUA 2VA9A 3HCOA 3P32A 4ON9A 3TGLA 1XD9A 4JJ4A 3W8EA 1D8TA 4U7JA 1JFSA 1MGOA 1PWZA 3MJFA 2YASA 3R6WA 2HA5A 3TLGA 4JU9A 2X3FA 2YBDA 2R5WA 4BKRA 4W5RA 3M81A 3W5CA 4BHRA 4BGEA 1ZA2A 4EI2A 5CT9A 4BLUA 2V0CA 1SKUA 5K05A 2OCDA 3FMPB 3N74A 5GOTA 5JROA 2G9NA 1F0NA 4HYEA 1N77A 2PH5A 1NX9A 3EXHC 2PJDA 5EWLA 2HBZA 3N7UA 1KSJA 1CVRA 4WFIA 1GTMA 1QS0A 3PZBA 4EZIA 4JKIA 5CIYA 2HIGA 1H1DA 3E9YA 5G4LA 4YV2A 2WTBA 5A6SA 5IT9A 4C78A 5LYYA 1OJLA 1L1RA 4ARUA 4BO1A 1ISHA 1H9AA 1UQUA 4JJFA 4D4GA 1YHNA 4IBOA 1CUXA 4O59O 4KUHA 4PNEA 3HCCA 3UUWA 4DLWA 1PU2A 3L7JA 3HY6A 2J0SA 1XJ5A 4PSUA 1PDVA 4PSAA 3WGVA 3W3AD 1T6ZA 4JV5B 3KYIB 3SX4A 2LDBA 4WK0B 1DPGA 1NBWB 2H4FA 3SHQA 3A32A 2PKQP 1JHRA 1T6BY 1P7WA 2CLHB 2R48A 2V9PA 2Y1DA 5AOAA 3DEIA 3S2ZA 4CV3A 3GLIA 4WW0A 4IV8A 4OM7A 3W5UA 1MXHA 4B74A 2ZOSA 4I8XA 3FNIA 2E48A 4WZBE 1U4SA 1WAMA 2VBFA 4ENPA 5JSUA 1SHZA 1GR1A 3AEUA 1C8KA 4R84A 2YW9A 4F0JA 1VPTA 2UAGA 2PU5A 2Z43A 3AY7A 2CHVA 4XB2A 1SXJA 2BEVA 2VP5A 2ZI6A 3Q1LA 4RF2A 5D3MA 5DV9A 3ZEAA 4EHDA 4PG4A 2PX3A 5I45A 2QP4A 4E30A 1M6WA 4UTXA 4D6XA 2LDXA 3QY0A 4P3OA 3OECA 1JG3A 2QE6A 3WTCA 2HQRA 3WGNA 5F9FA 5CA1F 5IHPA 1EXMA 2K5UA 3VXKA 5AW6A 5B6IA 4NCNA 3SZ3A 2HT6A 1ND5A 1Z07A 4J0IA 1ATIA 5JSZB 1ZOOA 4Y7DA 3GO4A 2PZGA 3T38A 4F8EA 1OGJA 2RCYA 1V0JA 1U0EA 1RQXA 1RPAA 4KFSA 2ZVDA 3SFTA 3EH1A 1VSVA 3DMTA 3CUVA 4ISCA 5COAA 5REQA 2QTNA 3I6MA 5HP4A 4I1PA 2JFUA 5GM2A 2G0TA 1T5HX 3AR6A 3R44A 3QZUA 3DHNA 1MV8A 3L8ZA 1QRRA 3MBIA 3IE1A 3JYQA 1T9CA 5BYJA 4NOLA 4CMEC 4BNJA 3SWWA 3H65A 4R8VA 3U13A 1WCIB 5ENVA 3BWCA 4F72A 1JTEA 2B5OA 3PFFA 3QUTA 5JYBA 2LXNA 1JI3A 5IJXA 1TIPA 3ESDA 3NBZC 1RKXA 2DQKA 5ICEA 3GLQA 1FS6A 3EVAA 2QTVB 1CY7A 5J2UF 3UOWA 3ZCSA 3F1KA 4P0PB 2CDRA 5KHOC 1QUEA 1VRCA 3QYFA 2A6PA 3RS5A 1KJ8A 3IB6A 4LJKA 4CL0A 1Z4JA 4WBNA 5K8CA 1QRSA 3NFRA 1TPZA 2Q6TA 3ZWOA 1IY0A 1U2DC 1YRAA 1AHIA 2Q0QA 3A2LA 3AINA 4U63A 4EZBA 1K8QA 2RI1A 3RQSA 2NX2A 1FXWA 3NYWA 1P6UA 3IAAA 3MWDB 4IYRA 2P9FA 3FYUA 3RFUA 4GYWA 4BRSA 1HA3A 2P3LA 3GCZA 4G89A 1NXWA 4N18A 4QSHA 4DCUA 1CFJA 3MC1A 3GIWA 4WGGA 3WHLA 2HQBA 3Q3IA 4P81A 3R3YA 4EYGA 2NSDA 3B6EA 4MQBA 5BV1A 3LVFO 4LF6B 1GZ4A 3HUUA 4FINA 2GHIA 1PLLA 2BVNA 4FE4A 5CFOA 4S1TA 5AXDA 3H5VA 3IE0A 3H5TA 2Y1GA 3RVSA 2AN3A 1Q7RA 2R1ZA 1EVKA 1HDEA 1M7HA 1TX4B 1YJQA 3PGVA 4GX1A 4ILEA 1YFKA 2M1ZA 4ND6A 2WPDD 5CW2A 5ITZB 2F3QA 1J8QA 2AZ4A 2I3BA 4UUMA 2BE7A 4UBKA 4KIWA 5CFPA 4OJQA 3LO8A 2VT2A 1Z0UA 3EDRA 5IVHA 2WIFA 4OP3A 1FP6A 1FRFS 1KJIA 1OV4A 2Q45A 2B98A 3SDSA 4XFKA 2I8LA 1AA6A 3MINB 5DE3A 1MO4A 3QVUA 1XXHB 2G72A 4KO8A 3WK7A 1US8B 2ID9A 3DHYA 1GRQA 4JP8A 3AWDA 1UFQA 2B61A 3NJ8A 4OEHA 3Q3JB 3KQNA 3KZOA 3RTBA 2YVQA 2Y1XA 3CLKA 4R9SA 2QLFA 2R60A 2FUEA 4FTWA 1PEYA 5G0TA 1LJUA 3R3JA 7ADHA 3DAOA 3HV0A 3I3OA 1CUHA 4O0MA 5K9ZA 1QH0A 3CZAA 3L6RA 2A54A 3HUTA 3V5NA 2GVZC 3D4IA 1CHNA 1SUEA 3LXXA 5CFRA 1O9BA 2BBWA 1G5IA 4YMIA 4AJ9A 4D9KA 4QUIA 4U6QA 2VT3A 1XAJA 3FR8A 2A92A 5FYQA 4UM9B 3RB8A 2AE2A 3AHGA 4P31A 1NQ5A 2ZBEA 1QK5A 1Y3IA 5CBPB 3MK31 1W87A 3A6LA 4OQMA 4AW9A 3PLNA 3V2HA 1BE0A 5KYYA 1ZMTA 5EPEA 2WMYA 1VL8A 4HNAB 3RTGA 1EMDA 1BWQA 5EFOA 2ZT6A 5BR7A 1U8YA 1G38A 3F5FA 2IUSA 4W5WA 4BQQA 2B4YA 1ZBQA 4DG5A 2OZPA 3STVA 2OCPA 1G5TA 3ZV4A 4BCDA 2FPOA 2NO9A 3T3PB 3UOGA 4MMXB 1TZMA 2IEBA 5KNCD 2QD4A 1NVAA 1X0XA 1PR6A 3DXZA 1XELA 2EZ4A 3B3GA 3PCXA 4GQIA 1RFLA 4M8KA 4CQMA 4CEHA 3OJLA 4AX4A 3N2GB 4UUQA 4PZZA 1OWOA 4Y1FA 3N3BC 1Z6TA 4X66B 1XBTA 2YMMA 4NY1A 5E4YA 2RKOA 1COWD 4MYDA 4F6RB 2VRCD 4MGIR 2DHQA 3PFCA 4CM8B 3LBYA 5A3JA 5K6AC 3KR1A 1DWUA 3OZGA 3UQZA 4DC0A 1WKBA 1VCOA 4RPGA 3RHFA 1RRPA 2Q8QA 1UQTA 4O4IA 3WQBA 1AXEA 1N9KA 1E3IA 2DPHA 2DCMA 2E4AA 3LECA 3H4TA 1PGQA 2WJJA 2IXGA 3V4RA 1YB7A 2IHZA 1UIRA 3L1KA 3W05A 2OGSA 2RHBA 4JYZA 3MAGA 1EFLA 4PXSA 1SCAA 2B37A 2PXXA 1PYGA 4WADA 1NG9A 2ZZMA 3CIOA 4G8CA 4P98A 3RREA 2HK6A 1DAFA 2OO5A 4TYQA 4WBXC 1IXYA 4IH9A 1VHQA 2HUPA 3LY5A 3ISVA 3LHIA 4UMDA 1Y4UA 4LC9A 1V25A 2VUIB 4R7ZA 1E1RD 1MX5A 5HG0A 4BIMA 2ZAYA 2WR8A 3E5RA 2YWXA 3TB6A 2AYXA 3GNSA 3ESAA 3FTDA 2DY1A 2GCNA 1XTPA 3B5JA 1M76A 2QJOA 4QX6A 3AK4A 2BCGY 3SS9X 4C20A 1MH9A 3SE0A 2WMNB 5HOEA 3L0YA 2ET6A 3EMDA 4ND5A 3QPCA 1X9GA 1Y8ZA 1QLWA 4I7EA 5FPQA 2HTEA 1TVEA 3KT8A 4G4JA 2G6TA 3K73O 3ESZA 5ERGB 1SUFA 1NBMD 1VCHA 2QX4A 1PV4A 4POAA 2C4UA 3OCUA 3OZUA 1ZONA 1WEHA 2D7DA 5DEIA 1JTVA 3VRHA 4D9NA 3FZQA 1SG9A 1U0GA 2WVAA 2X0IA 2SHKA 4QYWA 5DNCA 1DZIA 2VTDA 2CHQA 3WOVA 5IK2D 2I3ZA 1HF3A 1SOUA 2FPWA 3AR4A 7REQA 4J9VA 3KZVA 3QKSB 4U5XA 4J0HA 2L69A 3N2NA 3OOSA 4PHTA 2YJ4A 5F98A 3THSA 3HL4A 1II8A 1FLAA 4I0WB 4G4SP 3BIFA 3L1VA 3CRMA 4XQGA 4ZOAA 2IYRA 5GONF 4TL6A 2GH1A 3H9UA 4YBRA 1P2GA 3MYRA 2C92A 4PTYA 4PN7A 2SECE 2F8SA 4N5LA 5E3HA 3QU7A 4G0MA 4CLXA 4DUPA 4QYIB 3A25A 2RGUA 5KKCA 4LXGA 1J8MF 2R1TA 5K6TA 3HK2A 4FIDA 4EO4A 3L41A 3L7YA 3N76A 2KB0A 1Q0UA 1KERA 4S0ZA 3FOZA 4BNLA 1UODA 1YBFA 2EX0A 3QKSA 5IWCA 1P4AA 3CSUA 3S28A 3PXAA 4N9WA 4UREA 3HPRA 4REMA 1O1YA 5B5SA 3UC5A 1O6FA 4A2PA 3OPVA 3EX7C 4LVNA 5DBHX 1UC8A 4PICA 3V1YA 2GILA 3K0FB 4I50A 1TO1E 5TJ9A 3WYAA 1SPXA 4R1LA 2XWQA 4YJHB 1A8IA 5KQMA 1RMTA 2W4MA 4KQKA 4COOA 4IL5A 4OA5A 4UEKA 2GO7A 1KDPA 4FFPA 1EI9A 1T36B 3FKJA 5ES4B 3I62A 3SHOA 1VLZA 1PWEA 1OY1A 3CNLA 3LVBA 2P9JA 4CG0A 1PSDA 1XZPA 4HAOA 1QTQA 4NJOA 2A33A 3RRJA 2YMPA 3LPMA 2GYYA 4HXYA 1DC7A 4ZN6A 3LC2O 2BKAA 3KUCA 1E2QA 1U1DA 2JJQA 4KE7A 1ZEMA 1XKQA 3LVRE 1PJBA 2J0UB 3IFSA 3P0RA 2FMTA 1K4MA 2W22A 3PS9A 1FFEA 5K45A 4M7RA 4ZGWA 3T54A 3K8ZA 3N2LA 1M7BA 1VGQA 1GFIA 4GKAA 1KQNA 1ZGCA 4HLUA 5T4FA 1MO2A 3PQFA 5AM3A 1J39A 1ZIOA 2QE7A 1S3FA 1N25A 1SCKA 2R8EA 1S89A 4HDMA 4A2QA 5KX5F 5C52B 3MWEB 2EFEB 2GRAA 2X0DA 2Y1KA 2A0WA 3WGMA 1C80A 2P0AA 3RI3A 3WLSA 5KNDH 4WLUA 5LZ2A 1LSUA 2QAIA 2Z5FA 3AEKB 4N0EA 4RGVA 1I2CA 4O02B 2F3RA 4IG4A 4BQNA 5EN4A 5CRIA 5A5VA 2W2NA 4NI5A 3CRVA 1CERA 4LC0A 3U60B 2I4LA 3G6KA 2XMZA 1OPXA 1GR0A 3OU7A 621PA 2ZB3A 3NCTA 3ORRA 3SFVA 2W2VA 3ZZNA 4F46A 3V46A 1RE0A 2C4NA 2N42A 1U7XA 3D31A 1XJCA 2C78A 1G4HA 1CZOA 1WWKA 5K2MA 3HCWA 1O97C 4J4TA 3RIEA 2X2PA 4G5HA 4BO2A 3HTXA 3Q2KA 3HU2A 1U3WA 3VSAA 4OUKX 4B80A 1K97A 3L1UA 5M3BA 2AI1A 3OIDA 1X7YB 3PQ7A 2DBVO 5HFJA 2Y4OA 3U7QB 4B4KA 4M8IA 4XZ3A 2ONCA 3D4NA 3DZKA 1M0EA 4IJMA 3TCKA 1YI8A 2Q3LA 3ZGLA 3PUYA 2Q1YA 3EWNA 3SIRA 3U4AA 2W6IA 3BICA 1QP4A 1P7CA 1T25A 2IBMA 2PUFA 4YIHA 1CEEA 1UZMA 1X39A 5TXGA 4PGGA 4JL6A 4IXMA 4PQRA 3K5WA 4R1OA 4UU0A 4GZMA 1XZMA 3FI9A 4WVLA 1R5JA 4GI1A 3RVOA 1G17A 3U37A 4J3JA 4EABA 5FFNA 5JXHA 5FV4A 1S9DA 4UQLA 3OT5A 3U1VA 4MROA 2X6RA 1J1ZA 4FC7A 1VOTA 4IIJA 2P5TB 1JXMA 4ONEA 5J23A 2R6R1 4MO2A 4AZSA 2BHTA 1P1IA 2NO1A 5LLDA 1WU8A 1E1MA 1GNTA 2P2DA 1MF7A 2QD1A 3MW8A 4HAXA 2C95A 3FB1A 3V4ZA 2GD1O 1QZZA 3ZVRA 4MAAA 2ZYRA 1VPDA 2CBGA 1JGTA 4C3VA 5BNTA 3G2KA 1TKAA 2YN2A 4FYMA 1USGA 3Q40A 1ADGA 4MGYR 4TWIA 3VR6D 3BMNB 2D2FA 5JXWA 3DZJA 3LE8A 2PSHA 1UJ4A 2QXYA 2F9LA 4B8ZA 4D42A 1TA0A 1R5NA 3K9QO 3OIUA 3ZH9B 2FPUA 2PCJA 3ONFA 1S96A 1CF9A 2IYNA 3H2IA 2W2XA 3L02A 3L7AA 1YR7A 1WPGA 3RYFB 4B6FA 2HSJA 5BV7A 1RLTA 4QJIA 3RR2A 3WNQA 3SQNA 4DA7A 1E32A 3WLHA 3G8CA 3MFQA 2HF7A 2I2FA 1SJ9A 2H1HA 2QL7A 2RGCA 4Y9DA 4BVLA 4OI4A 2XVAA 2FWJA 3JVIA 4BJHB 3NHJA 1HO3A 3ZHOA 1JZQA 1XZCA 2E5WA 3DP7A 4REOA 4EA8A 1VIMA 2X9VA 2PEZA 2PZEA 3LPAA 1PK8A 1NI3A 4L8YA 3RJZA 1PS8A 5KOHB 2D06A 4MR8B 4CLEA 1ETUA 3QIAA 3GRAA 2JLUA 5ADVA 3WLOA 1S3SA 2XDQB 4FGLA 1Q83A 1WZNA 2QYOA 3IP8A 3O8BA 3U3XA 3TVYA 3T3MB 3DMPA 4BNYA 3RS3A 3RVLA 2A5YB 3ZYZA 3GVIA 4DB4A 4BLWA 1AO0A 3S44A 3JVVA 4EEXA 3KXDA 2YKGA 4IDFA 2QAGA 2DR0A 3A1DA 2I67A 2BH9A 1L4LA 2HUNA 4LYYA 1UK8A 3TL3A 5C3UA 4YB8A 3ZE1B 4C0SA 2XXJA 3SS8A 1CVLA 3SCZA 1O95D 5DM70 3TVDA 5CYOA 1SBIA 2W48A 4PO3X 3ZE6A 1I7QB 1K4YA 1A97A 3FTCA 1W93A 2QYTA 3HGMA 4BGVA 4UD2A 4WVFA 2CL0X 5KTTA 3F71A 2GN2A 4CU2A 2XBMA 5FUQA 2C1XA 2PL1A 3RS4A 2BGJA 5KVQA 4XX1A 2OBMA 3IXMA 4NOJA 3OCJA 3NBMA 3QPVA 1A9SA 2VAMA 2ODTX 1KE2A 2JCSA 3TWOA 1K3TA 2CHFA 2R4UA 3HDHA 5MFPA 4UQPA 1QRTA 3KG2A 4FGUA 2FQQA 1VGVA 4GLJA 1QHHB 3HV2A 3UXEA 3TBFA 5I7OA 1ODCA 4RIFA 3UM9A 1RRFA 5EXTA 3USCS 1X3SA 1BDIA 2RI6A 4NX2A 2X9GA 4D9IA 1QGAA 4WI1A 5CCXA 2ILTA 4ZD6A 1ZIYA 1A4RA 2GRJA 1ZN8A 3EA5A 3BWBA 4PFSA 5EJAA 3DO6A 3H6KA 2DLNA 5JYCA 2HJVA 3I42A 4H6PA 3NHRA 1VI6A 5BN5A 3GXBA 1G1MA 2J4CA 4WXPA 5AVXA 4LYAA 1H8ED 3RF6A 1M5TA 5F51A 1NF3A 4CCAA 1QHHA 4DRZA 5J2UA 1JYSA 1F4PA 3IBGA 1GUBA 3ZV3A 5BSFA 1AG9A 1CE8B 2B8NA 2QRPA 1JKIA 4O1MA 4V0NA 4XD2A 4D0SA 4DCOA 2XKBA 4EUSA 4YT4A 1PJ8A 2FPIB 5FUXA 2EJCA 1G9SA 1L7NA 2XQIA 2VNJA 5B58C 2BFPA 1RJGA 2ZIWB 3G8AA 2CSUA 4BGIA 4DA0A 4WZ6A 2FMIA 5EWJB 3AEKA 3H1EA 1KRHA 1Y42X 1YE5A 1ZVMA 5CHYA 3NXSA 3U7EB 4KNVA 2YS7A 2V7BA 4IX9A 2DGDA 2HXSA 1UFVA 2GJ9A 3QU4A 4H60A 1A8UA 2XQJA 1V4NA 5E9WA 1AM4D 1QHIA 2H1OA 2XF2A 2A1UA 4HY3A 4LK3A 3ZV5A 2JVKA 3OA2A 3P2KA 4IRXA 3TI7A 1OTYA 1IOWA 4TKUA 1NI5A 5B3AA 3EB9A 3HADA 1U2ZA 3EXEB 3R1IA 5LQDA 2W6CX 3BIJA 3AETA 1Z15A 2BGUA 2FN4A 3EK2A 3LRPA 1YRYE 1QJCA 3C98A 4K9KA 4RO0A 4YAEA 2QENA 3EBOA 1GSHA 2WU8A 2V97A 4LV6A 4M60A 2BPOA 3CLUD 6YASA 4N48A 3RW9A 1JQJC 3PI6A 2ZI3A 1FJ2A 3IAXA 3I72A 3STXA 3SAJA 4RANA 4YUXA 2I6GA 5BSGA 5FTMA 2RK3A 3A6HA 4GD3Q 4BX3A 5BUCA 5IAJA 1QGYA 1TEXA 3PSHA 3IPLA 5J5CA 4C89A 2EJTA 4Q3LA 3MVEA 3PVZA 2MWMA 4IVNA 4CLRB 5J2TA 1VIYA 3AL2A 4QXPA 3NALA 3M0EA 4QRHA 3ZZTA 3ZCQA 2EP7A 4Q7QA 3JYOA 4G1UC 3AHCA 2HLDA 2QPOA 3LT4A 2C3MA 4GMGA 2MYPA 5SY4A 1FE8A 1KI1A 1DUSA 3Q87B 4MWZA 4PF1A 3U9TA 1Z33A 4NCIA 4BLPA 2X8WA 1KYTA 2XQGA 2OXEA 2C20A 4FWBA 1Y8QB 3RFCA 3QELB 4KDCA 2VQEB 1EU1A 3AHHA 3FKSD 3PCTA 2NACA 2YJTD 4DMGA 3NNSA 3PJFA 4FMCB 4FILA 2H7YA 2JAHA 4PLFA 2HBYA 3QEBZ 1RRGA 4EP1A 4QBFA 1A8HA 2CLMB 2QLNA 4G0ZA 2YHSA 1SC9A 1GTZA 3A3KA 1FDRA 4ZP1A 4D0NA 3QXGA 4QPNA 2PZJA 4EY4A 3Q5DA 3H0KA 4UNIA 2X7JA 1J99A 1NXTA 1RIFA 2ILVA 3GN1A 4I55A 4NE2A 1MA0A 1DU4A 1JFFA 1OBOA 1R3DA 1T9DA 2NNLD 1CCWA 4R1NA 4EF5A 1QG6A 4MDEA 4MQFA 1FFBA 2P6OA 5TMDA 3TLCA 5JAQA 1SK9A 2WM9B 4IVRA 5ECGC 4XYEA 2UXDB 4IGKA 3TD6A 2QRVB 1T3HA 3FUWA 3H8VA 5CXUA 1CX9B 1UJ2A 3DBLA 1NWHA 3I39X 4FHDA 2Z2XA 4Q47A 5TGDA 1NW8A 1G5RA 1ZUNA 1YR2A 3QBJA 2ZWVA 4XQ9A 2OFFA 2XZLA 1IRIA 4HDCA 3U0BA 4H7KA 3HR7A 4HDNA 4KV7A 2XMSA 2J4DA 5LDDC 2FZ5A 4GEKA 1BZYA 5AW4A 1X77A 1ZEJA 1PFQA 1R1DA 4XWWA 4L1KA 2I6XA 2B4TO 1L4GA 3I01M 1XK6A 4G1MB 2BFEA 2WWIA 3MCTA 1O95A 3WLQA 2HWYA 3ZQ4A 4Q37A 4RD1A 3JQAB 1DEAA 1R6BX 4IQ4A 4ZEVA 1C0EA 1L8OA 4D4HA 2JZNA 1YA6A 3TLJA 1VBFA 1AU9A 4ANFA 3C3XA 2WI8A 3ELUA 3QVTA 4XWYA 2A9PA 3JWGA 5PGMA 4P0TA 3VMMA 1NBMA 4LC1A 2FUG6 1ZO8A 2YJ6A 2R5NA 2GN1A 1AQUA 1UBUS 2ZUUA 2ZUVA 2PX8A 3KM0A 2CYAA 3PDHA 4FYWA 2BC9A 3SIWA 4F84A 1NJ5A 4UOEA 2G1JA 5B4VA 3WGQA 1IZ8A 1VE6A 4CM6A 2QRQA 5CCEA 4ZI7F 2J9XB 5DP2A 1D1PA 5JI2E 1W46A 5TQJA 1FSZA 4LI0A 2W4IA 4G8JA 1YUNA 5BPHA 4M9UA 1YVPA 3BQNB 2G17A 3LUKA 5KKNB 5AK6A 3PFHA 1U8CB 3BRCA 1VCIA 2ZWMA 2ZTSA 4I3HA 2VQ3A 2XTNA 4HEA6 4P32A 5FEMA 4TLLB 2AA3A 2DUMA 4BMDA 1TQDA 4H27A 2P4UA 3MM4A 3PICA 1CRZA 3LL7A 4C03A 3UYLA 2I33A 3TW8B 2CF6A 5F12A 1AJEA 4KMSA 2A7XA 1W8IA 5LXTF 3ZVMA 1JB1A 3P96A 4BFLA 2JFPA 4G5RA 5JS7A 1VRVA 1IZ9A 3IDSA 3UNXA 4PC3A 5BQPA 3VTKA 2FHPA 5BWBA 1C7JA 4GRAA 3I1IA 4RV9A 1Y4DE 4UHCA 1Y9ZA 5FWXA 3TLKA 5ALPA 2Z4SA 4V0RA 4BLQA 1YUBA 5L6LB 1KU0A 2Q4DA 3Q7EA 3ILXA 3QMPA 4UTOA 1Q6YA 4H7FA 4DHEA 3KFVA 3R0JA 1DC3A 2CCGA 1Z4LA 3GNQA 4H17A 1FDUA 4AY6A 3DE3X 3MT8A 4MUJA 1QIGA 1QIHA 4IKPA 2GLTA 4G5FA 1SXQA 1KORA 2IT1A 1NM5C 1WVMA 3S7TA 3ROXA 5JD4A 2DR3A 3BGSA 4MRMB 4WTOA 4JLVA 3VYVA 1IULA 3U39A 2ZE7A 2HRDA 3QPBA 4KGXA 2GUWA 4RFSB 5EMMA 2I03A 5TY0A 5GJVC 1W25A 3AKCA 4JOQA 1H8EA 5SY6A 1ODSA 2CNLA 2AI3A 3COZA 1N5JA 2IBSA 3R7FA 1KP3A 3EWAA 4TRMA 1Y8CA 3O93A 2VATA 2HH9A 4I50F 5H16A 5DNAA 5LQJA 3DOUA 4FR2A 5CBKA 1CZHA 1EG7A 2PQMA 2TS1A 1UWLA 2Y99A 3AH8A 3RUAA 4US0R 1B1CA 2JJYA 1RWMA 1IBCA 4OYRA 1SD5A 1AGNA 2UU9B 3NP7A 2D5CA 1IEQA 2ZSUA 2PKRA 5ALFA 4C7JA 1G291 1O77A 2AW5A 2EARA 2CSXA 3GU3A 4UM5A 1Y34E 3BXEA 5IC5A 3HXLA 2P7HA 4WZBA 4FGJA 1QH8A 4OOFA 2QR5A 1D1TA 3H1AA 3GLIE 1PJ3A 1ZM3A 4YMSA 3N5CA 3FNRA 2KBFA 3JASB 5T5QA 3I4CA 2OM2A 1CUYA 2P6RA 3PQ4A 2XKKA 2BM9A 5DTMA 4GL2A 1E18A 1JPJA 3QXXA 3HU1A 5DYTA 3OFKA 1JKMA 2YVAA 2XSZA 4NU5A 2OC9A 2OLJA 1C0IA 2OD2A 2VT6A 2PEYA 3GEBA 1HBJA 2GPAA 3MEQA 4X61A 2H5IA 5GV7A 5SZHB 1CDOA 4Q16A 3CE6A 3Q3HA 2VEOA 5BN3B 1NWCA 5GPBA 4G9BA 5A3SA 1QVZA 3BWDD 4R41A 3FM9A 4DYVA 4CM4B 2AOTA 2CWWA 1IATA 1ZOIA 2CBXA 1FX1A 2WA1A 1KZHA 1HE4A 2IHJA 1W1UA 1RAHA 1ZK4A 3QOWA 1DQSA 4Q01A 4ZOLA 1SOVA 1P5ZB 2GS9A 3HJRA 3R76A 1P9NA 3LLSA 3VR2D 2E1RA 1IY1A 3SG0A 2UDPA 2QMZA 3K9BA 3NIWA 4BCBA 4YXFA 5DHAA 5JW6A 3D6MA 1YRLA 4KUGA 4DPKA 3A06A 3SZMA 2PGAA 4NVRA 4PO8A 5EIBD 5LXTA 3GK3A 3F4LA 3EIQA 3LHKA 2OSVA 3GUVA 3KU1A 4EJFA 5KQGA 3OIFA 1WMSA 3OUTA 4F91B 5JALA 1CS0B 1YHZA 2XECA 3W77A 5B1HA 3BZWA 1AKMA 2F1IA 2GM9A 4J16A 4QU9A 4R6WA 1UXJA 4IX1A 4Y6PA 5I7EA 2E6UX 5LZ4A 1A0OA 5EMKA 3ZWXA 1KVQA 2YXDA 1PNOA 1E2JA 4NCAA 4A0GA 1VMAA 1XROA 3I4LA 1CU1A 4LBVA 4IXJA 3GDGA 3UFXB 4R2MA 1E2GA 1KQGA 3I01A 4KK4A 4MO9A 2YYYA 4YCDA 1WEKA 1SBCA 4D9BA 1EIWA 2V7QA 5IBCA 1MVLA 2D00A 5I7SA 1MVOA 1Q1GA 1SB9A 1CXZA 5AHOA 1L5YA 2I80A 3DZDA 3ICWA 1HEUA 1M2OA 3OEED 2BBTA 5BRAA 1YZNA 4O4HB 3N1UA 3GPLA 2K2QB 1DIHA 2IRWA 2JCXA 4KVAA 1YZHA 5CM2Z 1UWCA 1G3IA 4XCXA 5TQ0A 5C2JB 3IP1A 3NAZA 5D3KA 3DT9A 1ZVVA 1C0KA 1YDHA 2JFZA 1G8KA 2OBBA 1D2GA 2PKXA 3BORA 2I22A 3HB4X 3I6QA 2VXYA 2GHRA 3ONWA 4G09A 4UCXA 1J20A 1D9ZA 4KQGA 1KSGA 3OQVA 5C34B 2FY8A 1NVBA 4DR1B 3DEJA 1SBYA 2ZUSA 5F3RA 3ZWMA 4L8LA 4Q4JA 4DV0B 1GDTA 2H06A 3AZOA 1OX4B 3V48A 1E3EA 4LFBB 3HP4A 2A1UB 4KN5A 3VVBA 2W6PA 1ATZA 3BWYA 3ONEA 1T6YA 1WVGA 3U3MA 5C7OO 2WRZA 4OCZA 2AXPA 3CT6A 3GCWA 2GPTA 5CYGA 5LLTA 3COVA 3CGGA 5E38A 3I34X 2I4MA 2OLKA 2ZB4A 4IZIA 5TQ0B 4XSVA 4RGYA 3TVTA 4QQRA 3WYFA 4Z4EA 1KJQA 2A3NA 3M4NA 4R2JA 3CTMA 1JG2A 2O3UA 2XQVA 3K92A 4S1WA 3TS1A 1M5RA 1SKYB 1D6JA 1TZ2A 2AQHA 4A6EA 4DRXA 4IEEA 2XE7A 3RSSA 5HUQA 2CYCA 3JPWA 4NARA 2I2DA 5LUAA 1QV9A 2ZSHA 2QJRA 2WFZA 3HVHA 1NIJA 3GRFA 4JXXA 1XCPA 4ND3A 3MJTA 1AT1A 1ZD2P 2GKSA 1P4GA 2CF5A 2H59A 2O2SA 2W6ZA 1XJQA 2ZTMA 3WWEA 5JZMA 1NUQA 2I34A 3D54D 3DDOA 1XMXA 3V00A 1NN5A 3IMFA 2I52A 1QS0B 2GFQA 4O0LA 3RGWS 4RA6B 4ZAFA 1M1XB 4YRDA 2J87A 3TZ6A 2FOLA 2GA9A 1O8BA 1ESEA 2CXPA 3NAGA 1T5BA 1N5OX 2HCRA 3KXPA 4WFJA 1E3TA 2O2GA 5HKLA 3AFMA 4Q7KA 4LY6A 4LNUA 5THXA 5CD9A 3DVLA 3DBLB 1Z0DA 4NZZA 1JT9A 4M49A 4Z54A 3FDIA 4MQLA 1Z2NX 4QC2A 5HXAA 4HWOA 1EGQA 2AFHB 3DDZX 3OQ1A 1CF2O 5C81A 2P1DA 3WGIA 2ZRHA 3I09A 3WRYA 2FFJA 2LCQA 3TQQA 4UBMA 4EMSA 2DFKB 4C87A 4D79A 3UJNA 2DUWA 2PR7A 4MS1A 4XWTA 4JYAB 1LVHA 1Q1AA 3EPJA 1TDJA 2HAEA 4WCFB 1KVTA 1E9AA 1SC4A 5EP2A 1IWBB 1LC0A 4GVLA 3HCPA 3W04A 5HEKA 3UWKA 2A5FA 2CXHA 4B4UA 3KTDA 1G2PA 3NHMA 4U7FA 1ZY2A 4WMLA 1ECPA 2I2XB 3GH3A 4LMRA 3IVGA 4E7OA 1MFZA 3X43A 2CCJA 3FYSA 2BHNA 3O2JA 2BTOA 2XTJA 4C4YA 1SOWA 7MHTA 4YN3A 4BGUA 5D6OA 3EIUA 4YCJA 3FSEA 5CMLA 4E3ZA 1H2BA 5CIWA 3MWEA 5CTJA 1CLUA 2FK8A 1M34B 3RVDA 1Z2OX 4A16A 2FLKA 1WXIA 3E61A 3JAKB 1B2LA 3UN1A 1ZUHA 3F9RA 2G2SA 5EZYF 1JQ3A 3SXJA 5BVHB 2BFOA 4MWOA 1E2DA 3X2EA 5EXDA 4A73A 5F7XA 2J7PA 4XEHA 1NVUQ 1RFGE 2YMLA 3JASA 3COJA 2PLRA 2QTZA 5LD2B 3UG7A 5ESWA 3DVRX 2UUAB 2GPYA 3SIPA 5JNVA 1WUIS 2B2CA 4MNTA 2JS7A 1NXQA 2G25A 3G59A 1CJMA 1IPEA 1CUZA 2SCUB 4RZUA 5EFZA 3T15A 5MFZA 4O1IA 1L8XA 4BKMA 3E7PA 1PFYA 1QYCA 4M0DA 3ABIA 1J2TA 1SVUA 1CQIB 1U81A 3UMGA 1BJRE 3E3AA 4Q6WA 3UT6A 4ZV9A 4KXQA 3WL8A 3IO3A 1R9NA 2FDRA 2HLDD 121PA 2H2DA 2WYWA 3VNVA 3U4IA 3AJDA 4GOLD 4C4TA 4KB5A 3ROMA 3TAUA 2NAFA 3PA8A 4OIFA 4CF7A 5AM0A 1QAOA 4L2IB 3R8CA 5A6VA 4N76A 3EXG1 4PBSA 4NH0A 4EITA 1ADCA 3MMSA 2W2LD 3RABA 4DWVA 2FN8A 4L02A 5B57C 1JBQA 3NHZA 1Q1BA 4HAZA 3UANA 4BZWA 4CQMB 5KPJA 4KR2A 4XWAA 1U8XX 3ZX5A 1QNFA 4PQEA 4CIYA 1GTG1 5L3QA 2MYTA 4Z9YA 3L0PA 4IICA 1VG8A 2V6JA 4RCYA 4ZJPA 3M34A 2CVOA 5JDIA 2BGIA 4CTOA 4E11A 4PWZA 1TAGA 3AV0B 5JXIA 4PZ0A 6Q21A 2FOXA 3OZAA 5KTPA 1OAAA 5LNK1 3W78A 4V0SA 4YRSA 3IPCA 4C4OA 2HDOA 1FMTA 1IQRA 2AQKA 4HRXA 5JSQA 1FP4A 3ZE0B 1E0AA 5IULC 4P4SA 3NEYA 1FFYA 5T4BA 1QG0A 1ZK0A 3RLIA 1OFHA 2P3QA 3NTOA 4NHEA 4ZO4A 3BE4A 3ZNPA 4GZLA 1NFQA 5BSMA 4EDFA 4TTAA 1GCUA 2ZSFA 3HB1A 4F60A 5G1OA 2Z6UA 3WK9A 3LPLA 1CJCA 1CP3A 1W8DA 5T3UA 3B2QA 1U6IA 2Y05A 4HQLA 3VU3A 1I8TA 3HZHA 4XJXA 2R86A 3G88A 2G1UA 5E9JA 3ORSA 4EG3A 4W7HA 1L1QA 2PQ2A 1T9AA 2NU7A 3DZHA 4TVKA 3N53A 4G01B 5KCMA 1YQXA 1R8XA 3KEMA 1TT5A 2HWXA 2CLKB 2EF0A 1E9FA 3MINA 1ZC3A 3PP8A 1TCBA 4IXNA 3CX3A 4CTKA 3TJMA 4B32A 4KACA 2RGAA 4ZOQI 5DOVA 2GTIA 4UUAA 2VNKA 4ER6A 1IHUA 3UHFA 2OP1A 1MAHA 4UU7A 1ONBA 3TLBA 3QBTA 1CV2A 1SIBE 4HZUB 4MJLA 5AKIA 2CHGA 2X4LA 3GT0A 3GPCA 3HVJA 1ZXXA 3AVYA 4WLVA 2YXPX 4D3SA 4IWYA 2C4WA 3C24A 4BO4A 2D8MA 3FUXA 5A05A 3F6SA 3ZZUA 4EFDA 2GLUA 4EB3A 2OWEA 5A71A 2QAGB 1GT91 1QR6A 1ZH4A 1EFVB 4DSAA 4G67A 1NW6A 4XDYA 3LHFA 4B76A 2N46A 3P0HA 2C96A 1AKRA 1ADJA 2C2KA 3RK0A 1NG1A 5CVUA 1OI7A 2UZIR 3ICQB 4W9RA 4DLUA 2VYVD 2WTAA 2X9LA 3C8HA 3THYA 3TKYA 1LBTA 2BONA 3K4PA 5FKJA 4HAYA 1YS9A 5GGXA 5JVDA 2J3HA 1RXYA 1YS1X 2ZBGA 2BIFA 2JFGA 1T10A 2ZJFA 1YC5A 3KE9A 1A9QA 4Q3EA 3AUAA 3T99A 3DF7A 3I6BA 4BQFA 1F6DA 2AW3A 3STWA 1RR6A 4X44A 3KSAC 2ZKLA 2DBRA 3T52A 3X1WA 1JQ5A 4M36A 1UEJA 2YN4A 1WQ1R 4ZT5A 2YXLA 4Z0HO 3PLAE 4DANA 2V65A 1LF0A 4KHPB 2IDZA 2EFYA 4FD3A 4LCJA 5JAZA 1JB9A 1OGYA 1BW9B 1E6CA 1NNSA 1QK3A 1BEUB 4JXKA 1XGKA 4TKZA 5HK8A 1W47A 1XU7A 1XDZA 1XNGA 1E6UA 4X63A 1QHEA 2Z3ZA 3H99A 3IV7A 4M83A 4ND8A 1XPJA 3AJ8A 4ML3A 2NO4A 3RVRA 4B3JA 3LVQE 5HYVA 3C3AA 2BAGA 1ZESA 1MA3A 1FU8A 4RL4A 4V38A 4TTVA 4YJ3F 2IYLD 1CS0A 3ANYB 5B1SA 3VR1A 3GRCA 1HQYE 1XCOA 3A1UA 3LGSA 3ZGOA 3CVUA 3NTVA 3R40A 2GXUA 2QORA 2QMUA 4RHCA 1NJSA 4TUYA 2HDHA 2HWUA 1VG1A 2W2OA 2VOEA 2XB4A 5CIQA 4CDRA 2F3PA 4YK7A 4JP2A 4D0LB 1Q57A 2CXXA 2O52A 1P7VA 1R8YA 2J07A 2AZDA 2LUOA 5HCIA 3QI2A 4OHPA 2F1RA 4U2GA 4FHCA 5FBRB 4QDTA 2A4MA 1NMEA 2E85A 1EJBA 4X62B 3O03A 4X64B 5KS2A 2QKYA 3CZ5A 1BEZA 1IRXA 3QE3A 4H18A 4Z4CA 5AD1A 3A9WA 4JAVC 1NP7A 5HPYB 2UYQA 2HADA 1E98A 3BS4A 1DSSG 1BH6A 5BT9A 5H83A 4JC8A 2IOQA 2F8LA 2V9CA 5KHAA 4PVCA 4MLZA 1TJ3A 4ZYXA 1SKYE 4ENQA 3VAZA 1SIUA 1UL1X 3B38A 2LZ0A 1X1BA 2LP4Y 2NIPA 2A78A 4F06A 5K0SA 2O23A 1KFBB 1G55A 4U7HA 5J43A 2CGEA 4EBFA 1OX6A 3F7TA 4J3NA 5FB3A 2AKYA 3JX9A 5FTWA 3T1TA 2OO3A 2X41A 4FHGA 5JSZA 5LU9A 4IDHA 1YASA 4DADA 1L5OA 3ILVA 3CPHA 2HCFA 4IIFA 3WGGA 1RJ9A 4JI7B 1KARA 2AL7A 2ZR0A 4TM7A 3WXMA 3Q5EA 5KJCA 1DAIA 3AG5A 1G5FA 3RTCA 4KAXA 3ES9A 5PNTA 2PKQO 2J0QA 3F5DA 4BEVA 3AFNA 2EYUA 4R16A 2YWRA 5AKYA 3MHTA 1HG1A 3FSGD 4CYMA 5ICSA 2F3UA 4LRXA 3LWNA 3QPDA 3HZRA 4RPCA 4BP8A 3ZDBA 4J1QA 1DDIA 4ZPJA 3H11B 4I1VA 1AK2A 1DKPA 5E1DA 1QDUA 1Q11A 2QQ5A 3MFYA 4X3PA 3P5SA 2DBZA 3VVLA 1YZTA 5K5EA 1TVKA 4F5WA 2DEUA 4O2AB 1ZK1A 2WILA 3DD1A 4JLUA 5SZKB 1RMQA 4NBWA 1NJ8A 1XNJA 1GRNA 3IUBA 2IP1A 3PJDA 4DPLA 1R6DA 1A71A 1JEOA 4U4AA 3VU9B 2FRVA 1M2WA 1PLKA 3KNZA 1L4HA 4MSUA 2D0DA 1AUPA 5TLSA 2C57A 1GL3A 1HYHA 2Y77A 3VR2A 1F7VA 5IKOA 1ADYA 4KRXA 5BO5A 1F4VA 1HURA 4L73A 2FW6A 1Q0QA 3M3HA 2AG0A 2JLCA 3DLHA 3ST7A 1PT7A 1B8UA 2GSWA 5HUHA 4LG1A 4YIKA 4Y6LA 1W4LA 1GQSA 2HV9A 3IOMA 1HLPA 1QYVA 4KHZA 3CX6A 3KVYA 3C14C 3OEHD 3RHTA 1ONOA 3LT2A 4ZI3A 3AVPA 4AY5A 2H92A 3QQPA 3D8TA 1XQYA 3NHAA 3QKUA 4MVJA 4NEHB 5JE8A 2J3IA 5IVPA 1POWA 2X8JA 3Q12A 3IT2A 2XJ9A 1R0WA 2EEZA 2QY9A 3NIFB 3HM9A 1TYDE 1AKNA 3GR6A 3ETCA 1QOPB 2QLMA 3MOGA 3VPHA 4D3YA 4I3GA 4AXXA 4LXYA 4B8WA 1UJBA 4IF6A 4EJ6A 1GDDA 2XNCA 1F8UA 1RTKA 2JNWA 3LLUA 3ZTTA 5JAHA 1MG5A 2QG4A 3UMYA 1L5GB 3HKBB 1GNPA 2DWPA 3SC4A 4YAGA 1WHSB 4KO2S 2XXAA 3NG1A 4K9PA 4XOUA 3ZD6A 1PS0A 3CZCA 5AI5A 4ATNA 3S7ZA 2ZWPA 4AZVA 4MS1B 4ZYWA 3FDZA 1NVMB 3LSTA 2W8BA 3CRW1 5I9LA 6PFKA 2FGJA 4MPJA 4AMYA 2P6MA 3BGVA 3FHCB 4GBMA 2ZAMA 1IN4A 1TFRA 1DBQA 1EWQA 2HRCA 2C7OA 1GM5A 2GEJA 2MMGA 1RQNA 4JLMA 1ZM7A 2C99A 2GM3A 2QEQA 4HVCA 3RAPR 1YE8A 3FPJA 5BMVA 3D02A 2FHSA 3GYGA 3ZV6A 2NMVA 4FKMA 1MZPA 1C3OA 1N2ZA 3K9WA 5KYGA 1UZLA 2FX2A 3SXUB 3NRBA 4JJGA 3RYCB 3JD1A 3OTIA 2Y66A 3LAWA 2Y0BA 4LZLA 1KP9A 3CJTA 1JDVA 1HT2E 1NPDA 2GZDA 4BAGA 4DA8A 3OT1B 3PTLA 4AICA 2JG3A 2HDNB 4FYKA 4OHWA 3QLUC 2EL9A 4Z9AA 3I9JA 1OV6A 4LJ7A 3LUBA 3COYA 3FNGA 4L07A 1I3CA 4WUTA 4QUDA 3REOA 4MX8A 1N4DA 4H15A 4YJGB 2RAFA 1T0IA 3R0QA 1RYEA 2QQGA 4WNAB 2QMOA 2C7RA 3ONVA 3FDFA 4G0WA 3LY9A 3PFNA 3PUIA 4FWTA 2QVXX 3LT1A 1Y7LA 1DFHA 2FTKE 3BIXA 2I9KA 1ZPDA 2VDWA 3DHVA 4IGIA 4R1MA 4MW2A 5DLEA 1KMQA 1W2HA 2WSYB 4Y1EA 2DXIA 5I7HA 5DM0A 4AS1A 1F20A 3K2IA 4L57A 1Z5PA 2DKNA 3CEAA 5G0UA 4D9HA 2HCTA 4IHJB 3H84A 3D7SA 3RVMA 2VF4X 2YW2A 1Z7WA 1Y5NA 1DTEA 4D3DA 1E1KA 1SULA 2RGEA 1UMDA 2ZIFA 3QKRB 3DSRA 4RVCA 4RZSA 4TTQA 3RYHB 3SX0A 1L1FA 4FI3C 3AF3A 3FWZA 3SXPA 4D0RA 2JJMA 3G2HA 4GICA 3O2QB 4QATA 4TLMB 2H0QA 1L4UA 3B53X 2J30A 3R5KA 1GA1A 3E0QA 3TZKA 4Y9RA 1OLOA 3F2VA 2JBAB 5ELLA 1N8NA 2BMFA 2JARA 3L4SO 1JDPA 1N0IA 1EVZA 1Q0HA 1IZZA 1TUBB 3RTAA 4L0MA 3ANLA 3GCDA 4OQYA 4ED9A 2O3RA 3H5NA 2XH8A 1G21E 1WSWA 1Z3CA 3F2IA 2C5EA 3PFGA 4NV3A 2VJPA 5F5XA 1OBCA 2XNHA 3ZK8A 1RZUA 3B82A 4MV9A 1E3JA 3LO5A 1G5PA 2VLIA 3EZYA 1UJCA 3P9NA 3QEKA 3D3JA 4JKYA 3L7IA 2FSPA 3N3AC 4F93B 1T5DX 2GLXA 3FCSB 3H04A 3NWBA 5HJEA 1FRNA 3E3MA 4V1CI 3GLHA 2R87A 1U8AA 3JQFC 2CZCA 3WQRA 1NV8A 4K1XA 2FUCA 1HFWA 2GBIA 1BMDA 2MYUA 4BNIA 4OQNA 1GRCA 1Y6RA 3ETNA 1LBQA 4CV0A 4CUJA 1C1DA 4EJSB 2X2FA 4BYGA 3BRWD 2PSEA 4RTKA 1U98A 3WBJA 3P97A 2P9GA 4RPLA 5AVYA 3QI7A 1QRUA 1T3GA 1DC8A 2J7PD 2GR8A 4KU4A 3MAAC 5FOWA 4EK9A 3PNKA 3PE6A 5HZGA 5ER9A 4K9LA 4H4DA 1YIOA 1U99A 2I55A 5SYNA 3QVOA 3WMRA 4RDXA 3OOEA 2D1TA 4YFYA 3DDNA 5EHNA 1X1CA 5B30A 4HNTA 1BA2A 4D26A 4OJYA 1H6CA 4G4GA 5EJ7A 2VCEA 3EBPA 2YY5A 4ZVSA 3DBHB 4BNXA 1IHYA 4MMYB 4TVSA 3B2NA 1FPQA 4FK8A 1L7XA 1B73A 1X1QA 2B1QA 2Q5JA 3QPAA 2QVCA 2KE5A 4I3FA 4KI7A 3TGPA 3EG9B 2DE0X 2O7NA 3JSAA 2V0GA 4E5PA 3VU0A 3HBJA 5KTNA 2WWTA 3LZDA 4J7CA 3UJ7A 1YFLA 2Y27A 3EEFA 2XUFA 3JALB 4O08A 4FQ5A 1G41A 4WNCA 2G04A 5K0BA 4NABA 2JLQA 4WPGA 4UDYX 2XDQA 3GA7A 2EFJA 3PEWA 2F9MA 4JX9A 2C8LA 3SYKA 4DNPA 3AL3A 3D8BA 3E58A 4Q9LA 3SBXA 1VJGA 4MB0A 4X6UA 5A1TA 3S29A 1EUDB 2ECOA 1MHTA 2PLAA 5CU7A 4DJTA 1DRVA 4X8OA 4BY9E 1TF7A 5K3BA 2OMKA 2Q4RA 2CNOA 3DWFA 4BOYA 1KMIY 1T9ZA 5KWEA 4ZVTA 1UK9A 1E1QD 3C6XA 3H97A 3EXG2 4Q1AA 5IAEA 1NMYA 3RBXA 5LOVF 4K3VA 5C35A 4O4JF 1SUDA 2Y1OA 1EB9A 2NV2B 5JCPA 5IXYA 4A2CA 1A5BB 1M8GA 1ODJA 2XODA 2ZYIA 3RHZA 3GRVA 2UYCA 1XLUA 3N2IA 4X7MA 4A9AA 5SYAA 3KBBA 1B00A 1P0CA 2BSXA 3WA6A 3DXXA 1NI4A 5L3ZA 1X7ZB 3P4XA 3CM0A 3DOIA 3KL2A 2FEWB 3W4KA 4GKVA 3VTZA 2GF0A 3IPYA 1VKNA 3M33A 4GMFA 1OYOA 2C9CA 1MLDA 2Y1LA 5K0EA 1RAGA 4YRCA 1QZUA 3TQTA 1JMVA 3ENVA 4BNMA 1V26A 3K9CA 3LDAA 5HILA 4XGKA 4DILA 4NMXB 1AHNA 1YS2X 4DMMA 3VBEA 5J4KA 2EJVA 4V1CB 1TVCA 2EP8A 1EX9A 3QUAA 3F6RA 3B8HA 1KJ9A 4IH1A 3D2AA 3IBYA 1Y9EA 3GGSA 3O95A 1P9RA 2W2QA 4F2PA 1SUPA 2IIBA 4FT2A 4XX0A 2CN1A 4XVQA 3ZBQA 4B33A 4FHZA 1NW4A 2OYSA 5FUBA 9MHTA 4CDMA 1ZOLA 1WBJB 1ECJA 1CUVA 2D0OB 1QV7A 1ZD3A 1PV2A 4M54A 1ISFA 4ROSA 1KFEB 3GHYA 3DEZA 4DIOA 2V55B 3CXRA 2ZI4A 4OI2A 1R6AA 3X1YA 3ZZMA 1IIBA 1EEXB 1G20E 1XCLA 2JFFA 2XZTA 5HGJA 1YB1A 4C0WA 4FN4A 3ZQKA 1KIMA 1ENOA 3FA2A 4GC5A 1DBVO 1PTJA 4MQUA 5LOVA 4C3UA 1JXOA 4LF4B 2J9GA 2FR8A 3IDFA 1ZL2A 1UMBB 2PAAA 1KYZA 4PNHA 3O0DA 4TRJA 4RY8A 1YDWA 1Z26A 4EM6A 5I4CA 3BJMA 1O7JA 1GAEO 1RDFA 3JZFA 3GVHA 3B2EA 4IDOA 1VJRA 4DR6B 3V7WA 3EZFA 3IP6A 2QZ9A 1OFTA 1TVMA 1WPQA 4CM9D 4Q6BA 3FF4A 2J3LA 4TTSA 5DBGA 1FFGA 5KNBH 4ZMRA 3M5DA 2H9IA 3LKZA 4RVHA 4KPFC 3K0BA 4ZMBA 3EPKA 2AFHE 3IALA 4TV9F 3ASVA 2PRSA 3B1YA 1N5MA 1PNVA 2CMDA 3CLHA 3HKEB 1GYQA 1WPRA 1XA0A 3FMFA 3W4JA 5EXEA 1I4WA 4QYMA 5A04A 3GJ4A 4OGWA 2Q7XA 4PR3A 3TMYA 3O7MA 1B2RA 2D5AA 3HYLA 1JIXA 3D8HA 4WOPA 5AUQA 2WICA 2XSZD 3HFRA 3UH0A 2NSLA 1Y7TA 3WGYA 3HCEA 4MKIA 1AKQA 3G1TA 3KVVA 4U39A 3RYFA 2G9UA 2NYUA 1MABB 3AESB 4WXEA 3S1LA 1Y1QA 1GKKA 2J9FA 3Q1KA 4IDQA 5EQTA 4V2IA 4ZVQA 4TLEA 1FMJA 3ZPXA 1Q0LA 2KMLA 3O4IA 2WVHA 5KQRA 4DUGA 2O2YA 4EF6A 4HT3B 5E8RA 3QIVA 2FPMA 2OCAA 4UBLA 1GITA 4MV8A 4PLTA 1S8OA 1NF8A 2DYKA 2OB1A 3KQUA 3AHEA 1XTTA 3G7UA 3KT3A 4HN9A 5LP6C 1O9HA 3PQ5A 4FDVA 5KYWA 4CN9A 4NBTA 1UWKA 1M74A 4FSXA 2ZP1A 4QU5A 4X93A 3RKUA 5B1IA 4FZ3A 4C1NA 3EUAA 1ND6A 1TQHA 3B85A 1CQZA 4IO1A 4JFAA 4PSCA 4LGMA 2OECA 1FLDA 4I5DA 2IFTA 3AESA 3LKDA 4DQDA 4UVEA 3E1GA 4DYHA 1Y33E 3ASUA 1DQRA 1NURA 1YCHA 1DNPA 2P77A 2ZUCA 3SEQA 1PSWA 2PL3A 1H2YA 3FVTA 3I23A 4KH0A 1E6LA 1HZZC 3R3HA 4DDUA 3HN2A 2GOYA 2P2ZA 4Z7OB 5FP0A 4AJEA 2X7HA 3P9ZA 4NOMA 3PT5A 3I9OA 3IAS1 3HJNA 3DZIA 4JCCA 4F8JA 3O8DA 4PRYA 3GEDA 3BGWA 3SX2A 1IBRA 2BFFA 4J0JA 1Q50A 3O9VA 3ER6A 4JX8A 4BUZA 1AN9A 4KKXB 4LZJA 3VR6H 5KYNA 4LXQA 1FK8A 1M7GA 2B6HA 5KC8A 3TRFA 3WI7A 2G06A 2A84A 2F43A 1PEKE 4HNAA 4J07A 3V2GA 3S8MA 3OTOB 2Z98A 1D1QA 2JI8A 3HKBA 3GIDA 2H57A 1L4EA 4IOJA 2OPBA 2F7SA 3OLXA 1NJ2A 4QTTB 1E64A 1I0IA 1RAEA 3F7MA 4KQ9A 4BZQA 4QHSA 1EP3B 1I9GA 3I6YA 3OCXA 4NBUA 2Z56A 5FPSA 2RGGA 3JD3A 2BD0A 1QHNA 2HBQA 5KTOA 2RK4A 1EDOA 1UKCA 3GI1A 3IX7A 4GVXA 4AF7A 5JY1A 2FR8C 5E7MA 4GF5A 4TWBA 2JJ8A 4PQGA 3K3PA 1E4EB 1OLSA 2PBLA 2ZREA 3L0OA 3ND8A 4YT5A 4CIXA 2J3MA 4EG8A 1BVHA 1IHXA 2IOFK 4H7DA 1RXCA 2X22A 3DB2A 4XASA 1S2DA 2NAPA 2ODWA 4B7ZA 4HEJA 3E81A 2RHWA 3K9HA 1UPTA 1SVOA 4ZHQA 1N9GB 4K9NA 5HM8A 1GAJA 3FI0A 3VR3D 4GPZA 2QZ4A 3ZD7A 5DCWA 1OXXK 4GLBA 5FAKA 1TLTA 1AV7A 1EBUA 2C5GA 1B6RA 1NUPA 1ONSA 2VF8A 4MUYA 4R9UC 3T61A 1DO8A 2ECFA 1NQOA 4B46A 1DIOB 1O95C 2ZJ2A 4Q7MB 3MT7A 1BKDR 5JJCA 4MIOA 2BF7A 3R0XA 2CLEB 2OGZA 1JDNA 2B3DA 5SY9A 3T0GA 4I5IA 1EK0A 3S4YA 2GAOA 3H2YA 5I5GA 3AOGA 4L2IA 3REFA 1FFAA 4BLTA 1X15A 2EGGA 3PRHA 4OHXA 1C0LA 3LW7A 3LUPA 1GCOA 4MQ5A 4WZAB 1SHLA 1DL5A 3WO1A 1EWYA 3B6IA 2WLSA 1JXQA 4V0MA 3I8SA 1Z74A 1SY7A 2PKEA 4BRZA 2JIPA 3L6CA 3S2SA 1SG6A 2XKAA 5T4HA 2DFNA 3DBRB 2I6TA 3GFSA 1HL3A 1ZRMA 2R7MA 3I37X 3EVCA 4W8HA 3GEGA 3GMDA 1TM7E 1O03A 4XKJA 3KKKA 1L5HA 4C04A 1GUZA 4EW2A 4QM7A 1W85A 2QPTA 3T06B 1SVLA 3DD5A 2ZUWA 5DN9A 2AN5A 1Y82A 2CB0A 2YC4C 3RRZA 1SC3A 3SGLA 4R5HA 4IG9A 3IESA 2H00A 4MKGA 4P7GA 4TOIA 4PU0A 4EPYA 1IEWA 3G5TA 1D2MA 1E79D 4PS1A 4WACA 4E2FA 2GEBA 4B7AA 5GWXA 3LC0A 5D7NA 2V54A 4U9HS 3ZXUB 3G2QA 4Q4CA 5CXXA 5LOVB 4PYKA 4DCCA 2FRDC 1XTUA 4GDMA 2NXNA 3EPHA 2WJIA 2XNSA 1L3IA 1G20A 2X4GA 2OQIA 3RSZA 4ARCA 1GPWB 1SU4A 2G8NA 2EGUA 4QU8A 2J09A 1UZNA 1I01A 4JLPA 5EMLA 5C7IO 3LUHA 3GRYA 2ZB2A 4X7PA 3Q7TA 3Q41A 1QZTA 3HJFA 4RTPA 3CC8A 3A6JA 2PGNA 3WMXA 4BMNA 1GNVA 4GOMD 2EBFX 3L43A 1EB8A 2VQDA 3FLBA 4L5CA 3SN6A 3V33A 2D0PB 4BVKA 2C7QA 1QE3A 1YVUA 4ZICA 1XZGA 1LDBA 1R4MB 2CVPA 5HDQA 3UMRA 3ZDDA 4AQYB 2VP4A 2EU8A 2RKBA 3LKVA 1OREA 3NKLA 2XZPA 3DLBA 4ZQGA 3I04M 1LRKA 1TPYA 2JBWA 4C6RA 1UP7A 2R6GA 4TXMA 3EG5A 1X80B 4C22A 1XD2A 4BP1A 2OP0A 4FR5A 2COEA 3G2JA 4MB6A 1CC1S 3U48A 4BO3A 4CWAA 2QF7A 3NTUA 1E92A 2C3PA 2H1RA 3PKIA 3FPFA 3PI7A 4FYYA 2WF8A 2XNDD 3H1TA 3I5AA 3IS3A 4EUKA 2QNBA 1PT6A 2CLOB 3ZLBA 2O2HA 1EE1A 3WGOA 1TYBE 2GNOA 3HYNA 5JCZA 3HI6A 4HH0A 2CXRA 2W93A 1G7RA 1U0TA 4ZTZB 1GKLA 1O97D 2GT1A 4YEDA 3SEAA 3A37A 5I9NA 4EY7A 1U2SA 2IYZA 4E4YA 4LBWA 1A9XB 2H48A 1HR0B 1V6CA 1NASA 4KJXA 3EZ9A 3IOEA 4KV9A 1Z7BA 4PLGA 4QWWA 4Z0PA 3JQAD 2I3AA 4FX2A 4J4BA 4M7OA 2KLBA 1XDWA 3O9ZA 4JWTA 2GEDA 1JEJA 4M38A 2L19A 3NWOA 5EXSA 5T41A 3S55A 2CLCX 4TWRA 1QO0D 2O6LA 4MI1A 5ALMA 2Q2OA 3MGKA 4CEJB 4LK2A 1LSOA 3B5EA 3CLSD 3I3SR 3P27A 4DSZA 4OSOA 2Q4TA 1GYRA 2C3UA 4HYTA 5AO9A 1UT5A 1ULHA 2DWOA 2FSVA 2CXTA 4GRIA 4S1VA 5F1OA 4DDMA 4BLRA 1J09A 2X0FA 1M6NA 1JJBA 4D43A 1OWPA 1ZMOA 5IYZB 2BGLA 1D7OA 1Z7EA 2ANBA 1BWPA 2OG1A 4BVHA 4YV0A 1GARA 3OLCX 3BZUA 2FUNB 3C4JA 1GPH1 1P3JA 1ZIXA 3WMFA 1TF5A 5K3CA 4I4TB 2JGNA 4TMXA 1ZJ6A 3EGIA 1WIWA 3G6WA 3IAM1 3QHQA 3HLTA 4JENA 4KXNA 4YRBA 4V0KA 3V55A 2PRJA 1I3MA 2W2PA 3LT0A 4BX0A 5KWSA 4TN5A 1Z8FA 3ZXXA 1Z6ZA 2I6UA 3EC7A 4U2CA 3TFQA 3IYLW 5CB4A 2EFDB 4QGBA 1MW8X 2DPLA 3OF3A 3A3NA 1ZM4A 1RADA 2EOAA 2Z9BA 4JT4A 2J59A 4FDMA 4O4LA 1XYYA 4J9UE 1J6UA 4TMFA 5DSZA 4DJJA 1MRNA 2VSQA 1P73A 3MWLA 4B3MB 3DM5A 1KDYA 4HEQA 3P9XA 1Q7GA 3ZWBA 1Z5NA 4YP9A 4F56A 3ZIUA 4CT0A 4UFNA 2W2LA 1K8ZB 1DCMA 4PO1A 4G1EB 1RQRA 4L3VA 4B8YA 2VZ9A 5F5LA 3AOEC 2F2TA 4NOKA 4BEWA 4P4SB 4HV4A 1FNSA 3ANSA 3FVVA 5COQA 5CX1B 2VZEA 4LOJA 1G7CA 3OI7A 3FFAA 1MAUA 1G8FA 1L8QA 3SJZA 4TXHA 3MQ2A 4W1PA 2CK3A 4ARZB 1HDGO 1V1JA 2IC5A 2M32A 3FSJX 2IITA 3WJ7A 4G5XA 2WYIA 3P0IA 3DLIA 3QVWA 1E9BA 1YR8A 3TG8A 2OQ2A 2OAQ1 2M98A 3GMSA 4OHFA 3CBQA 4FHEA 3FW1A 3NETA 3QKRA 2IWHA 1EX1A 5C8ZA 1KU6A 1ZN7A 2NUAA 3FAZA 1F2DA 2IEGA 4Q3AA 4WGFA 4WESA 5IM5A 3UTCA 4D8YA 1XTZA 4KYVA 1KBOA 2ZTVA 2GO1A 3CZ9A 4D6YA 4OHYA 4A4DA 2DCUA 2BH2A 1BMFD 2P11A 1P60A 1RKBA 3DC7A 1U3VA 3RVQA 4RLQA 3BGOS 3VNBA 5J2TB 4OYLA 4B6OA 4DIKA 2AV6A 1T2UA 4L16A 2Y8EA 4QQ8A 5IZCA 4UZSA 1RXSA 1NP6A 2AD1A 2INGX 4F45A 2GNPA 4HNRA 4QELA 1JWLA 4MUHA 3PDIA 1II9A 2IV3A 4PG8A 2EAUA 4D46A 4JFRA 5DO9A 2BKUA 1EHIA 3OM9A 5JI3E 1W52X 4YQZA 3BH7A 3IUSA 3UGQA 4LVOA 5IBPA 2Y6VA 5F2NA 1P2UA 2K87A 2UZ1B 2WHPA 3OKAA 1Z8HA 4MWBA 3B1ZA 3IHTA 1EA7A 3V1LA 1JHUA 5AVWA 3KIPA 3UIEA 4Y2SA 1P1CA 1IAVA 4YXWD 4I9HA 1WY5A 1AZSC 2L2QA 2TMGA 1BS2A 3LOUA 2BFEB 2PJZA 4J29A 4DNQA 4NDNE 2OD7A 2ZRNA 5HGXA 1ULUA 2IYWA 1U0NA 4ZCQA 2HFKA 3U7HB 4JASB 3CFFL 4DIDA 3HO1A 3K0AB 3MIZA 4FW9A 2CD9A 1B42A 2BLLA 3CKLA 5LWHA 1J2UA 3SXUA 4EENA 1LI4A 1LW7A 3AKYA 4CM1A 1A9RA 2R00C 3M89A 1DWQA 4JL5A 4E4RA 3PEEA 4DABA 1TYCA 2Q3DA 4FLFA 3VU8A 4CMIA 1J0CA 2YIJA 3GDWA 2WE7A 1TC1A 5F73A 4E07A 1UP4A 3U44A 4IFEA 5CAEA 2GTHA 3U4MA 1PZNA 1G1AA 2PZFA 3CNBA 1CNMA 1TEHA 1L5NA 1UDAA 4AWAA 1XQVA 1KK3A 4M46A 5TMEA 4FMCF 2GCOB 1MIOA 2V96A 3QENA 5FOSA 1GCIA 3V1NA 2Q6VA 3BERA 2A50A 3P5BA 2FQXA 4WLFA 3LKBA 1P2DA 3R3SA 2JJ1D 4OXYA 2EW1A 1W44A 3ZY4A 4ECEA 4FGWA 2YZNA 3D8NA 1ZR4A 3IVRA 5A3QA 3H3JA 1R0KA 3CKYA 3NFYA 1WCIA 4H6XA 5DB4A 4I4NA 2PHZA 1E1LA 1C2YA 3F6BX 3TKLA 1PUIA 3ID6C 3UZUA 3BVPA 5CAEB 5GTDA 5LSAA 3TTTA 4BBJA 2OCXA 3DAGA 4XSHA 1D2AA 3KETA 1Z83A 2FZLA 3O21A 4B84A 1P45A 3W1VA 3VPBA 4L8VA 3R7AA 3E4DA 3EEYA 4KDRA 5FL7A 4DHWA 3K70B 2YVLA 3VZBA 5KUTA 2R66A 3QSYA 2P79A 3WVNA 3G8DA 4EKEA 1IUPA 3AR9A 4D4JA 1IQUA 1MD9A 1NQAO 5G4KA 4PC2A 4C88A 1U0JA 1K98A 3SSOA 3EIEA 2RB5A 3JQ9C 4AO7A 2JIOA 3E1KA 2C2ZA 2OCGA 3HSKA 4FNGA 4RC9A 4BE7B 1S2NA 1DAKA 1P72A 4MQMA 1PJTA 2ZVQX 5D6NA 4O4HF 1CRPA 5AVQA 2Q3FA 4HJXA 4F04A 2NSYA 4N6NA 1FW6A 3RBVA 1FTWA 3TZQA 1RHQA 4TYMA 6AT1A 2G88A 2HOQA 3EFBA 5BRNA 3VSEA 1NFRA 1XN1A 4ME6A 2JIZA 4PYRA 4AJ1A 3A2MA 3OZDA 2DH6A 2BZ0A 5DFAA 2YOGA 4FCWA 4CKBA 5BMOA 1AZLA 1XKXA 4XVRA 3QEAZ 1Z3IX 3MSCA 3GYBA 4QJ3A 2F9FA 4BQPA 2PMDA 3BBPA 2HO5A 1MMFB 2J3QA 3IE2A 4QXAA 4UVHA 4DBVO 2JFOA 2QG6A 4WA7A 2GX6A 1E7MA 4ZGGA 1KA9H 1F5SA 3DCIA 1YB2A 3WSTA 3JSXA 1IU9A 1DJLA 2AOXA 2JI7A 3DW3X 2HPAA 4NYMQ 1MZVA 1FFWA 4FXPA 3HNOA 4OXRA 4YI3A 1XZAA 3QUBA 4LOAA 4S24A 3ZDYB 3U16A 3QKWA 3BL8A 1DJQA 4YBZA 2EZUA 3IIIA 3B1XA 4MEJA 1E89A 3W2IA 5ULLA 4BLSA 1XEFA 1H2FA 3QEMB 1W76A 4NYJR 4RFSA 3I2HA 1HEYA 2A0KA 2J5RA 2C5LA 3OFNA 3SQMA 4DWWA 1ORIA 3E2MA 2YVKA 1TM5E 2V6IA 1E5TA 3N2EA 2Z9DA 4JIGA 3TM5A 4L5IA 3W8FA 2KWIA 1LFAA 4EVRA 4K1LA 4M22A 1TZBA 4IVQA 3LMKA 4I2VA 1G4AE 2GFIA 2XHZA 4LDNA 5L45A 4HPJB 3N70A 3MRSA 4CCYB 4TMYA 1T8WA 1MAWA 3HE3A 3JR3A 1DRJA 1U5BB 5KYYB 3AP2A 4JA2A 5KB3A 5BW5A 3LQRA 1XA3A 3A0RB 4N5DA 1HTWA 1RP1A 1SRQA 2CUTA 3I8XA 1VJ0A 3FTNA 2P7IA 1RYZA 4RY2A 5H82A 3NYQA 2CEAA 5F9HA 4FYPA 3PX2A 3I9NA 1WOMA 1JG6A 3P9PA 4L95C 3T9AA 2HHCA 3RUDA 2J3DA 3V8RA 4BMZA 2CV2A 2V7PA 4MRSA 1U5CA 1QO7A 3OJOA 2D3WA 3VI3B 2HYDA 1BCRA 5CK5A 3V7YA 1RZ3A 5DM4A 4QQNA 1V7PC 4A82A 1MR3F 3TRDA 1IONA 1BG6A 5EJ6A 1UPAA 4ASUA 1V5IA 3UTDA 1GGMA 2BDTA 1XIVA 1OR8A 3O74A 4MCAA 4NBLA 4XOIA 4AWXA 5A9RA 1UIMA 2NXCA 2X19A 3ZDXB 5EHXA 4FR0A 5JQGA 4INJA 5K0ZA 1VBKA 4XLZA 3EXIB 3HKCA 3MPUA 4A0RA 1W88A 2FFQA 4GLFA 4GR5A 3WAKA 5BQXA 3MB8A 3GCGA 1C0PA 1DJNA 1UM8A 3F5SA 3H83A 3M9XA 4HATA 5HBRA 5AVZA 5IYZA 1FOEB 2QJFA 4KXYA 3L40A 4JR1A 3OCCA 4H0NA 5EIBC 3KTFA 4TM8A 1ZR2A 3CN7A 2YHBA 1GGFA 2J0UA 1OU4A 1YE3A 1KZ1A 4QOHA 2LR0A 2JHFA 4H1UA 3EDYA 1EGAA 3TLEA 3R6TA 8MHTA 3ICPA 3L8MA 5C5IA 5JMPA 4OHZA 2EQBA 5FOUA 3KQWA 4K28A 4UCQA 2RGXA 1S2LA 4ZDIA 2V98A 3J7TA 5HK9A 3A6KA 3N0TA 4OJKA 3HI4A 2ZJ7A 4LE1A 3B3QA 4MICA 3KCNA 4EHHA 4INZA 5D86A 5D3ZA 4L5YA 5BW4A 3L8HA 5ALYA 4AY3A 1A72A 4HS4A 4JYPA 1E9CA 3O3CA 4JYCA 4R01A 4ENVA 1CHDA 3PXUA 5T6MA 1HDCA 1JZTA 2PTGA 4DM3A 2IECA 4L72A 4B2LA 2RHTA 3Q6MA 1ELOA 4IMPA 1J25A 2AN9A 4FC6A 3T1QA 1R0LA 5JV5A 4YPVA 3NNDA 2F1OA 4H0CA 4YA6A 4DCPA 4Q3BA 5EJ8A 3W7VA 3HN6A 1T1SA 3FOFC 1ZJ5A 2Q6LA 3LPNA 3QLTA 4LGYA 4WA8A 2HJRA 4RTMA 1Q21A 2IDJA 3JQ8A 4UXHA 3FVQA 2FW7A