3IOCA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.50 ang resolution in complex with 5'-deoxy-5'-(benzyldisulfanyl)-adenosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
273
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 86
structure length 273
sequence length 285
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iocA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iocA01
1R6XA 4OUDA 3A05A 1O97C 4QREA 1PFUA 3H05A 3ZXIA 1N77A 4I6JA 2DLCX 2A1UB 2ZUFA 1NI5A 3FH0A 4U8HA 2CFOA 3AL0C 1Q15A 1KP2A 2A1TS 3P0JA 4E1AA 1KH3A 1N2OA 1GPMA 5AHWA 2DERA 4ZCSA 4MWBA 2D5BA 1QQTA 3AFHA 2DPLA 4K03A 5EKDA 3N2YA 4MW7A 4WSOA 3INNA 3COYA 3TNJA 3TZEA 1K4KA 4MUFA 4EG4A 2PZBA 5KHAA 4Q93A 1T6YA 1V47A 1M1ZA 2A1TR 1O97D 4DE5A 3COWA 4NAHA 1N3LA 4MW5A 1G59A 1YI8A 2J4DA 2B7LA 1GZUA 2CT8A 3HMQA 4ARIA 2A88A 1O5TA 1X8XA 4JFAA 2PFSA 2X0KA 3NBKA 4DDKA 1WQ4A 2QJOA 1U3CA 1ZH6A 1Q19A 2QTMA 4ZT7A 3IOCA 3SZ3A 2HZ7A 2R5WA 4RPIA 1K97A 4PY2A 4X0EA 3X1JA 1M8KA 1R6UA 4PBSA 3TS1A 3IH5A 4ND7A 1OWOA 2RD2A 1QRSA 3M5WA 3LOQA 4G5YA 1TYBE 1B6TA 2D54A 4RUKA 3AG6A 3HZRA 3Q10A 4DDHA 5J58A 1Q77A 2ZP1A 1JIKA 1J09A 1NUPA 2E21A 3MLBA 3CLSC 3MUEA 4YBRA 1JECA 2H2AA 4OUDB 4BWVA 3NV7A 4XSVA 1VBNA 4TS1A 3Q4GA 3U1VA 1N2HA 1JHDA 1H3NA 1FYDA 4FZJA 1I6MA 3UC5A 4AQ7A 3ND5A 1YIAA 4UZEA 1NYLA 3DV2A 1HYBA 2YWCA 1O95D 5TS2A 1H3FA 3LCJA 4KR9A 3DO8A 1N1DA 2QJTA 3FETA 3A4IA 2XRZA 3G5AA 1PFWA 3RK1A 1JIIA 3GLVA 1N78A 3FOCA 3FIUA 5LFAA 2ZUEA 3CVXA 3X1KA 1O0CA 2YY5A 4MWEA 4PBRA 4U7JA 3IOEA 2O5RA 3FG9A 2AG6A 3CLSD 4MWCA 2DUMA 4EG7A 4ZT4A 4ND6A 2PZAA 1XNHA 1PFVA 3AG5A 3UY4A 1I2DA 4YMIA 3TZLA 2YWBA 4ZT2A 1F4LA 3QTBA 3ISJA 1QU3A 4MVWA 2PIDA 1O96B 5IJXA 2J08A 2IELA 5FO0A 3PNYA 1JEEA 1A8HA 3G59A 2J07A 1WXIA 2QTRA 4NAUA 4CDMA 3H9BA 1PG0A 1ZUNA 3K9WA 3ZJTA 1TQ8A 1TFUA 4DDMA 3CLUC 3HV0A 1EFPB 3RJZA 2X1LA 1O94C 1U0BB 1N75A 3GMIA 3VGJA 3ZUGA 3IVGA 3AKZA 1GTRA 2WQ7A 2VTBA 4ZT6A 1VBMA 4EF6A 4EFKA 1GN8A 1M8FA 2WSIA 3BL5A 5KCMA 2NZ2A 1JMVA 1U7DA 1MRZA 1MJHA 3GUZA 4DJAA 3N05A 3SZGA 2E18A 1WQ3A 4MUIA 1LI5A 1MB2A 4YP5A 4L2IA 4H3SA 1KQNA 1LW7A 3A04A 1MAWA 3N8HA 3IOBA 5HUJA 1MOPA 1M8JA 4DLPA 3MMXA 1I6LA 3RBAA 3ZJUA 3KFLA 4KPUA 3IVXA 3UMVA 4HK4A 1NURA 4YP6A 3H9CA 4EG8A 4NDAA 1EE1A 1PFYA 4ZCRA 1IHOA 1COZA 4ZT3A 1TYCA 3DLAA 5TEWA 2BYTA 1NUSA 1MC1A 2A7XA 2CV0A 5K0TA 1EFVA 1J70A 3A2KA 1M8PA 1IQUA 5LM3A 1TYDE 2CSXA 2EL7A 2JA2A 1SURA 1TYAE 1GLNA 4PBTA 2DETA 1QRUA 4R2LA 1EJ2A 2QTNA 3H99A 4KR7A 4Q16A 2CYAA 4P2BA 1JIJA 2IJGX 1KAMA 1N2BA 3SP1A 3KT8A 1MB9A 1O94D 4GU5A 1OD6A 3KT6A 4XFDA 4ARCA 1QNFA 4MVCA 1KH1A 1IFXA 1XNJA 2WQ6A 3FI0A 3MXTA 3SEQA 1QRTA 1J21A 3HFJA 1RQGA 1TEZA 2DXIA 1NUUA 3IMCA 4KKVA 2CV2A 4EG1A 1D2RA 1WY5A 2VTBB 1O95C 5BNZA 1OBCA 3OTWA 2A4MA 1EUYA 3ND7A 2AZXA 3DPIA 3CR8A 2GM3A 1Q11A 5J59A 2G36A 5DEOA 1LI7A 4XFJA 3F3MA 1O6BA 2HGZA 3ZJVA 3ZXSA 1YUNA 3OP1A 3ZIUA 2CYCA 1WKBA 1ZH0A 1JEDA 3LE8A 2QJFA 4MQ6A 1YIDA 4J76A 1J1UA 4A91A 2EJCA 4AS1A 5H16A 3CVWA 4CT0A 3IUBA 2JANA 1V8FA 3IODA 1NP7A 3P0IA 1Y42X 3UK2A 3QE4A 1ZJWA 3PRHA 2AKEA 4MUJA 3MLAA 2TS1A 4QBTA 2QUHA 1YULA 3H97A 1OBHA 1WXHA 3PNBA 4MUEA 3L93A 4MVXA 3C8ZA 3CVUA 2RE8A 4EGAA 3SEZA 4R0NA 4JXXA 2DEUA 4WNYA 1KAQA 3CLTC 4EG3A 1O0BA 2X3FA 4K0RA 4I6GA 1NUQA 4EG6A 1T6ZA 3X1MA 4JXZA 3VU8A 1IQRA 4JYZA 1WZ2A 4UZFA 1JGTA 2V0CA 1KORA 1U3DA 1T9GR 4MUGA 1JZQA 2Z09A 4MUHA 1N2IA 1VL2A 1K4MA 3CLTD 4HPWA 1K92A 5HUHA 5H7XA 3FNRA 3KT3A 3JXEA 5K0SA 1OWMA 3UOWA 5JBNA 4S1OA 5TGTA 4U63A 2X1MA 2WB2A 4MWDA 3RFFA 1BS2A 4GRIA 4KR6A 3AIIA 1QTQA 2JAXA 3TQIA 1EUQA 2QUKA 1KH2A 4ZCPA 1KR2A 4MULA 1F9AA 2GKSA 3NBAA 1N2JA 2QUIA 3PXUA 1F7VA 1GAXA 2PG3A 3D6VA 2IP1A 5DB4A 2PZ8A 2QUJA 1WXGA 1WOYA 4MVYA 4L2IB 5DK4A 2OV4A 1J20A 1N2GA 1EXDA 4MUNA 1IQ0A 5LLTA 4OJMX 1MBZA 4MW1A 4MUKA 3E27A 5J5AA 1P7PA 2E89A 2Z3VA 4DNXA 5IHXA 4KPUB 2YXNA 3FWKA 2J5BA 4HJXA 2Z08A 3VRHA 4MW4A 4NZPA 3IDFA 3ELBA 1YUMA 2V0GA 1OWPA 1CT9A 1G8HA 1QJCA 1GTSA 1G8FA 5F23A 5KWVA 3Q12A 1KQOA 1EFVB 3QTTA 1UFVA 3FY4A 2DR2A 3P52A 4EG5A 1OWLA 3CVYA 3I05A 4MW9A 1NSYA 3TQOA 2A1UA 4J75A 3RK0A 4ZCQA 1OWNA 3COZA 2C5SA 1JILA 1NUTA 3CLRC 3ILVA 4HJRA 4ZCTA 3FDXA 4F4HA 2CYBA 3SYTA 1XNGA 3G6KA 1ILEA 3ZGZA 1PG2A 4JZYA 1H1TA 1R6TA 3HL4A 1IVSA 1M8GA 2OQ2A 2HMAA 1T9GS 2E0IA 1KKUA 1XJQA 4F3RA 2XRYA 4NX2A 2O8VA 2I1LA 3L92A 5FO1A 3HGMA 1X6VA 1M83A 1S4MA 1T6XA 1DNPA 1KQPA 2VXOA 2A86A 4MW2A 1WXFA 4G5FA 1ULHA 2GOYA 2PXHA 1U7XA 3KT0A 4ZT5A 4CDNA 3IVCA 2BTEA 5TEVA 3COVA 2CV1A 3CLUD 3ND6A 2CUZA 3SDBA 1I6KA 5FNZA 4CQNA 1O96A 2NSYA 4MLPA 4MW0A 3N9IA 2J09A 1IH8A 1G8GA 3IUEA 3CVVA 3P0HA 1VBKA 4R2MA 4NATA 1F7UA 1JZSA 4MW6A 3IMGA 1WJGA 1N2EA 2H29A 3S3TA 1EFPA 1J1ZA 3PNVA 3IMEA 3CA8A 4QRDA 5DASA 4YP7A 3RHSA 1FFYA 3FHJA 1KP3A 1IRXA 2A84A 1WXEA 4MAFA 1MAUA 3D6UA 3K32A 1VLHA 1H3EA 4I6EA 4G6ZA 1QU2A 3CLRD 2D13A 5HG0A 1NZJA
chains in the Genus database with same CATH superfamily
1OAOC 3QUCA 4EYQA 1QF9A 3JW8A 3A05A 5E3IA 4QREA 3OHMA 3O8CA 3IQIX 1I7SB 4K5QA 4IFTA 2CLSA 5ILOA 1NQ5A 2X3YA 3NIBA 1QYXA 1ZQ9A 3L7MA 2VSXA 4DLSA 4JI1B 1N6LA 3ZS8A 5MGNA 4PF1A 1VKNA 5KNCA 1ZUD1 4M6WA 5I9NA 3PC7A 3MQFA 3ELWA 2Y77A 1R4MA 2K4MA 5FRDA 2A5GA 4S12A 4JK3A 3F6EX 3HUDA 4GYYA 3DZFA 4G3XA 2J9YB 1T2FA 2ONCA 3IAUA 1EVJA 3N75A 2W70A 3S99A 4D6XA 2Q5FA 2D5BA 1QQTA 2O7VA 2OHGA 4MQEA 4PQRA 3I5AA 3O8QA 4LY0A 2FAXA 4RK4A 4DA7A 2KBFA 5G40A 3UVEA 5L8VA 1E7YA 4N9QA 4M7PA 2XCUA 3DXYA 4YAEA 3RBZA 5JS1A 4PXAA 1INLA 1RFLA 4RIEA 2N1BA 2X1HA 3H9EO 3ISTA 2JCXA 4DIMA 2IH4A 4KXWA 4MQLA 3KUUA 3BIFA 3C70A 3C98A 4NHOA 4QQ8A 5BXYA 2XIQA 3HM9A 4YRSA 4RY8A 2FYTA 1TIKA 3DDZX 3LHSA 4DE5A 1PR1A 4RSRA 4TV9F 4UUQA 3B6MA 3IIMA 3T5CA 4D0RA 721PA 4NBRA 2Y4NA 1C9JA 3MJCA 4JKOA 4X1OA 3IL2A 1XEXA 2G0AA 1IXSB 4KAXA 2PEYA 4WZBE 3SXPA 1HFKA 2VPQA 2OTCA 3I1JA 4GM4A 4RJIA 3X2EA 3GIWA 3MK31 3O03A 2IBMA 3OT1A 1WQ4A 2WZCA 1LSSA 1JKFA 5L45A 2OQRA 3CB4A 4UUPA 2Q9UA 2ZJ1A 3ESRA 5DO9A 4AMVA 2QORA 1YL7A 2GPAA 3FLMA 4R9VA 4BBAA 4HEA6 1GFWA 3NGXA 4F4JA 4F5ZA 3B12A 2P0AA 4CM5A 3C0KA 2JC3A 3O92A 4LE1A 1U7TA 3W9BA 6YASA 2QRPA 5JZSA 3A3YA 4M7WA 1R66A 1UJ6A 3RS2A 3OLXA 3HYCA 4LYYA 3SEFA 2O8EB 3AEUA 1HQKA 4LRWA 2VRBA 3IR7A 1XK7A 4MB6A 4UCQA 2VPPA 4KX3A 1GL3A 4HYYA 5G41A 1ENPA 3U09A 3I8XA 1AKYA 1T2AA 5LXTB 3I5UA 2XGMA 4CJXA 1OYWA 4K6OA 3WGGA 5C81A 5JCPA 1KY2A 1LDGA 1QOQB 4Z49A 1OFGA 4MGYR 5C1PA 4DLBA 1HMYA 1YS7A 2R2AA 2H54A 3K1ZA 1ZAKA 3L7BA 2IHUA 4RD6A 3CU5A 4FFSA 2R8RA 3QGMA 4FSHA 4INPA 3WNZA 2DFPA 4ALNA 5E3JA 1OXBB 3V8QA 3I8OA 3TIVA 2DSNA 1Z2CA 4FC6A 4CIYA 3Q1LA 3D3NA 4LOHA 2PZEA 4JXJA 4RKQA 4CGZA 8ADHA 4M1YA 2XNKA 4BGUA 5K8CA 4X6XA 4IILA 2BEWB 2RH4A 4UZEA 1RQNA 3P9RA 4WFKA 5P8WA 1P60A 1YFZA 4IDHA 2Y1EA 3WLHA 5EMMA 4YN3A 4YI3A 1PR0A 5B1IA 3HCCA 3ML1A 2ERXA 4RF3A 3F6SA 4X61A 4ZOBA 4DB4A 2AEFA 3OECA 2EHJA 4IEIA 4MYHA 3WB1A 4EW6A 1QP4A 3G5AA 2Z2YA 3HBAA 4ZARA 1JIIA 2AIRA 2IWRA 2JDID 5AM0A 2WUWE 2I29A 3DHYA 1SQ5A 3K0FA 4FUQA 3F67A 4JEUA 4XH9B 5TRTA 5BVHA 3K6SA 4NXMB 1GZ7A 3FYUA 4Q4JB 1PFQA 2WJIA 3RUFA 2IEGA 1N7JA 3W1VA 4BBPA 4DKXA 3E3LA 3T1HB 1NXSA 3B6IA 1Y9EA 4KCGA 5FLEX 3QEMB 2O5RA 3QX8A 1L4MA 2DUMA 3NYQA 2P6NA 3C5CA 3UY4A 2ZUWA 5EJEA 1FRFS 1GTMA 2R6HA 2GB4A 2AMJA 2C3UA 4OY3A 4EVRA 2PANA 4MWSA 4G1FA 1U99A 4WZAA 3W3AA 2C96A 2FZLA 1IYZA 1Y9JA 2Q1UA 2P2NA 2FSSA 2P4SA 1NOJA 1VE7A 3DEZA 4IDAA 2QN9A 4ND2A 4TM8A 3V7NA 4U7DA 4WRRA 4F06A 1E60A 1H2FA 1JQLB 1T5LA 2JDIA 3NMUF 4BEBA 3QY0A 1PJQA 4JVSB 5JJKA 4X71A 1E2UA 2ZRMA 3SS9X 1DAEA 2RC6A 1Z6YA 3PITA 3QUBA 5UKDA 4CDMA 2HDHA 4FU0A 1RPTA 2R00C 3M33A 1BXKA 1F2TA 1H6BA 3I2YX 5D3KA 3CKKA 4NMXB 3ZLVA 1E5LA 2ZI4A 1Z29A 3B2EA 2WNSA 3G0GA 4OI4A 5JBIA 1PL0A 2C83A 2IGBA 3FYDA 2JIMA 3BE5A 3C6ZA 1QOPB 4OB6A 1ECGA 1X7ZB 4AC9A 3AKZA 4P33A 1X94A 4D9EA 1DOHA 1ZXLA 2IZ5A 1C4XA 1E1LA 3WFIA 3TDNA 2C98A 1I30A 1XC7A 2W2PA 1PWEA 3CV3A 4HYTA 4TYPA 4JC5A 3QKTA 2C7GA 5E8RA 3WIOA 1CRPA 2Q4OA 3VDRA 4B46A 2R66A 1A71A 2YZ7A 2Q6LA 5K1ZA 5K0EA 1UAAA 1WUYA 2PH1A 3NONA 2FP3A 1P6XA 3HMKA 3BGSA 3ZHBA 4C87A 3EZYA 3H84A 5U4QA 1SZCA 4WOPA 4G0OA 5LB4A 2PSHA 3VC3A 1G8MA 2HA2A 4CU5A 1LW7A 2ORIA 3I9V1 3UK0A 1HDEA 1FUYB 3PWKA 2ONJA 5HUJA 2UUBB 1E2HA 1MOPA 3GLKA 5DSXA 3W90A 3CGGA 4ENUA 1M8JA 4UTXA 4ER6A 4ML3A 3PE4A 1XD8A 2EBWA 4XYLA 4BNXA 3L46A 3UXYA 2XUQA 1ISIA 1AUXA 3SF8B 5JYBA 2M32A 1FB5A 1CS0B 1KZ4A 4INAA 3J81A 2E48A 4XQCA 2QRZA 4IQGA 4OFWA 4CQLB 2KSQA 1EWYA 3ZWDA 1GUZA 1HT1E 3ND9A 2G17A 5D00A 3VVMA 5CRIA 4WY2A 3H8SA 3HTXA 4AZ0A 4FXOA 1RXCA 5F9MA 4V0QA 1E7QA 4NFSA 1UPUA 3AJDA 4QUDA 4R8LA 2JA2A 3ZI4A 4AG3A 5LP6A 2Y6VA 3GCWA 1GNRA 3IAM6 1HZZC 4LPKA 5M34A 3E9MA 3NVKI 1IUPA 1ML3A 3R9XB 2R8ZA 3MTDA 3FNGA 1HRDA 4JLMA 1GCUA 3TPCA 4XB2A 3FPLA 1C50A 2QV7A 2PH3A 3HUEA 4DMKA 1KETA 2XE7A 3L82B 4FGWA 1HEIA 2F3RA 3GNTA 4GLLA 1V35A 3QVKA 5CYGA 3AVVA 4CYMA 3FSGD 4TTVA 5JXGA 3KKPA 2ON6A 1VJ1A 1C8BA 1Z16A 2YIVX 3F8SA 3KT6A 3N7UA 4JUIA 4OKNA 4ZWNA 1F4VA 1U94A 3PHLA 4Z4QA 1CZUA 5T64A 4LYAA 3F6PA 2W6JD 3DTVB 1AHHA 5CJJA 1P0FA 4LC9A 1XTKA 3B6ZA 3B7WA 3WY9A 4EKNB 4ALMA 5ELMA 2A67A 5BN5A 5HYVA 2GF0A 4A8JB 1XG5A 5AI8A 1R0SA 1WDTA 1H2BA 2XJ9A 3GN2A 4R71A 3OPMA 1R5OA 1F8YA 1T5SA 1YKGA 2F6RA 2XT9A 3W05A 3IDZA 4EG1A 4MGEA 4ENQA 3MAJA 1VA5A 4M1KA 4OXXA 2QTZA 3I0NA 2GCIA 3PC3A 3IUMA 1JA0A 5JOQA 1GU1A 1KZ6A 5G0UA 4BKUA 5FWXB 5I7WA 3EVDA 5J59A 1XV5A 2J5KA 3FYSA 3MTEA 5BWMA 3AJ8A 3QWHA 1GKYA 1XMOB 4Q12A 5HIIA 1XDWA 2WIAA 1BGXT 2G1UA 5FUYA 1BXGA 2CHUA 4PC6A 4MV5A 5K0LA 2QVGA 1F1JA 1H2YA 2B2CA 8ABPA 2I7VA 3OX2A 4N8SA 2P3QA 4QARA 5KREA 2O8CA 5JC1A 2A6PA 3ETLA 5AVXA 3DZ8A 3AU8A 3Q15C 5SY9A 1KK3A 4QWWA 1S9DA 3F8WA 3MILA 3ORQA 4I9FA 4Q05A 2ZIFA 4L9WA 4AS1A 2V98A 2SKDA 2ACVA 3HU3A 4GKAA 4BMSA 3KV1A 5F77A 1GLGA 2BJVA 2D59A 1JR3D 3VKGA 1P44A 2WF6A 2HHLA 3GUYA 3WLJA 1CERA 1SR8A 1NNSA 3BMXA 2QUHA 3RYIB 2RAUA 4ZU3A 3TL2A 1VKRA 2OGTA 5AOBA 2EBFX 3WK6A 1JG1A 2JIRA 3LT1A 3LPCA 4OBWA 4KUEA 3DVQX 1VHLA 3LXXA 3U3JA 4RTOA 1B8VA 2P77A 4ER5A 5KNBA 1YDFA 4Z9FA 4DUGA 3LBAA 1N2CE 2QI9C 1K86A 2WV7A 3NHJA 2G0NA 4H7EA 3R8CA 5KOJA 3PYLA 5IBRA 3TDKA 4D45A 4UMEA 2JLQA 4M9SA 5T4BA 2NU7B 5CVCA 4F56A 5T41A 4JYZA 4BO3A 1P77A 5K3SA 1PK9A 2RCNA 2IHVA 1BDMA 1QUEA 2JZOA 3WOHA 2WP0A 2V0CA 3A2NA 3H0CA 3ZOKA 4YRZA 2RHTA 2YIJA 4HDRB 3L7JA 4YRLA 1PG5A 1Y8RA 3AV3A 3KALA 4UAUA 1NNEA 4D44A 2FWRA 1BWSA 3GY0A 3PGJA 1XDUA 4WOKA 3RHZA 5BW4A 4ZQEA 1IATA 4HDOB 1Z74A 2FPSA 3CURA 3IXLA 3VU0A 1RJDA 4MPPA 4V0RA 2QNBA 1EM6A 1O94A 3HFGA 4DILA 5E6SA 1SVWA 3BCUA 4U0KA 2CK3D 3DQPA 4ND8B 4XD2A 1CUGA 4F9EA 9LDTA 2BGMA 2R3SA 1EUCA 5I8ZA 3ZBTA 4PAQA 1SZDA 3X2FA 2VPTA 2C5FA 4FILA 1GQSA 4XCXA 1F7VA 1AQ6A 1QHNA 1V96A 2C9YA 4LZZA 2FTKE 5DB4A 4NH0A 1T1RA 2VT3A 5TPZA 5JISA 4RTQA 3BICA 5CHEA 2FWJA 2Z9BA 4MVYA 5EXXA 5JDIA 3TIIA 4FZ5A 1TA0A 1Z0SA 3PPXA 1VLLA 4I1SA 1LC3A 2WI8A 3BMCB 3O4VA 4WCFB 1O6ZA 1D07A 4AN1A 2DU8A 2VQDA 1EB9A 1S7GA 3NIFB 1A27A 3HA2A 3PVZA 4H2DA 4E5VA 2UXCB 1P7PA 3C39A 1JSLA 1TK2A 2ZJAA 4AO8A 1FJXA 1OIXA 4S1TA 4YO7A 2A9QA 2ZSIA 1L3CA 3NBMA 2Q3EA 4GXRA 4IMJB 3B70A 1ABEA 2VQ6A 1JPVA 4P0TA 5I01A 1JDTA 1R9MA 5GQSA 4C6HA 1C4OA 3PVSA 1OXUA 1D2GA 3P9CA 4XJSA 1QG0A 3B82A 3F7OA 4BTLA 4ISBA 2AGVA 3L79A 5FI3A 2DCUA 2RGWA 5F23A 1U2SA 5K0ZA 1LTQA 1YS4A 3QVJA 3LPLA 3OLCX 3ZYCA 4MIYA 3WRVA 4AUKA 2H59A 2DR2A 1OYVA 1R5JA 4Q4AB 2ECKA 1HA3A 1D2NA 1WQ1R 2WTEA 4NV1A 3CO0S 4V2UA 5H81A 2F55A 1Z13A 3GFVA 3V7WA 1N5JA 3BFKA 2WM9B 4PYMA 5B6IA 5JAZA 5CIYA 3SIRA 4KO8A 4FP9A 1Z4IA 3UM9A 2WZDA 3KEFA 4KFSA 1WMAA 1IEXA 4YJFA 3LWNA 4TVKA 3QHPA 1P3DA 1J56A 2IYZA 3DGEC 4M0DA 4ROTA 1T0HB 3PRYA 4AZ3B 2XBLA 3OJLA 4Q9JA 4TMXA 1XNGA 3A1UA 4FOTA 4PS1A 1KTIA 2PY6A 4MQEB 3NEPX 5GY7A 3MCTA 4CMKA 1PJZA 4F9GA 4G8CA 3RVRA 2AZTA 1C8KA 2GPNA 3ZC3A 4BB0A 1L8QA 2GA8A 2P9TA 2Q9BA 5K8LA 1XWWA 1FXWA 3OZXA 3RFXA 4PG6A 4I0WB 1OC2A 4PHGA 3QJYA 4IJUA 2C7QA 3GGDA 5HFAA 4J8PA 1WM1A 5T5QA 3V2IA 4RZUA 4U6QA 4JBHA 4G37A 1AVTA 1OPRA 2ZU6A 3A9SA 1KC3A 1Q95A 3EGXA 3JQ8B 1P2SA 4QELA 4GI3A 1S4MA 4RGQA 1GPH1 3PCTA 4GOXA 1IXZA 1KQPA 2VK4A 1PF7E 3N59A 3LLCA 3EHEA 4HDKB 3KT0A 4G0UA 2O2DA 2XMBA 2RIRA 3H1AA 3K71B 1W4RA 4JXKA 4YRQA 4EB6B 5BNIA 1Q1AA 4NE9A 5GOZA 3Q7RA 2CNKA 1RRKA 3LPAA 1LZLA 3LJKA 5B1SA 4BE7B 3USZA 4RF2A 2J3JA 1E3DA 2XMRA 1RAEA 3WHIA 4DRXB 2IYTA 2VF7A 2H2WA 3S1LA 3UV3A 4OXYA 1MC8A 4C21A 3KOOA 1Z15A 3A9WA 3E9QA 1WZCA 4XSGA 4BTEA 5D01A 1SC1A 2JD0A 2O5EA 1DAOA 2XQVA 1OLXB 3C48A 4CM6A 2OBNA 1SGWA 1WMFA 1NFQA 2IQIA 4FOPA 3V8BA 5EZYF 3FHJA 4IVPA 3Q3GE 2EWMA 5CA0B 3OIDA 3EEQA 4H1UA 1QDLB 1E61A 2C94A 2DQ4A 3BCSA 3E9NA 2D74A 4A8HA 4DDWA 4BNNA 4KMRA 1PSWA 3U61B 1DXOA 3BORA 5KDDA 1QH9A 1HI9A 3HXMA 1MQ8B 2CN1A 2GDZA 2LKCA 5AM1A 1J42A 5JALA 2HA3A 3T7RA 2ZULA 5F35A 2J3EA 2KJQA 1OA0A 5H82A 2Z2IA 1N77A 4I6JA 3V46A 2PKEA 4W5RA 1ULSA 4OSPA 1M34B 3EXG1 3R6WA 1LQTA 1Q3KA 5JH7B 3OH8A 1XQYA 1QCCA 3FH0A 1OKKA 2Q4RA 4G0PA 4I66A 5EJMA 3ZPXA 4IDQA 4DV0B 4F7DA 5DI9A 3WLLA 1C3VA 2Q5EA 5HRAA 1J7JA 2V4MA 2G40A 3K8OE 1AKTA 1LS1A 3HCRA 3PRKE 4P6VF 4DMCA 1PVVA 4BMOB 2XVYA 1R3DA 1QRDA 1EZZA 1F6DA 2XOKA 3D1VA 3FMPB 3G5UA 3QVVA 3O3CA 4O2AA 4ZC1A 1LJUA 3ZWWA 3L7YA 2BHRA 4R3WA 5KYUA 2Y3IA 3S2SA 1DOZA 1JAYA 3KK0A 3KWMA 4JI0B 1DG9A 3FRJA 1TC1A 3LVBA 4FYIA 5E6UB 4DG8A 1MVLA 3I6YA 3FYCA 2BFBB 3PF9A 3DZBA 2OE2A 4YV0A 1AKEA 4M9RA 1EINA 2G0TA 3DJFA 4P82A 2BM0A 4YAFA 3ROGA 4FGKA 4QFCA 1IEWA 1AKQA 2PX0A 2A56A 3R09A 5HQJA 4BAUA 2UZ0A 1O97D 2P2SA 1YVRA 3HBFA 4NAHA 4N65A 4BLOA 1EU1A 3UIEA 3VI4B 3C3KA 5IH3A 1GGHA 3HWSA 1SBQA 2IDZA 5KDOA 4CM3A 5MN4A 1GZUA 3LDFA 3TOVA 1SC6A 1TA9A 2C4MA 1T25A 1SU7A 1UFRA 2RG7A 2Z4SA 1OLSA 3D3QA 3NHWA 1DZIA 3SMQA 2I6GA 2GD6A 1GLVA 2PFSA 4RQAA 1CZRA 3OZGA 1T9CA 4BN4A 5I7SA 4R1OA 2AN4A 2WSYB 1T8TA 1ECFA 5KYKA 5K3AA 4AZWA 4V02A 1RJGA 3Q3VA 1KMHA 5JDCA 5C18A 5KO2A 4HAZA 3VAYA 3DKIA 1JJBA 1QIEA 4K9RA 4AMUA 3NTQA 1XGKA 1XAGA 5I4BA 4D8VA 1XQ6A 4D1YA 3GLSA 4GO1A 5ALOA 5TDHA 5J4KA 1G8SA 1T0IA 4LYGA 4LY3A 2IU4A 2P40A 3FUUA 5C8DA 2PTGA 4PG7A 3GJRA 4IX1A 4TRRA 1B2RA 1C30A 3SBDA 3ZHCA 2BISA 1JVSA 4CN9A 5A0FA 1HQDA 4ACBA 4CLOB 4ZYVA 4CV2A 4FINA 4JB0A 3G8DA 4TYMA 1C9MA 4D3ZA 5A4AA 4QRHA 4XTRA 3NWJA 4U2CA 3PQ7A 2EQ5A 3L7IA 2VDJA 4LRXA 2W6QA 4QNNA 4TXNA 4XYGA 1UXJA 4XPIA 1UKYA 2QGFA 1Z0FA 1Y63A 2CXQA 4KAFA 5AK4A 3KO8A 1RE0A 1JA1A 5TGDA 1GQ2A 5J2UF 3UN1A 1I7NA 1J8YF 1ISMA 4B33A 4HG2A 1E3TA 3OFVA 3VVBA 4CG3A 1ZYUA 4JUBA 3ZDZB 2DJIA 1NI3A 3GRYA 4H31A 3OD1A 4PC1A 4R1NA 3RIEA 2WOJA 3GPLA 1WD5A 2OORA 3W0LB 2GJ9A 1XE3A 1GUAA 3L05A 4QYXA 5HFJA 4AUMA 5FOQA 1MABA 1NXWA 2FI1A 1O95D 1I14A 2NT3A 3E5NA 3G2JA 4QTZA 1X19A 4KO4S 3WYEA 3VX3A 3ZH9B 5AOCA 4L5IA 1A7KA 1ZXBA 3OZVA 1BE8A 2CLLB 3FETA 4IDOA 2DKNA 4BECA 2X6RA 4GLBA 5EEGA 1KQGA 5EIBC 4Q1FA 2Z1MA 5LNK6 1FMLA 3A14A 1T3LA 1PFWA 2GK7A 5CTJA 4GR4A 2O23A 1HDZA 4IMIB 4UTZA 2QIPA 3IDOA 3IAEA 5IDVA 4H16A 3OCVA 4L8VA 1JPJA 3ZBPA 5I3CA 1Y9ZA 1GXSB 2GK6A 1EDDA 2B8EA 4L5AA 2PKWA 3K2QA 3IYLW 1R8QA 5EWLA 4EHJA 5U1PA 2QZSA 3S44A 5IZCA 4I4IA 5JQGF 1ATIA 1FFXA 1L5RA 1XTQA 2BW0A 3ESBA 5KKCA 1OH6A 2C4NA 1AQJA 5K09A 4M49A 3ZQUA 3A7EA 3MBOA 3OZWA 4MWCA 1G2QA 2XNDA 2HMUA 2G72A 1RRPA 3GCXA 4JL8A 5DXJA 5FPHA 5KNCD 4YMIA 5KOJB 1E2BA 2O0JA 3LP8A 2OAP1 5IU6A 1P4JA 1M34E 3E1SA 1IWPB 5FV7A 1QU3A 2IS1A 3SPXA 2GNAA 2OFWA 2HEGA 3BK2A 2A0WA 1O96B 5IJXA 3WGUA 2J08A 4R8KA 4DKJA 1G7SA 1GTG1 4FDUA 3GROA 2BHNA 2GZMA 4TS4A 1KK0A 4QGSA 3NUGA 1I2AA 2J9RA 4R2HA 1MJGM 3T95A 3DNMA 1JH9A 4H27A 4UMFA 2QX7A 3P9YA 2ZFUA 1MX1A 3QKWA 4K40A 4RZHA 1UXKA 3RU3A 3UICA 4GP7A 4DDMA 1HE3A 4JUCA 2A52A 4QT0A 1YB7A 2O3TA 4J0EA 5CEJA 2JGIA 3KZOA 4L16A 1TUBA 2Z5LA 2D1RA 3VYVA 4BO7A 1CEQA 2WJGA 1X13A 1RKQA 2Y05A 3GMIA 4Y6LA 5C8ZA 2H5IA 4QO7A 5AW8A 4EJ0A 2DBQA 5H70A 3ZDAA 2YNMD 4TV9B 2H18A 2Q41A 1B15A 2QZ4A 2YRWA 3N5KA 5IFLA 1M6HA 1VBMA 3KPJA 2H17A 3ORYA 4IIJF 4FX5A 4G8BA 1XB2A 2XGOA 4PGAA 3HUTA 3PPVA 4O4HF 3FSEA 4HH4A 4FZVA 4Y6OA 4ZJZA 2GERA 3AYZB 3H42B 4BLVA 5AVTA 4UBKA 1XZLA 1E5QA 1IWOA 1OX4B 2J9GA 5M3BA 3DHVA 2XUZA 3RC2A 3OC6A 2AI1A 2FKAA 4MV8A 2PMFA 1A9OA 1DEHA 4B3SB 1GG8A 1NBWB 2E5WA 2ZRHA 1DQZA 1J9GA 4YMSA 3U62A 5A04A 4Z5XA 2VJQA 2RGYA 2CLEB 1R00A 4DUYB 4NPCA 2OXFA 1TTQB 3SX0A 4AK9A 5F52A 4TM7A 4HO1X 2JBWA 3FE2A 1ZJ6A 3ECSA 1COZA 3LXRA 4G5QA 4JVNA 1QO7A 1EK5A 4NICA 3ICWA 4EPYA 1PV1A 2A7XA 2W2MA 2QMQA 3D7RA 3ESXA 3A2KA 1X9HA 1H2AS 1BOOA 4JMLA 1H9BA 4NBSA 2WAOA 3ZGNA 1G3QA 4WN9A 5JNVA 4AKIA 1WB9A 1ENYA 3B1WA 3MVEA 4OHCA 3LS2A 3EW7A 4OX9Y 1YASA 4PBTA 3E3AA 1XYYA 3TQTA 1JXQA 4MQBA 4WKCA 1CRWG 2FSPA 1Y80A 3IHKA 4C29A 2O8FA 3P27A 4RPKA 4Q9KA 1L4KA 1JSZA 4Q16A 4P5EA 2ZSUA 3OZDA 3LA8A 4G1CA 4TROA 1KF0A 3V8VA 2IJGX 3ANMA 3IP5A 1N2BA 4NBKA 4MQUA 2IUSA 1CUCA 2HIHA 1SQ0A 4PYJA 2F9FA 5IT0A 1U4NA 3GIDA 5BYBA 4W1SA 4ARCA 4RVUA 4P38A 1TJNA 4WESA 4ESVA 2EP8A 3OE7D 1IN6A 4UHJA 5L3VA 3ZIAA 2JJ2A 3DOFA 2Y1GA 1EZ4A 5E0OA 3IAS1 4JJEA 3TE6A 4IFEA 2G67A 4R8VA 2UYQA 3OQIA 4UM8B 3IHLA 3IAFA 2XZTA 3IB6A 4YMHA 2YQ5A 2X5OA 4MK4A 1K3UB 1AH2A 3AFIA 1ZK2A 3HB1A 4Q15A 2J0VA 2Y8EA 1XZAA 4PX2A 1RAGA 5H9VA 2VTBB 3ND7A 4BB9A 1XALA 1XVIA 4Z4CA 4MUXA 1PJLA 5C2JB 1RHKA 2IYFA 2QL5A 3WI7A 2WF7A 3U7IA 2XTAA 1E2JA 2GJKA 1BW9B 2QA5A 3NHUA 1XDGA 1XZKA 4NK4A 1W93A 3GV0A 1XROA 4DYDA 1CY8A 3OO0A 3ZXUB 1Y7LA 3LI2A 1P80A 3T54A 4Z7OB 4FR2A 2QW0X 2I2FA 1HT3A 1KAOA 2DF8A 5EESA 3U80A 3VOTA 1EFTA 2QQFA 3G2IA 4B4DA 1DI0A 3NNDA 3EXHA 3OMWA 3QMMA 3IAXA 4MIOA 2IPXA 5E7IA 4GR5A 3CVWA 3D4OA 1K6XA 1N1MA 2X9LA 3K3PA 5DX1A 3UCXA 4DF3A 5BYAA 1V8FA 2R1VA 3U9SA 1NP7A 1M73E 1KYVA 3EBLA 3WNQA 2PPVA 2LPMA 3OE7A 1HOTA 2PLWA 3T1YB 1Z45A 1QHXA 1Y42X 3VZQA 1T6BY 3UJAA 1BA2A 4N8DA 4CR8A 2OYCA 1DFGA 4C06A 1JQKA 2FNAA 2H65A 3R3SA 4JC0A 2HWKA 3F8TA 3FUTA 3WGNA 4NG5A 4DN6A 5M5BA 4AAYA 2F62A 2REBA 5ALXA 2QSUA 3SC3A 1TVCA 3F7TA 4HXEB 2PLAA 3UW1A 4DM4A 5I5EA 4GX0A 1VMEA 1JEQA 1TD9A 2FSHA 4TOIA 3DD5A 1RSZA 3FNBA 3ISVA 5JYCA 1L5FA 2LDBA 2GN6A 3A2MA 2O2JA 1KRXA 2RHGB 1KXJA 4IICA 5BSRA 2OLKA 1M34A 1VSUA 3O4IA 2J87A 2AOUB 1NBAA 2GCGA 3RSOA 1ENZA 1WR8A 3OCYA 1MP0A 5BO5A 4Q4HA 5FAXA 4FIZA 2FLVA 3IP8A 3L1IA 1NN0A 1X1BA 2WYVA 3S29A 1G8KA 3A10A 1OFIA 1VZ2A 4LDNA 2H2GA 4OQZA 3LWZA 4UXJA 1IQPA 2EU8A 4WE3A 5FUVA 2QYSA 2QX8A 1VL2A 4D74A 1XHLA 4RSMA 2QRUA 4F2PA 3WK8A 1F5NA 1QXSA 2QRQA 5DTEA 1SCQA 5B7NA 1BDIA 3EZ7A 5HUHA 4BNFA 2X9VA 3QZUA 1VFNA 4FGSA 1JEYA 2VA9A 3AUAA 1IHUA 2GM4A 4G01B 5K0SA 4HVAA 4DHWA 1H2RS 1E9CA 2P4UA 2EEZA 2V3WA 1GPUA 5KUTA 1JR2A 2SNIE 1CUWA 3K8QA 4PNZA 4U2FA 2G4VA 4X7MA 3RJTA 3GB9A 3RTCA 3PDHA 4DC1A 1XN4A 3GELA 4DDUA 1QTQA 3T12A 1FFBA 4HCJA 1FLDA 1NVDA 2F3QA 1LDEA 4QDJA 1E1DA 4YLEA 4MVJM 2OO3A 1OW3B 1BXRA 2GUGA 2O0LA 3K30A 3NHLA 3QXGA 4LZNA 4HKTA 4LSZA 5KKAA 1OXMA 4QU0A 3L8HA 1W2GA 1B26A 3RT1A 3ZNNA 4HMPA 5K01A 3JAKB 3ND8A 3DVSX 2NGRA 4NLLA 4FNMA 4YJ3F 1H66A 1ZGZA 1HNZB 1OU0A 5CYFA 1R4AA 1JQ3A 3KTAA 2C4TA 1AUOA 4JGIA 3P9SA 1WAMA 4MUNA 1AKRA 3LSTA 4ARVA 5LLTA 2XCSB 2OR3A 1ZJ5A 1WU7A 1GT6A 3R0ZA 1TW3A 1J0DA 4MEAA 4BRWA 3L2OB 4IF6A 2OENG 2EOAA 2NP6A 4WTOA 5GIOE 2V7GA 4B84A 2OXRA 2WKSA 1NMXA 4RHYA 5ALYA 2YXNA 2YWJA 2ZSFA 5FPSA 3IQEA 3GRAA 5K9ZA 1HDXA 2A30A 2VNSA 4DFDA 3EASA 2WVAA 4IDBA 5JATA 2FX3A 2FN7A 4ZMSA 5CT6A 1FMJA 3BJRA 3TAXA 1RM0A 2BTOA 3IURA 1V1JA 3LUDA 1IY8A 1X7GA 3ENNA 1QMPA 2WV9A 2JARA 1VCIA 4Y6QA 4QOEA 1B4DA 4KQHA 3S2IA 1K6MA 1XWFA 2AFIA 4RORA 5B4VA 2BEUB 2FSUA 2QWXA 2V03A 4OH7A 4PHFA 5C1DA 1E0JA 2O0HA 2P68A 3RIMA 4G85A 3G79A 4OFZA 2A1UA 3LUCA 3RK0A 4DIEA 4JJ8A 5EFZA 4ZEWA 2I1QA 4XE5A 1VMKA 2G1AA 3RTBA 4HS9A 3V7YA 3R3JA 4EOGA 4KDCA 5DCUA 1K0UA 3D7MA 4RFVA 4Q9LA 3SYTA 1JX6A 3HPQA 4MP6A 1SU8A 3AHDA 4YUXA 1V9SA 2Z5GA 4LZJA 4MV6A 1ISJA 4IDFA 2P9EA 3HL4A 2OQ2A 1CJMA 2YUIA 1YBVA 1MB4A 5EJAA 2F9MA 4MHSA 3GLQA 1CNFA 3L40A 2AXEA 5D2CA 1FDOA 2JJYA 2W0MA 4UHBA 5EWLB 3LKDA 4BVBA 4HAUA 3L92A 4WA7A 3DFUA 3IP3A 2PGIA 1NNLA 3I1IA 1M2JA 1U65A 1FQOA 3GH3A 3JSXA 3L4SO 4ATNA 4BRUA 5BV0A 1X6VA 4MYUA 4AG5A 5ICMA 2J5XA 4DBLE 3EEOA 3R9WA 1QF6A 4XGQA 4Q1VA 1DNPA 1IOVA 3NBYC 2B7CA 1DJMA 3LYUA 4UBJA 1K2VN 1YDEA 3CX6A 3IKVA 4G8JA 2GRAA 4WA8A 1AB6A 4WXPA 4UPEA 3SX2A 1Q0TA 5AXCA 3RROA 2C4WA 4HZGA 4V39A 2VZ8A 7ABPA 1M5RA 5FL7A 4LKRA 1V1MB 2HCFA 5I45A 2P2YA 3KR1A 4CL8A 2I71A 5CNIA 2G8LA 2RFLA 1KMIY 4D4KA 1TZJA 2F64A 5IVDA 3L7LA 3DH0A 3TMAA 3ORRA 4V2IA 3AHHA 5B1HA 2A54A 4H60A 2IHJA 2IUEA 3M4XA 2QRHA 3PFHA 5FOWA 5JV5A 4LGCA 1G17A 5E2AA 2PYIA 4UDXX 4GEKA 3TAHA 3REOA 4EDHA 2HUPA 1PRYA 5FHRA 5JD3A 1O8CA 1FDWA 4CEIA 1SVMA 2FUG1 3HXLA 5EPOA 4BGIA 1ISFA 3L0IB 2FQYA 4HQLA 2IQ5A 3T3IA 4BQFA 3UHJA 1WXEA 1Q14A 4I4TF 4OQDA 3JYQA 5HVNA 2H2HA 2YV3A 5LXTA 3K32A 2IYLD 1N5OX 2NXWA 3DTNA 3KVVA 3QA9A 3RYIA 5JNTA 3GRVA 4KR2A 1UJ5A 4EY4A 4F2DA 5HG0A 1US8B 1G21A 3NYWA 4U2KA 1N3BA 3UFXA 3C6BA 2I2DA 1Y8QA 2OHHA 4E0BA 4G23A 3FPFA 3GUUA 1W0KA 1O97C 2YW2A 3N3BC 1KEPA 1YQWA 2GM5A 1OASA 1REQB 1USKA 2G1JA 4OGKA 3CPJB 3CW2A 3MMPA 4N6GA 1BD3A 1GWNA 2D1FA 1QLWA 2CFOA 2G1KA 1DBVO 3E82A 4BCCA 3WMFA 3DFIA 5AKZA 3NRCA 1Q2UA 1N2OA 1Y8CA 3S55A 3WJ2A 4BO8A 3TOCA 4TT3D 2EERA 4JCOA 1O57A 4BRZA 2ECQA 5FPKA 4MJLA 4QBFA 2FWMX 3FTEA 1PZFA 1OZFA 3IQZA 3KYDB 3O31A 3VR2D 4OL0A 2FQQA 5HGXA 3I4FA 5EKDA 4RLHA 2OKGA 3DPSA 2VOEA 4DR6B 3ASZA 4YQFA 3T7SA 2G16A 2H4YA 1B6SA 2AF3C 1F5SA 2ODAA 2ODPA 2ZUCA 1CF9A 1GXSA 3B1ZA 3BF7A 3EIFA 1QX4A 4O2RA 1C14A 5FBZA 5J2TB 2NXNA 1ZQ1A 1NXQA 3FDFA 1X7XB 2OORC 3DLTA 4RZ2A 5MGBA 2FUNB 2YS7A 2P7IA 3ZLUA 2BEKA 2XNCA 2GPBA 2TMKA 3AI2A 1DINA 3MT7A 3QIAA 5A5FA 1G59A 4D4LA 4YP1A 1SUBA 5D7BA 3PPYA 3OQOA 4E4TA 1G2OA 1C3LA 3NC0C 1U2TA 1XELA 2WY2D 3GJXC 3EAFA 3JQ9A 4NJMB 1HDIA 3HCPA 4N0EA 5KYVA 5K45A 1RXVA 1M2VB 1GGVA 4IIVA 2EKQA 2FMKA 3ETHA 2IZ7A 3KRTA 4LJ9A 3KDPA 1QTRA 1MOZA 1Q6ZA 2G70A 4QFDA 5ALEA 2QRLA 2JVKA 4LZOA 4WKOA 1U4OA 3QVSA 5AVOA 4WBNF 1N57A 4U2GA 1N6IA 1OAOA 1VRCA 2PLNA 2I4OA 3O9VA 4JHLA 1P1KA 1M1NA 5IEJA 2O8DA 4KACA 2ZYGA 4UHDA 3KWLA 2ASVA 4F4DA 1RMYA 1MTZA 3D64A 3FUXA 5F4ZA 1CHDA 2RD2A 3JQRA 3DD1A 4WLOA 2B1RA 2XXAB 4K0KB 1LC0A 4MS3B 3ONVA 5C1OA 2II6A 4M8LA 3MWEA 2LKDA 3IDQA 1K88A 2YWDA 3K70D 5FA5A 3SU8A 3O1JC 3U4MA 2JIZA 4HS4A 5FR1A 5BRAA 1X7WB 3MUEA 3AVWA 4K9SA 1EE2A 1UANA 4O4LA 4YPVA 1M2KA 3MLEA 3U4IA 2P2GA 2B69A 3QVTA 4Q4AA 2W83A 2XYVA 2P78A 1N9ZA 1ONPA 5G4LA 4AP5A 5LL6P 1Y6ZA 4NYMR 4Q3AA 4YJ2F 2HSDA 4LRQA 1ODSA 3K9BA 2P1DA 2PJRA 3H8VA 3GJSA 2XXBA 5D5PA 3S1AA 4DCUA 4KRGA 1Y7PA 2GZDA 5ALDA 5SYAA 4B47A 4O8ZA 1EVZA 4L28A 3IJRA 4V38A 1GKKA 1FRZA 1V6CA 2GN8A 4YJFB 5B3LA 2O0KA 3FHCB 4B3FX 2V0NA 4B76A 4EKEA 1H3FA 4KK4A 5KYNA 4LISA 1TPZA 5JAQA 2P1ZA 1UR5A 3UB2A 3AI3A 3HLTA 4FYKA 4AXXA 3EF0A 3AP1A 4B0PA 1IC6A 1W0JD 3DBHA 3QBDA 1WUKS 4HB2A 1O5OA 5TT0A 3NTLA 5BNWA 1Q1GA 2HJGA 4KWCA 3DVAA 2YX1A 1P4HA 5THXA 4JLNA 1QJ4A 2F67A 3FKQA 1YS6A 4OOFA 5EIAA 5G02A 3SYMA 3VO2A 3W2GA 2N75A 4HGYA 2WIDA 3VU9A 3WQQA 1JBKA 4XM0A 1UJNA 3IBSA 1F2DA 5EQJB 2WT4A 4WD3A 5CYPA 3LXMA 1S6YA 1WCIA 4HQKA 1RJEA 5FBQB 4BKRA 4BZXA 1H23A 4QA9A 3ZLTA 1XTJA 2W2XA 3OZSA 2VK8A 3I32A 3M4YA 1X39A 4ZT4A 4PPGA 3K0EA 3V42A 4D4JA 1M6VB 1KSJA 4L4ZA 3Q5GA 3PGVA 4AFNA 1KYXA 4N7MA 4OP1A 3NATA 3SQNA 4XARA 3TZLA 5JAIA 2PKYX 3UWPA 3UBTA 1JFVA 1PD0A 1VJGA 4IVNA 2NU7A 2QLBA 3B78A 4KQGA 3QVLA 5CDTA 2P9CA 3B1JA 2K2QB 1XQVA 2AH5A 4ZFNA 4DMLA 5I7RA 5EWJA 2WB4A 3JWPA 1VYVA 3WK9A 3IIJA 5FO0A 1UJMA 1MZVA 2XTJA 3WL5A 3AVYA 4YIHA 5FI1B 3PICA 3PUIA 2IXTA 2FG5A 2VJPA 4Q9AA 4Z1MD 4Z4FA 4BXOB 3WZMA 2PGNA 4WXYB 1PIWA 1ZD9A 3H3JA 1PJ2A 1TFUA 3E53A 3EC1A 4IH4A 3LT0A 4QECA 3GAMA 4E88A 4RAOA 1N2SA 4HH3C 4IDNA 1GR0A 3OZRA 3TJRA 1DKPA 2HK6A 3WC4A 2F2TA 1KEUA 1ST3A 1NJ2A 3GNQA 1Q91A 1OLOA 1WUIS 2W2NA 5COAA 5T4HA 3VPCA 2HYDA 2WQ7A 1PZMA 3B7GA 1WLYA 4FT4A 2HK8A 3ZZUA 5ALIA 4TYYA 2R68A 2W0SA 4UNIA 2O2CA 3RKSA 5CEFA 3KQLA 4TPKA 3ZEIA 1ES9A 2C5LA 1JMVA 3GDOA 2N47A 4E2YA 3INGA 1C0IA 4FSXA 1LI5A 2QLFA 3Q7EA 5A7GA 3WFJA 5K6AC 2H9AA 1JKIA 2TSYB 4ZOLA 3WISA 2GAOA 4MKXA 3N2IA 3NTXA 3Q9SA 4K7JA 3UKDA 1DP4A 2QT1A 1ZVMA 3BMCA 3EVTA 3AF1A 3F3YA 3GAZA 3CJQA 2A0FA 2CXRA 2WWYA 3CTMA 4PIVA 2WLSA 1T2UA 1OPXA 2EKDA 4LJ5A 3V5NA 4QE3A 1Q16A 2A92A 5EZSA 1CWUA 3HBLA 3MD0A 1U6IA 5A1JA 2WSSA 1EP3B 2BZSA 3CUTA 2IU6A 4WZBA 3K6SB 4DLXA 5A62A 2MINA 4U3JB 4Z6KA 2AUMA 1K5GA 1SM4A 1MT0A 1QPZA 1TYCA 4D6YA 3DLAA 1S3IA 5DM1A 5TX7A 4CM8A 1RCFA 4D0LB 4N6OA 5K0TA 4LMPA 2BDUA 4WOJA 1YKFA 3B85A 1XVVA 2BEUA 3LWDA 3MWYW 5CLIA 4P4UA 1M1XB 2XRMA 2JLYA 1PZEA 1TOAA 3TL3A 4C08A 1W1UA 3B3GA 3E58A 1NG9A 1Z0DA 2XBMA 4R2LA 1EYZA 1GU0A 1YZHA 5T67A 5BSKA 4RHEA 1GYQA 1GZ4A 1ONOA 3A06A 3BKXA 3H99A 4JNKA 3ZGOA 4KR7A 2HH9A 5JMPA 1XU9A 3GL9A 1MCZA 4ESHA 2GARA 2VWGA 1GPNA 1RU3A 1YZUA 4IKEA 1OFHA 4AQDA 4D82A 3G23A 2Q7OE 4OGGA 3G68A 4J6FA 4ZCMA 5JEDA 3WB2A 1BN6A 1D3AA 2WG0A 1G38A 1T3SA 1U9YA 3YASA 2H52A 2Q28A 1NPDA 1L4YA 2PZFA 2R8BA 3FZYA 4RO0A 2O8EA 1IHDA 3UMFA 2P35A 3T3MB 4P93A 1Q7RA 1UPFA 2OQVA 4DXAA 4BFWA 3SC6A 2P2CA 2BC9A 4DSOA 5A5DA 2JRLA 3ANLA 3P8ZA 1IDOA 4X92A 5TPWA 1I0LA 5E6SB 2ZE5A 4U7FA 3MOGA 1OBCA 4G0YA 4BNUA 3AR3A 1HTTA 5E9AA 4JDUA 1S02A 2RGNC 1UP4A 1QAMA 3H5OA 3ZZMA 1V2GA 5A9RA 4QG7A 1LI7A 1CR1A 4Q3KA 1QIHA 1CY2A 3QU5A 3C6MA 3TQCA 3BRWD 2BMVA 1DT5A 3ESYA 3I1FA 4FDMA 3PQ6A 1RI3A 1E58A 3OY2A 3IQXA 4MKFA 1A50B 1YU9A 2G9NA 2D4AA 4NR0A 4BNWA 3PHHA 4W1RA 3TNYA 2JA1A 4HX5A 3UQYS 2H1HA 4LJYA 2Q0QA 4NE7A 3NEJA 4PC3A 4PPFA 3U49A 1PT5A 1JE1A 1K8YB 4HLUA 5LMNB 1JA9A 1G0OA 1R0YA 1S2DA 1SC3A 2IY8A 3I6BA 2XCRB 4BMPB 1A5ZA 1SHZA 1PW7A 2BM9A 2JANA 2I4LA 4H7IA 4O4HA 4PZPA 4YROA 4AJJA 2OUKA 4IIHA 4OMDA 2HL6A 4Y2SA 2ZUDA 1U2DC 1YWGO 1WXDA 2VTVA 5TQJA 1BX0A 2Q29A 1JFFB 1FTQA 1V16B 2HMVA 4MUJA 5U4XA 4W5QA 2WRZA 1MW8X 4IXJA 2C1EA 3L9WA 3CFFL 2FPPB 3IPAA 2NYRA 3G88A 3K0AA 4GGOA 4IHKA 5IVKA 1LBTA 1JKXA 4NOLA 5DHPA 2P6UA 1ISHA 4LI0A 2W2TA 1LH0A 1DO8A 3G9ZA 2WM2A 1UOOA 1FBNA 1GNTA 4ZVVA 5KZMB 3MM4A 1FUUA 1JXMA 4LOJA 4KPFC 3SEZA 1ZD2P 3UHAA 5AUQA 1UFOA 2G7ZA 5JXJA 4UVGA 1L5ZA 2JIOA 4G9EA 5IJAA 4D0SA 5ALTA 4Z51A 1OLUA 2VHZA 1M1YA 2X3FA 1A9XB 1MC4A 2BFAA 2H11A 3GA0A 5CUQA 4EG6A 2Y2UA 3ACBA 2C0CA 3JCZA 4J0QA 1T3GA 4PYKA 2JBAA 1RP1A 1DKUA 1PWYE 4KQ1A 5ERYA 4RV9A 2PT9A 3KFVA 1JGTA 4H9GA 1EK2A 1H4QA 3DTYA 2OD2A 2RKBA 3UYKA 3KLMX 5KYYA 3M4ZA 5E2BA 1E9AA 1NN5A 1XCLA 3L1UA 4TLBA 3G7SA 1M2HA 5K0BA 1H1DA 1H5UA 1K4MA 3HADA 3IUNA 4LE0A 3AINA 4MKGA 3RLIA 2ROQA 3AVXA 3B8EA 2QZPA 3DV0B 1GA1A 4WJZA 5AI9A 1RC8A 3MN1A 3KT3A 4ARUA 2D1YA 5JTTA 2HLDD 2CUTA 4GRDA 3SZRA 2ZPAA 2GZ1A 2NV6A 4S1OA 4E2FA 1JG2A 1TUBB 3TOXA 3CZQA 2I4NA 4U63A 4Q4CA 5CFOA 1DC6A 4MR7A 1X7ZA 2GI4A 2H4ZA 5AVKA 1P2GA 2LRHA 2RC5A 3BZBA 4DCJA 1RLIA 2I78A 1JQ5A 4LY9A 5CDSA 3NHAA 5EIWA 3I1YA 3UJNA 4J49A 3PQFA 4L7VA 1EUZA 1AF4A 1RRVA 1RPAA 2HBZA 2CK3A 2WLTA 3Q8WA 1II8B 1VE6A 4ER7A 1BXGB 3KOXA 1HZZA 3O8OA 1MHPA 2G9VA 4YXWD 1VJDA 5K05A 3UATA 3KQUA 2X5JO 3E18A 4DSZA 3NS7A 4L8WB 1QOZA 4K9LA 5LYYA 4TT3A 1RAHA 3DQQA 4JVMA 2BTQB 1AO0A 3AP3A 3DYBA 4ID3A 2EIXA 2PVPA 3Q98A 4ITVA 2GCNA 2DAPA 2ZPTX 4GOKA 1DRVA 4X41A 5BOVA 1U90A 2CVZA 2BFCB 2QP4A 3C2QA 3C6YA 3Q7IA 4KQ2A 4RM3A 1X7DA 2V6BA 4IIXA 1QIJA 4KMOA 3WGTA 4FMBB 4C88A 4KDRA 4Y0NA 5TNXA 5FDFA 3ZVNA 5IHXA 4JQZA 1POXA 1SUSA 2QN6A 1IN4A 2P30A 3BILA 3NRBA 4NSNA 1L7AA 4NZPA 4CCSA 3L4BA 3P2MA 5G4KA 3RO7A 2IYWA 3MT0A 4RTKA 1QB8A 3NWOA 4F0JA 3OE1A 3M49A 1YJAA 2XCQA 3T7TA 3SS8A 3FY4A 4MNTA 1U8UA 1EI9A 3BAZA 3QI2A 2OESA 3I9NA 4J1QA 4ALKA 2YY6A 3TCXB 1W5TA 4UEKA 5JAOA 3ETDA 2F90A 2M9MA 4AWAA 1QFMA 2VZ9A 1K8QA 3ZW8A 5B7PA 3V8PA 4ENSA 1S9HA 5MF6A 4AY6A 4HC4A 5AOVA 2H08A 1C8VB 1TYEB 2FPRA 2RHJA 2NUBA 3CT4A 3DSRA 3F9RA 4QLAA 2W22A 2VZEA 4ZOAA 5GM1A 3D7NA 3ZYZA 4TVSA 3FDXA 1CJUC 2JI9A 3IIEA 3G0DA 1E5TA 3SYNA 1T4MA 4MVJI 2Q3DA 3ZGZA 2XTMA 3S2YA 3AF2A 3DLPX 3ZDCA 1DJLA 2W2LD 1R7RA 4B8YA 4F3CA 1KKUA 5HGJA 2INGX 1ZI9A 1E1RA 4YUWA 1H6CA 2JIQA 3GPCA 4OSEA 3RVQA 4DLVA 1SHJA 4E4YA 2B8WA 1WDWB 2AW3A 3D8UA 4E09A 1NX6A 2D7JA 3U4AA 2AC2A 5A02A 1RJFA 1HURA 3L07A 4M37A 4TYQA 2VFAA 3TCKA 2JH8A 3C3BA 1SCDA 2AYXA 1I5RA 3BDIA 4EMBA 4K87A 4KBFA 4KXQA 4H0CA 1TUEA 4DLZA 1II0A 3WWEA 4DZRA 3CEAA 3PXGA 1LNZA 4ZO4A 2ZB7A 1ZICA 4KVAA 2D0PB 4NYJR 2JLUA 5I8WA 2WWRA 1PW5A 1XMPA 4LJAA 3ND6A 3HB0A 1PEYA 3FFBA 4L15A 4PRLA 4EGCB 5IDXA 4EPVA 2WTXA 3QE0A 1DPFA 4CKCB 1UJCA 1UQRA 4WXEA 5E9JA 2CB9A 4Z3KA 4W5OA 1U5CA 1IH8A 2HJRA 2B0JA 2XPCA 3LXUX 4KXXA 1EGVB 1XPJA 2PKQP 2VP6A 4MB2A 1N0VC 5DX8A 5LP1A 4WCFA 3P0HA 3HPRA 1II9A 4LQDA 4LHWA 4R2MA 3ROMA 4FJ2A 4D57A 1E3QA 3J81k 4JLAA 1W9MA 3RC3A 1YDHA 4PC2A 4CKXA 5CFMA 1VYUA 2ACKA 4RELA 2H2FA 1YRHA 1DDGA 4QX6A 3CFHL 1N2EA 1WULS 2R1VB 4TGLA 5K3FA 3GCDA 2O8BA 1DADA 1TMYA 3CEHA 3PJDA 1C3JA 1Y34E 4RK0A 3V34A 1WW8A 4M36A 1UH5A 1T0JB 1WV1A 1V1RA 3EX7C 4I4NA 4C3VA 5JYDA 3PI6A 2HCRA 3CFIA 2LZ0A 4GZLA 4M1QA 5MHTA 1JKJA 2XA9A 4GI7A 5AUNB 3CXUA 1HV8A 3PYMA 4DMFA 1BGWA 4MYDA 1YR7A 1QANA 1FNCA 4KRYA 1N0IA 4IIDA 4E32A 3QKIA 4HQOA 1KRWA 3PFKA 4JQCA 3T3HA 2OBFA 5COQA 1Y1KE 2NXJA 4IV8A 1QDEA 1BJRE 2QROA 3CC8A 4MVJG 5JNSA 1U04A 2HHCA 5COBA 3DE6X 1ZIOA 1MO2A 3DNFA 4KN5A 1PR9A 2JLXA 2Q6IA 5AJYA 4KXNA 1TRKA 3JQBA 4M8KA 4O2BB 5ENVA 1PYOA 2ID9A 3L8FA 2D1SA 2JCBA 4KG7A 3KQKA 1GTL1 1WIWA 3QFCA 1ZGHA 4QICA 5TC4A 1KJZA 3PHIA 1V3VA 4HVCA 1L8AA 1A2KC 2HX1A 2I1WA 2NO0A 3IUSA 4ZAZA 1KE2A 3SE0A 2MMGA 3INNA 1RC0A 4Q7MB 4RBNA 4TXMA 5C46F 5LOVA 1YOVB 2C20A 2PZBA 4IXNA 4JOCA 1QQAA 3OD5A 3OAAA 4BQIA 1FIUA 2FSVA 2PO5A 2KLHA 1V47A 3NV9A 1WBDA 4IJVA 5DVZA 5BUZA 2G9RA 1C1DB 4K6CA 1ZNWA 3F73A 1JJ7A 3FCCA 2AN3A 2BKXA 3QF4A 1N3LA 1RYMA 3AUJB 1Z5PA 1XZJA 4TTAA 3F74A 4D5EA 1CY0A 1GAQA 1GQOA 4G07A 1XMIA 4JIGA 4N41A 4LG1A 3F5SA 4HBGA 4Q3NA 5EZ6B 3I62A 3FLAA 1P0QA 1X8XA 3B6EA 5DNDA 2QZJA 2O7NA 3T35A 4CM8B 1XK6A 4N49A 4IG9A 4Z0PA 1J00A 3PGLA 4M38A 2DBRA 1CKEA 1GTZA 5K8TA 3U6KA 1DKOA 1VPEA 4XDYA 3SDZA 1ESZA 5T6MA 5CHYA 3GFTA 4ZQCB 1G21E 3MNFA 5JO9A 4HR7A 2A5FA 4V3BA 1ZC3A 2ZIGA 3WHKA 2Z83A 4PY2A 3G89A 5KYWA 3TS1A 2OBBA 4ER3A 3I58A 1NBOA 3U7EB 2HJHA 4AYTA 1YHNA 1R6BX 3JQQA 4XSHA 5LLSA 2BR4A 2VWHA 4KUGA 4DA6A 5EIEA 1XIVA 2DUJA 5B2ZA 3Q10A 3JQGA 2JHAA 4OK5A 4TZKA 4Z9YA 3AGQA 1PV4A 3S2FA 1P4GA 4MYSA 1W35A 1V8BA 3HK2A 3ZCSA 2CLOB 1F0NA 3NV7A 2PU7A 3EN0A 1ZUWA 5D5QA 1AGRA 3K31A 3BWMA 1EFUA 1JHDA 1QHIA 2R1TA 3WLFA 4C7KA 3MJSA 3LBIA 1OI4A 1V25A 1J5PA 4BKQA 3BXXA 1BH6A 4G5OA 4NCBA 1VZ3A 5EQFA 2ZJ0A 3F9IA 5FR2A 1UADA 2JLAA 3WQHA 1YUBA 2HMYB 1QH8A 5ARDA 3HU5A 4QT4A 5BSFA 4OP2A 1NLMA 3OKCA 3C24A 2QG9A 4Y1FA 1DBWA 5H3LA 3B52X 4C6TB 3TLXA 4JBIA 5IVHA 3PDIA 5E2IA 2BFOA 4Q7KA 4AG6A 2ZJFA 1XEWX 1PR6A 2JGJA 3FDZB 1RKBA 3ZV5A 4EEKA 5CXUA 3FOCA 1P1HA 5ADVA 3N2GA 4IINA 2WIKA 4ZKEA 3BWBA 3KPYA 1XDBA 2ZUEA 1OU4A 2OZEA 1W0KD 3D0OA 1WF6A 3HBNA 4NYIQ 4WLVA 1TA4A 5EI5A 1CQZA 2AOTA 1HBJA 1THTA 4XRGA 3I2HA 4EB3A 5P21A 1ZOPA 1XRSB 1XZNA 3CN9A 3PEWA 4COOA 3IBFA 1TIPA 3DFZA 3ETGA 3KQWA 3LL4A 3EVNA 4X65B 2VJOA 3DCJA 1E66A 3SR0A 4RVGA 3LDGA 3BERA 4MVWA 4RTJA 3UWKA 2WG1A 1PJ8A 3Q8XB 3FGZA 4II7A 3A31A 1HKHA 2C88A 3K4QA 3GLTA 4ZQFA 5HBGA 3A9CA 2H5LA 5FJJA 3DVRX 2FF5A 4TTPA 3B3QA 3HXKA 2CXTA 2QTRA 3SXJA 2PBLA 1F3OA 4A1FA 2HW8A 3FPGA 2BGWA 2J5RA 1P8JA 2C58A 1JS1X 3D6TB 4MTLA 3Q41A 2VNKA 3VC1A 1LNQA 1Y98A 5IK2A 3CJTA 4GNKA 5AJZA 4D9NA 4TUYB 5JZOA 3WKBA 1O94C 2QSZA 1YR6A 1K5PA 1HEUA 1O8BA 1M0SA 4Q01A 1BWRA 3VO1A 1TM3E 4DJFC 2E37A 1OFVA 5CK5A 4QYWA 3PQ2A 4CMEC 1MORA 1BD4A 2HCTA 3WG9A 4YRTA 1C3EA 5EJ7A 4LHZA 3BXOA 4OP3A 2C7VA 5IFKA 4CLRA 4C2BA 2V7QD 4XDHA 2WDPA 2OVBA 4OMCA 1IMOA 4GX1A 1ZD4A 1H2ZA 4M88A 3DFKA 3P26A 4KXFB 3SZGA 3I5XA 3N8GA 2YDYA 2P4EA 4KRXA 3V8RA 4H3SA 4TRJA 2HQBA 2VAVA 3ILYA 4FHGA 1PGPA 4RTMA 3VC7A 3IOBA 3A0RB 4GR9A 4O08A 4TRNA 2JI6A 2X2EA 3ANNA 4Y6RA 4XWOA 5C4MA 4DV4B 1K08A 1YJXA 3I04A 4CCYB 4QOFA 4FCCA 2EIHA 2UUPA 3PP8A 4KIGA 4MDYA 4ZRMA 1PZXA 3EBPA 2AR7A 3HXOA 4EJSB 2XWJI 3O6VA 2VH2A 3H9UA 1IHOA 3JQDA 4NCHA 4HTFA 2REQA 4QYMA 2C95A 1MC1A 3NW9A 4GL2A 1EFVA 3DEKA 5CM9C 4KX5A 1WABA 5JW6A 3JWGA 1PUXA 1UDWA 1SCNE 1GYRA 3OOHA 1YQQA 1Z4MA 4CF7A 2DY0A 1MEOA 3JQBC 3AIOA 4U7TB 3P1JA 1XVUA 1I4LD 2EGUA 5DLDA 1QK4A 3SLRA 3HSKA 4NARA 1E1CA 4S2EA 3EHDA 1BU5A 4O02B 1JIJA 4TWRA 3ABRB 5EL0A 4BDTA 4D9HA 1QVRA 1P3JA 2UVPA 3FZNA 4RD2A 2FPGB 1OD6A 2OHJA 2J85A 2AF4C 2C2YA 3G1TA 4WY8A 1YL5A 2JFZA 1D4ZA 3G2HA 1LLCA 3PNLA 1RC1A 3EXIA 1X8LA 2IT1A 3ZD7A 3AUSA 3MXTA 1KNQA 4BLQA 2DR0A 3VM6A 5CDYA 2OL4A 5FB3A 2M6LA 1KJQA 1GAWA 1TDJA 4TMYA 1BS9A 1YQUA 2PX4A 2DC1A 1YMQA 1Y4DE 3HYLA 1NJFA 4GICA 1OX5A 1UZAA 4CEHB 3F9CA 1H22A 4QUBA 4ZCIA 1RABA 1D2RA 3PBKA 1P6QA 4BFVA 1WY5A 5D3QA 1UIMA 2AZXA 1GTVA 3FWZA 4MEBA 6NULA 3AOGA 5F9HA 5LB2A 2PBZA 2Z2KA 4TQ9A 3JARB 2WJ6A 4XFJA 1W6RA 1MENA 1PKXA 4PZYA 2HZBA 4QBGB 4F46A 5KOYA 1BEZA 2FUEA 1JHOA 3QEAZ 2XWSA 3L84A 1P7YA 4Q34A 4RK1A 3LTEA 4PGHA 5AW4A 1DWPA 7GPBA 4B7XA 4OEHA 4CKBA 1ZJJA 3L43A 2GCOA 1I3OA 1Z2NX 2P2DA 1BKYA 1IN8A 1R18A 2PKQO 1NSFA 2IH5A 1QKKA 1JMKC 2A94A 2PMCA 4CTKA 5IJZA 1X1DA 2PJDA 1IB0A 3PLAE 3O4HA 3WP0A 1T1SA 1BX3A 3EXFA 5CD1A 3GAFA 3HNPA 1Y37A 2I54A 2FU5C 2AJCA 2Q2NA 3DVAB 5F33A 1L5NA 2DWOA 3X3HA 2NVUB 4DYHA 5ECWA 4EI8A 5CDFA 4Q9DA 3U5ZB 2IDMA 2NNLD 2PYDA 1D4AA 1QWOA 2Q99A 1ZD1A 2ZWAA 1VCHA 2P69A 4UCFA 4AJHA 1QAOA 3A26A 3L93A 2ZVQX 2I8CA 4W8GA 2H8GA 4HSGA 3CZAA 1E62A 3LX8A 3DUFB 4K9KA 3ZDFA 2NT4A 3DM9B 2VTDA 3EUEA 3PJGA 4S3MA 4U7HA 3UT6A 4YRIA 2VF8A 1AN9A 2V96A 1XZCA 3DCYA 3ESQA 1NY6A 3JALB 4K0RA 5AJHA 2ZXUA 2QM8A 1N34B 2PUJA 1XQXA 1CNMA 1WMDA 2WM3A 4BU0A 4US0R 5EMLA 3E22B 5F5XA 3NWEA 4FD2A 4UBMA 5I7HA 3WRXA 5BPHA 4U6NA 2C57A 4MPDA 4BY9E 1DC8A 2O2ZA 4P54A 5BR4A 4RK7A 2JCVA 1YQGA 3R0JA 3RGGA 3CLTD 1H8EA 5BXQC 1UM8A 5I7EA 1UK7A 3DJYA 4TKUB 2Q8PA 1YR9A 1YOVA 3GJQA 4N39A 4E1BA 3JR3A 4HQFA 3O9MA 3B20A 1OB5A 4DCSA 3KZVA 2P79A 5FFMA 3KJZA 4HRXA 3H8JA 3WO0A 2E2WA 1LPAB 3RWBA 4C3ZA 4D4MA 1HYQA 1ZO8A 2ZJ4A 4J4TA 4OL9A 2ILTA 2VT6A 4QJ5A 1UMCA 3LC7O 2LXNA 1YBHA 2Y9PB 2AOVA 5JVDA 1E9SA 2WVGA 3N0TA 1JTFA 2HIAA 3LGAA 4GVXA 4EA8A 4OF4A 2O50A 3BXFA 3QRWA 3EFOB 4PAMA 4ZQHA 5E4FA 4CLHA 1O87A 4F3KA 1U31A 1L5QA 1YZLA 1V1MA 2RBEA 3OM1A 5SZJA 1SUEA 1U0RA 4DT1A 1U7HA 3QI7A 1YRQA 2AE1A 2QB5A 1NP6A 3IT3A 1Y9DA 1W48A 1X92A 4K3VA 5E4JA 4D9FA 5FEUA 1KMMA 2ATXA 2I9PA 2O8DB 1L5KA 1SG9A 1PDWA 2Q3BA 4MW1A 1IZYA 1SUDA 3CF4G 4GLJA 4BNDA 5CLJA 4IJ6A 2EARA 2H63A 2ZXFA 4RH1A 3UQZA 1UJBA 2RJOA 3AGPA 4O4JF 4TVOA 1Y7IA 3OP4A 4B85A 3MXOA 5FPPA 3JD3A 5F3DA 1G7TA 1FMCA 3R0VA 3NTRA 5EEHA 3JWIA 1NNUA 1ZGGA 5FKJA 4Y7CA 3REGA 4L8LA 2GAAA 2AD1A 2AWNA 1QJCA 4EGFA 1FRNA 4RXUA 2MSCB 2Z2XA 1U2QA 2ENUA 3WGQA 1U7WA 2XB6A 2ZI5A 1A77A 3DE1X 3DBLA 3ZU6A 4G2TA 4D8TA 3AF6A 5AVUA 3U16A 3U4QB 4MAAA 1OWLA 5KC9A 7MDHA 5A7FA 3PXBA 2ODWA 2Z8YM 4HRYA 1FU7A 2PR7A 2R9VA 4UBOA 1A4XA 1VSBA 1AO3A 3LY9A 4OM7A 1NDHA 3SCZA 4YT4A 1W73A 1EWRA 5BYJA 4B09A 3HKCB 4LZAA 4NG4A 3SF0A 4JAVC 1CUUA 3W2HA 3JZAA 1EFDN 1JH8A 1N3YA 3OPQA 4EMUA 1SB9A 2IYSA 2VHQA 5C8VA 4MRVA 3TMKA 1ARZA 1BE1A 1Z5WA 4PG5A 4UNNA 3RS3A 3K1AA 1MEEA 2HWUA 4WHMA 3NIDB 4RPHA 3OJWA 2D0DA 1R1DA 4RDIA 1QR6A 1Q0SA 1AGYA 4PM4A 3JY6A 5JPIA 1T8UA 4HSEA 4IZHA 1WEKA 5DWVA 4GBED 2J46A 2KYRA 3CRRA 1UBRS 2DPMA 5FO1A 1L1QA 1WTCA 2QR3A 4L22A 3ZE9A 3LBYA 5C0OE 4D7AA 2G4CA 1JALA 2VAMA 3SQDA 3ZV4A 1TGYA 5JMTA 5TPWB 3HGMA 1YC5A 3IXMA 1E3SA 1UXHA 1RCTE 3MINB 2PRIA 2A86A 1FOEB 2DVMA 1V3UA 3A6HA 4IH9A 1KS2A 2CWWA 3QBEA 4CR7A 2LV8A 3IVCA 1OFUA 3AZQA 4OATA 3RJ5A 5GADl 3BFVA 1JWLA 3QELA 4E3ZA 3COVA 2EWWA 2P4HX 2B92A 3CLUD 4QU9A 1UL1X 4TXHA 3ZLBA 2UYCA 3M6XA 4TKZA 3HXPA 2MCFA 3R23A 4YCAA 3JAKA 4MCHA 1WV0A 2FH5B 4NMHA 2VG8A 4S0ZA 1RT9A 4E5SA 3PZRA 3JATA 2WKWA 3Q3JB 4DVJA 5JNRA 3PQ4A 2E5LB 2BY4A 1JLMA 1IU9A 2RH8A 1ISPA 5C4GB 2HHHB 3PUYA 1USUA 4JL5A 5KTOA 4CBVA 2A8YA 4FUTA 3L9XA 2E4XA 4WADA 2X5XA 3QOYA 1H4VB 5F5LA 4KE9A 5BVGB 3DMNA 1RR6A 4M87A 1JVNA 1JYFA 1RZRA 4QAJA 3H9JA 1GUBA 2F8LA 3A8TA 2AVDA 1PUJA 4TUYA 2H5JA 1V9LA 1CZHA 1VJCA 3JTEA 4DHEA 3QW2A 2OPBA 4HNVA 4M8NE 4OHUA 3TIGA 1DE0A 2VHWA 5HJEA 2PUDA 5E9WA 1VL8A 3LCMA 1A72A 3SYKA 4HEJA 4FDTA 2VZLA 3KELA 4MYRA 2FEMA 1AMOA 3Q6IA 3CHYA 2UZ1B 2G28A 2Y1KA 1LKZA 3EF1A 3VSEA 4OUDA 3WL6A 5AVJA 3H5LA 2P3LA 4FHZA 2XAAA 3KTDA 1EBFA 5B3KA 2EVWX 3FVTA 5A3QA 4EO4A 3CINA 4J16C 4JGGA 4RWEA 3DBIA 4FCVA 1Q44A 2O2IA 3IEUA 2EXXA 1ZR4A 2GPYA 4Q4HB 1A5AB 1ZOIA 1PLKA 1KP2A 1N5KA 3LUJA 2I67A 3C1AA 1SCIA 2IYOA 4WEOA 1O9GA 2YNMC 2XRFA 1XDZA 1E5XA 1DKQA 4MWBA 4W5HA 3P9PA 2IS2A 1YBFA 1YS2X 2BR5A 1V11A 3KOZA 4L51A 1ORTA 2RHCA 3FGPA 1FTYA 2HK9A 1NXOA 3K0KA 4GW3A 2PAAA 4MA5A 4ZC8A 4AX8A 4B4VA 1TM2A 1UBNA 4DLTA 3KFXA 4X7PA 4XB6B 3KJNA 1PCXA 2C31A 4B9AA 2F59A 3LBNA 3VZSA 4H1TA 1KVRA 4IKOA 4WV3A 4AU1A 1ISRA 4IAOA 2UYGA 3PFBA 3LVFO 1WKCA 3FYUB 1GRQA 3A4TA 4KO3S 4ZVSA 2JI4A 2OCDA 1QVVA 1SUFA 2QTTA 4LXTA 3ZWYA 4BGVA 3PFWO 5AI4A 2WMDA 3OOYA 4RY0A 3RUEA 4QGBA 3ROZA 4AKTA 2I4TA 4BU1A 1NW7A 4ARIA 2Y68A 1Q0RA 1RP7A 2C4KA 3QE2A 4PC7A 1CP2A 3MQ2A 3D6HA 1J4AA 1GPLA 1XZGA 2EYQA 4DC0A 3OIFA 3JQAA 4HN2A 4IYJA 1J90A 1H85A 1SVKA 2X1VA 4XPZA 2XLCA 3C4JA 4KVFA 2HSWA 4TMWA 4C4AA 1PYDA 3AZOA 4G2NA 4DMUB 1PZHA 4V0ME 1A7JA 1BU8A 1ZH4A 3OEED 1Z26A 4JT8A 4M9QA 2CWDA 3P9IA 1K97A 3ZKAA 4X0EA 1LTHR 3SY8A 4LQLA 5FL7D 3DLIA 3KZNA 3BDVA 4CEIB 4OLHA 4TSFA 1SUCA 4Q48A 4Q47A 5JSZB 2PMWB 4G5YA 3JYHA 4FW8A 3BC1A 3D4NA 4PZEA 4WCDA 5FCDA 2P11A 1C9EA 1Y0BA 3OWXA 3VPAA 2ZCUA 4J7AA 1Y6QA 3H16A 3SHOA 2WYUA 3HYRA 3Q7SA 2EDAA 2Z2JA 3EEBA 1ZXXA 3CLSC 2ISCA 3LQKA 3NDRA 4QU8A 4M1MA 2GR7A 3UKOA 2FB9A 5G1NA 2YMPA 4LCEA 3UC5A 1FYDA 4FZJA 2G5TA 3U4CA 1LDYA 1AS3A 1SU6A 2NZWA 3FYUC 4PZ9A 4TQAA 1PTJA 3K15A 5HKAA 4KNVA 1ZEJA 2WKPA 1CHNA 4D3DA 1DARA 2ODBA 3HGTA 1NTRA 4RE6A 3N0RA 3O26A 4EVIA 4CIWA 1ND6A 5JSQA 4OHFA 4LXQA 2DGDA 2WOOA 3GRZA 1FSFA 1AKMA 5KTKA 2BH2A 1LPMA 3ED5A 1A1SA 2JAHA 3EG9A 3OEEA 1X3LA 1DEAA 3ZXXA 1C0PA 1PR5A 4ETIA 1T4CB 4Q21A 1R8YA 2G80A 4G36A 1F0YA 1W5AA 2IF0A 1WCYA 2FPPA 3K0AB 3IUPA 3QXSA 4AF8A 4OHWA 2HNKA 4BIIA 4KLZA 2PRSA 4TLEA 2M1XA 4OQEA 5JWOA 1KKLA 1XCBA 1I24A 4MWEA 4CEJB 5C5DA 4G86A 1H4TA 2X9QA 1KC1A 1I2CA 3BFJA 4OYHA 4JI4B 4L07A 1P0MA 1MOSA 2GYYA 3ZVKA 3Q72A 2QOEA 5SICE 1BHSA 1ZNXA 2WK1A 2VSQA 4LC1A 4ZT2A 5NLLA 1DV1A 3SHVA 3STXA 3W5DA 1NBIA 1UAYA 2IITA 4JBYA 5D5HA 5C7OO 3NT4A 4DUZB 1UOPA 2AJ8A 2AOWA 1YGYA 2HRRA 3ONEA 1NQTA 3EIWA 4GG1A 2I6FA 4L95C 4LC0A 4N1AA 4TKVB 4YAKA 3HYNA 3JZMA 3QHQA 1FS4A 1WMBA 3LX4A 4H59A 3VDNB 2WEKA 2FCRA 4NU6A 2JFBA 1CE8B 1ESEA 3A28A 5FP0A 2QQ0A 3G59A 3UNXA 2AQIA 4TZ6A 1YTUA 1VE9A 3WGJA 3GGSA 3B1KA 1L8OA 4CMIA 1BDHA 4WBNB 3NPMA 3G9TA 1NE2A 3HR8A 5B37A 2HY7A 4YWJA 4HNSA 2X9GA 2J5QA 1OXTA 1TCAA 3FYHA 4Q1DA 4DUGD 1VE1A 1MZPA 3L6BA 4JI5B 2YHIA 2ZI3A 1XKQA 1WL8A 1ESCA 2ZANA 4EENA 1ZA1A 5FBRB 2DG2A 3VH2A 2W42A 2VF2A 3UGJA 2A9RA 2HNBA 3UF0A 2DB3A 3ET5A 1JKJB 3MWGA 5DSTA 4ZAGA 4CKEB 1LRJA 3DZHA 1DJQA 1G21B 2ZXEA 4UQOA 1VE5A 2ZDHA 5DBGA 6REQA 4BMYA 1U8XX 1DQSA 3GGOA 2E4VA 4PR0A 1OTYA 4PHCA 3WO1A 2JIZD 4DZZA 1U7DA 4R6XA 4RA9B 4WACA 3KZKA 4H7KA 1YR3A 2E87A 2EQBA 4J0KA 3H2SA 5AXBA 5HOQA 4L02A 1MB2A 3BXHA 4YP5A 2VUHB 3IA2A 3T1NA 1UODA 4C0AC 4CLDA 4ER0A 2FKNA 2VDOB 2Y4OA 1I1NA 2WU0A 1C7ZA 1NZDA 1PQYA 2NVWA 3E9DA 3NUQA 5TMEA 3SXUB 3T94A 4O2BA 3TUJC 3OTHA 3C14C 2IBSA 5CDGA 5CFLA 1DC3A 2I6QA 3LCCA 3MWJA 3WBFA 4MQFA 4LZLA 4L9SA 4BNDB 1YV9A 4E70A 4OQ4A 4CKZA 4DZTA 1N6RA 4IRXA 1FF9A 4JSTA 3EXFB 3LT4A 1U0GA 4EHBA 3HN6A 2IC5A 2MT9A 3LPMA 4PSAA 4NDAA 2L69A 5H1YA 3O21A 5CBPB 2PT6A 3LF1A 3TLJA 1JQBA 4BX2A 3QE3A 5HX7A 2WHPB 3G8CA 5TGZA 4YRDA 2GK4A 3I61A 2BBTA 1XRRA 2FW1A 3FSRA 1RHQA 3AZPA 2JFPA 3NAGA 3OFND 4AP9A 4BQNA 3WBJA 3RFCA 3NM4A 2KLBA 3DOJA 1XLUA 3AI1A 4TRMA 1YRAA 4Q9IA 2PN1A 4MRNA 4WXMA 3UMSA 3LPNA 4NQRA 1RBYA 1Y3HA 2HXGA 3G0CA 4FE4A 2GJ8A 1QRUA 1MN6A 2O54A 1C4WA 1D09A 3NETA 1H8HA 3EXG2 2O2YA 3OESA 3ENKA 1JUDA 4M99A 2C7PA 1R9GA 1TF2A 2D06A 2PR2A 1YA6A 1L5HB 5D51S 4PYOA 2ZYTX 4HFNA 1XMJA 3PJFA 4BQPA 3WOVA 3KCNA 3HDVA 4GMXA 1F38A 4OQXA 3TR0A 2WTBA 1K06A 2VHXA 2YMQA 4PN3A 3BYZA 4MKIA 2D62A 1LUAA 4KH0A 3IEVA 3VR5H 1HR0B 4O4JB 3SEQA 4DLAA 1XCJA 3CX4A 1PR4A 2FPLA 4LOAA 3TRKA 3UH1A 3NORA 2ZYDA 4GX5A 2HN9A 4OSOA 5DYNA 4AMBA 3WYFA 4UXIA 3HWRA 2JD2A 4CHTA 2ZRPA 4GYJA 4PNEA 3LDUA 3ELDA 1WPRA 4QQRA 5G1PA 1NR7A 5GWXA 2GEUA 3ESZA 3O2QB 3ENVA 4H0NA 2A4MA 2OXCA 2JW5A 4HBZA 3PCXA 3PC4A 5D86A 4D3SA 2PBRA 3T4PA 2WUEA 4JJAA 4MO2A 2UU9B 1FP7A 2Q62A 4C5AA 5EMKA 2C2OA 5ECGC 1K6IA 2B4QA 2B94A 2Q45A 3AR2A 5A4DA 4OHZA 5IJ0A 4CG1A 2X15A 3OJFA 2C92A 4JVLA 4UASA 1ACLA 1M2OB 3ICOA 4NMLA 3SHWA 1MRNA 2C8VA 3CM0A 3PTZA 4ZDWA 2I7DA 4DG9A 1TKAA 3N86A 3DA8A 3KKOA 1RLMA 2X9NA 1CC1S 4P2GA 5EP2A 2LCQA 4F93B 1RXWA 1KEKA 1UDRA 3RKUA 1SOWA 1T3HA 1P9WA 4DTIA 1ZM9A 5JAMA 1ZUIA 1LD3A 3IUBA 5EXCA 1GOTA 1TF7A 5B6PA 3IFSA 1NM5C 5K3FB 2FSIA 5E1MA 5F51A 1K68A 3WZLA 2PS3A 4QUAA 5IT5A 4PAWA 2BGJA 1R0LA 3THWB 3TF5A 1EP9A 2C3MA 1G55A 2AUNA 2A7QA 3SR4A 3UAZA 1UZNA 4YX9A 5AIBA 2GRJA 4BLTA 4QLBA 4CUKA 3HZOA 5BSTA 3W9SA 3PNBA 2YVUA 1CQPA 3QVWA 1KO1A 3AUKA 1F60A 1A69A 3NVAA 3S5JA 4CODB <