3IOCA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.50 ang resolution in complex with 5'-deoxy-5'-(benzyldisulfanyl)-adenosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
273
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 86
structure length 273
sequence length 285
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iocA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iocA01
2JAXA 3ZGZA 3X1MA 4WSOA 4NZPA 1KR2A 1VBKA 1TYBE 1TYCA 1NP7A 1O6BA 3HV0A 3CLUC 4EG8A 1KQPA 3OP1A 4EG6A 3DO8A 1O97C 1U7DA 3DPIA 4NAHA 2A1UB 2A1UA 3A05A 2PFSA 4NDAA 1M8GA 4MUHA 1Q15A 4G6ZA 4U63A 3CA8A 1O0BA 1KP3A 2YWCA 4ND7A 4QBTA 1VBMA 3A04A 3N9IA 2WQ6A 2CV0A 3IDFA 2AKEA 4HJRA 2PZAA 3KT6A 2OQ2A 1J1UA 1PFYA 1N75A 3IMEA 2V0GA 3P0HA 2IELA 1U7XA 5BNZA 3IMCA 3C8ZA 4ZCPA 2PXHA 4UZFA 3ND5A 4Q16A 2J5BA 2X3FA 3N05A 2H2AA 1WY5A 2DERA 1J20A 3UY4A 1G8HA 1YIAA 2A84A 5J5AA 3SP1A 1JEDA 1JILA 3IVXA 1O95C 3DV2A 3L92A 2A86A 1M1ZA 4MW0A 4YP7A 1NYLA 3RJZA 3U1VA 4RPIA 2DETA 3LE8A 3HMQA 3ILVA 2BYTA 4OJMX 1FYDA 1EFVA 1R6XA 4I6GA 1EXDA 2Z3VA 2D5BA 4JZYA 1IRXA 3KT3A 4TS1A 5LM3A 1M8KA 4Q93A 4ZT4A 3RK1A 1GTRA 3CLSD 1NURA 4EG7A 1JHDA 1MAWA 4MQ6A 3CLTD 3GMIA 5FO0A 3QTTA 3FIUA 4ZT6A 1H3EA 4F4HA 5TEWA 2R5WA 3H9CA 1UFVA 3LCJA 4KKVA 1H3NA 1KH2A 1WXGA 1WXHA 3S3TA 1T6ZA 4KPUB 3KT0A 1OWNA 3CVYA 1K4KA 4UZEA 1N78A 4OUDA 3FY4A 1MB9A 2DUMA 3IVCA 3H9BA 4H3SA 1KAMA 1KKUA 1TYAE 4K03A 2A4MA 2IJGX 1I6LA 1QJCA 2HMAA 1R6UA 4EG3A 1YUNA 1NI5A 2VTBA 5TGTA 4HPWA 1K4MA 2QJTA 1QU3A 4MULA 5KHAA 4MW7A 1JIJA 1YI8A 1YULA 3AFHA 3AL0C 3COZA 4EGAA 4A91A 3N8HA 4RUKA 2C5SA 1N2EA 3ND7A 1G8FA 3A4IA 5FO1A 4JFAA 3HFJA 1QTQA 2DEUA 4U8HA 4DNXA 3CVXA 1IHOA 2GM3A 4R2LA 1IQ0A 3QE4A 1IQUA 1J21A 1MBZA 3RK0A 2I1LA 3FOCA 2QJFA 2WQ7A 3Q12A 3FHJA 4YBRA 1IFXA 1WQ4A 1PFVA 3PNVA 4PBTA 1NUSA 3K32A 1MC1A 3RFFA 2D13A 3Q4GA 4ARIA 4PBRA 1ILEA 1F9AA 1KH3A 1X8XA 1QRUA 1N1DA 2JA2A 5DEOA 3D6UA 1WZ2A 4DDKA 5LFAA 4MWCA 3MUEA 1KQNA 4QRDA 4CDNA 1T6XA 1A8HA 4ZT7A 2J08A 3L93A 1QU2A 3I05A 2DLCX 1KAQA 3IUBA 4DLPA 4BWVA 1TYDE 2EL7A 1F7VA 3IMGA 1LI5A 4MVWA 5J59A 4DDMA 1N3LA 2YY5A 3F3MA 1F7UA 3FWKA 3ISJA 4MW9A 3CLSC 4ND6A 3ZIUA 4MWDA 4J76A 1COZA 4S1OA 1N2GA 1J70A 5HUHA 4GRIA 3COWA 1EE1A 2E0IA 3SEZA 3UMVA 1T9GS 1JMVA 2IP1A 2Z09A 4ZCSA 4YP6A 4CDMA 3CVUA 4AS1A 4AQ7A 1OWPA 2ZUEA 3G59A 1EUYA 1OWMA 4MUFA 1ULHA 5LLTA 3IOEA 4HJXA 1MJHA 2PG3A 3GUZA 3P0JA 1U3DA 3SZGA 4NATA 2X0KA 4L2IA 1OBCA 3IOCA 1CT9A 4MWEA 3MLBA 3AKZA 4X0EA 5TEVA 2O5RA 4JYZA 1JZQA 2HZ7A 3H05A 3IUEA 2DPLA 1NZJA 5K0SA 1QRSA 4XFJA 1NUUA 1JZSA 3ZUGA 1QNFA 3QTBA 1O94D 5KWVA 3G5AA 1GZUA 3FNRA 3FI0A 1ZH0A 4JXZA 4MW1A 1ZJWA 3CLRD 3NBKA 1VBNA 5HUJA 1JECA 4MUGA 1M83A 3NBAA 4EF6A 2NZ2A 3DLAA 1M8PA 2OV4A 4WNYA 4R0NA 3TZEA 1WQ3A 1HYBA 5KCMA 5H7XA 3MMXA 1PG2A 3N2YA 2X1LA 1MAUA 1F4LA 2EJCA 1EJ2A 1O5TA 3K9WA 1YUMA 2ZUFA 4ZCRA 5EKDA 1DNPA 1JIIA 1PG0A 3CLTC 5DASA 3M5WA 1N2BA 4OUDB 4ZT5A 2A88A 2QJOA 2QUJA 3UOWA 2YWBA 1XJQA 2CYBA 2DXIA 2CFOA 3RBAA 1WXIA 4MVCA 1OWOA 1G59A 1EFPB 1IQRA 1I2DA 2NSYA 1K97A 5HG0A 3ND6A 2B7LA 3JXEA 2X1MA 2PZ8A 3H99A 4MVYA 4CQNA 4MUJA 3X1KA 1H3FA 3CVVA 4ZCTA 4DJAA 1J1ZA 1O95D 1O97D 3AIIA 4DDHA 1X6VA 1N77A 4YP5A 4EG5A 1T9GR 2QTMA 1XNJA 1I6KA 1U0BB 4EG4A 3CLUD 5AHWA 3ZJUA 3VU8A 1Q19A 2A1TR 3BL5A 3UK2A 1RQGA 3HL4A 1GAXA 2VTBB 1WXFA 3KT8A 2J09A 4EG1A 1KORA 4XSVA 1V47A 4E1AA 3OTWA 2QTNA 1LW7A 1Y42X 4P2BA 3AG5A 4NX2A 1OBHA 1BS2A 2A1TS 3P52A 2RD2A 2AG6A 1GPMA 2GKSA 1M8JA 4CT0A 2CUZA 3PRHA 1NUPA 4J75A 2QUKA 1OWLA 1TFUA 3FH0A 2WSIA 1WKBA 4KR6A 5DK4A 2A7XA 2WB2A 1FFYA 4KPUA 1N2HA 1D2RA 1U3CA 1IVSA 1PFUA 2E21A 4GU5A 2ZP1A 2D54A 5JBNA 4NAUA 1EFVB 1WXEA 3PXUA 1GTSA 3IODA 3NV7A 2VXOA 3TQIA 3VGJA 3ZXSA 4MW5A 4PBSA 4MW2A 1MRZA 2YXNA 5IJXA 1NUTA 3CR8A 5TS2A 1IH8A 1XNHA 4K0RA 1GN8A 1SURA 3SYTA 4U7JA 4KR7A 4JXXA 2G36A 1MOPA 2PZBA 1OD6A 1N2IA 4I6JA 1O0CA 1ZUNA 3VRHA 4MAFA 1V8FA 1K92A 2J07A 4MUKA 1S4MA 1H1TA 2QUHA 1O96B 2E89A 3SZ3A 1EUQA 1Q77A 4MUNA 2QTRA 1TQ8A 2RE8A 3MXTA 1LI7A 2CYAA 3ZJTA 3H97A 4HK4A 2XRZA 3PNYA 1QQTA 3UC5A 1MB2A 1B6TA 3IVGA 1VLHA 2J4DA 3HGMA 5K0TA 4MVXA 4I6EA 4ZCQA 1KH1A 2CYCA 4L2IB 1JEEA 1WJGA 4MUIA 3ELBA 4MW4A 3X1JA 5IHXA 2TS1A 4PY2A 1JGTA 1WOYA 3RHSA 5DB4A 1N2OA 2H29A 2QUIA 1JIKA 1XNGA 1O94C 2PIDA 1T6YA 2O8VA 5F23A 4F3RA 4G5YA 1I6MA 2DR2A 1NSYA 1QRTA 3COYA 4EFKA 3CLRC 1O96A 2AZXA 3FETA 3IH5A 2V0CA 3SEQA 3G6KA 3GLVA 3HZRA 3ZXIA 1GLNA 3P0IA 4MWBA 1J09A 3FDXA 1EFPA 1M8FA 2CV1A 4ZT3A 1NUQA 2BTEA 4ARCA 2GOYA 3TS1A 3TNJA 5FNZA 3CVWA 4MUEA 2CT8A 2XRYA 2Z08A 3TQOA 3KFLA 4QREA 4FZJA 1G8GA 3LOQA 4XFDA 1TEZA 3E27A 3PNBA 1KQOA 1VL2A 2CV2A 3Q10A 4MLPA 3FG9A 5H16A 3SDBA 3INNA 3ZJVA 1R6TA 4YMIA 1KP2A 4R2MA 4KR9A 4G5FA 1N2JA 4DE5A 1P7PA 1PFWA 2HGZA 3AG6A 3COVA 3MLAA 2CSXA 2E18A 2JANA 1ZH6A 3D6VA 5J58A 1Q11A 4ZT2A 3A2KA 4MW6A 1YIDA 3TZLA 3IOBA
chains in the Genus database with same CATH superfamily
2C61A 3DV0B 1PL7A 1U7WA 2VPXA 4MI1A 3BFXA 2O5VA 2FZ4A 2N1BA 2X6RA 5DTMA 3PJGA 2E1PA 2AXQA 4NZPA 1VBKA 3CUKA 3HWWA 5EE0A 3U9SA 1XEXA 2MHCA 4LNAA 5IDYA 4EUHA 1SCIA 2JGJA 2YL2A 1UK6A 3E5HA 5KNDA 3BE4A 5ALLA 2F4VB 1UANA 5KEIA 1ML4A 6CHYA 4UCXA 3O8OB 4FDVA 2FUG6 1RMQA 1RKQA 3R09A 2X6TA 3G7SA 1VSQA 2R9VA 3CA8A 3HCRA 3R2JA 2EQ5A 2Z8ZA 2G4VA 4N65A 1E2LA 1B8OA 2I5PO 1IJEA 1UC4B 2R6ZA 1L7RA 1MO2A 3GLFB 5ALSA 2ZQZA 2JJYA 4Y2HA 2JLYA 2AKEA 1IJFA 2BM0A 4BBAA 4FHEA 4BMOB 5F78A 2HDNB 5ICEA 1QDLB 1SG9A 4AY5A 1JQAA 3NJRA 2Z2IA 3HYNA 3FJYA 4HAXA 6PFKA 2DHRA 5FAKA 4D4KA 1IC6A 4MRVA 2PTGA 3AINA 5FRDA 3ZDCA 1Z6XA 1FUYB 3F7OA 2P6NA 4ZRDA 1JA1A 1QC5A 1B8UA 1BX3A 1C30A 1YU6A 2XVXA 1N34B 4ZV9A 4BTVA 4QEDA 1CY0A 4CN9A 4HB3A 4C01A 2MR6A 4LY0A 5FADA 1MP0A 3BD9A 4LYAA 5AM0A 1T0PA 5FI0B 3SJUA 2Z9DA 5J5AA 4HWGA 2PA0A 5DCWA 3D59A 2GKOA 3FZYA 5IWAB 2HZBA 2A9QA 4TXNA 4KE6A 4K9NA 1OBFO 3D8NA 4FYYA 1AKNA 1T5IA 1L4GA 2VPQA 1NOKA 1J0EA 3HMQA 2BYTA 2JKVA 2IE0A 3BMOB 1DQNA 4I6GA 4M1OA 4V0KA 3SKVA 2XH8A 2JIOA 5JNSA 1DEXA 5K8IA 1S2DA 5AT1A 4A23A 2ENUA 4RHEA 1N6PA 2WG1A 3MOGA 4N49A 3R74A 3Q88A 3A7DA 1E1RA 2O1SA 3IFSA 4RDIA 3O9MA 4R1LA 3SXUA 4LV6A 4PXAA 4HCJA 1R4MA 4BZQA 2EKDA 4BE9A 1NLFA 2QTWB 5JCPA 4NBTA 2KB0A 1CUFA 1PD1A 3OFSA 2GF9A 5AVVA 4MCJA 5KJFA 1YS9A 2VYNA 1NM5C 4WT7A 4Y1EA 3UWMA 3C6MA 2BIFA 2P4HX 1II8A 2XI4A 2NXJA 3CT6A 3A9RA 5KNCD 5KOHB 3CVYA 4OUDA 1JAXA 5ICFA 4NBUA 5EP1A 4YJKA 4JOCA 2VYVD 3ZLJA 4F45A 2D62A 3ODGA 4DCTA 3N3BC 1OTYA 1E20A 2B20A 4GYWA 2GXUA 3B7PA 5DWDA 2NO4A 2FPUA 1EJ6A 4DPLA 2FK7A 1Z8DA 1XYYA 1BMTA 1B14A 1YVUA 3PNQA 2AVNA 3J80A 1WZEA 2LNDA 3FPSA 3HUEA 4FDLA 1P5FA 4HPXB 4BZPA 1RW4A 3GRCA 2KBEA 3O84A 5EJMA 5CEEA 1YULA 3BICA 4B6GA 4N5LA 4GX0A 2NO7A 3DFFA 5T3UA 1WMDA 5IXYA 5LQDA 1P29A 1J56A 4A91A 4J7UA 2HEGA 2RGXA 3HA2A 4F1KA 4AW9A 1U65A 2PGIA 2H2FA 2FV8A 3EY9A 3GXOA 2UYHA 3GLHE 3LU1A 2BM9A 1QTQA 1KAEA 3P7MA 5FOQA 5AI6A 3ASUA 1FU7A 3NONA 1SPXA 3SR0A 5DLEA 2ZTVA 3U17A 4QFCA 2OM6A 4MKZA 3IP9A 4FT2A 2A0UA 3UAOA 1BOFA 5IM4F 2WFLA 1C2YA 2LW7A 4JT9A 5IJAA 1E92A 3FOCA 3OZUA 4KWEA 4LA4A 1O5IA 2ORWA 2C7PA 4Z2AA 1ADJA 3P2EA 3OM9A 3B3GA 3IEMA 1X0VA 2PBLA 1WSWA 4MP8A 2JGDB 2H1HA 5AXCA 2D13A 4CLOA 3L8DA 2BGRA 5KYUB 1WB6A 4V1CA 4LX8A 5EMKA 3VO2A 1UEXC 1VHDA 1CQJB 2JA2A 1QCZA 3OP4A 4ITRC 3CR7A 4MJ3A 5CXXA 5F2OA 1KPGA 1RM0A 3DUFA 3IULA 3M49A 4DLVA 4B32A 2WOJA 2CFRA 4FLEA 1H2ZA 1KDRA 1IVNA 4BUCA 4RF4A 2H08A 2VBIA 1NMSA 2YYZA 4I5IA 4KREA 3AM4A 3U16A 2IYSA 1QHNA 4LRWA 4QPDA 4RVCA 5I01A 4LHVA 3F3KA 3FMPB 2H1RA 3ICPA 1C7EA 2CMKA 3OJCA 3RREA 3DXXA 2BP7B 4HQRA 4N0QA 5E2AA 3TBFA 1RDFA 1UQUA 2YY5A 1NM5A 2ZSIA 4X20A 1A1VA 1L4BA 1F7UA 3HA7A 3LDGA 3OD1A 4B09A 2H1VA 1ZRMA 4KFRA 3WK5A 4HL6A 1P6QA 2BF7A 4ZI2A 5T7BA 2KLBA 4GM1A 5IF3A 4N76A 4FGJA 5BW4A 2ILVA 2YJNA 1B43A 1PVVA 2VUTA 1RPZA 1PGPA 4E88A 3JQCA 3BB3A 5CITA 2XMGA 4M0LA 3LUGA 5KX5F 4LJSA 5T57A 1SUPA 4NJOA 1KHTA 1L8XA 4Y2YA 3T1OA 2C96A 5H82A 4TX1A 1UC8A 4FD3A 2J5XA 4BCCA 2YX1A 2AD1A 3N2GA 1E59A 2IUYA 3TLJA 2HQOA 4P4SA 1P9WA 1R9MA 4P4SB 3UMRA 2RBGA 4IUBS 2VHYA 3D5EA 2ZUCA 3MCAA 3WAJA 1D2AA 1X80B 4FFWA 4J4TA 2P3QA 1IQPA 2CFIA 3FCYA 3IQDB 4M4SA 4J1TC 4X24A 3WGLA 4F06A 2H6EA 1F8FA 1CZKA 3WNQA 4FFBB 3TJRA 4OI0A 3HWSA 4G89A 3TKAA 2A5JA 3WB9A 4TRJA 3ZQ6A 3HG7A 5COAA 3C24A 3FSEA 2FG5A 4EEKA 3T4PA 3NMUF 1WLSA 2HZ7A 3WGMA 3CLHA 1NZJA 1N9GA 1PJ3A 1J07A 4YCAA 5EJFA 4JYPA 3BWCA 1NUUA 3OT5A 1JZSA 1X1QA 5JWHA 5U4QA 4JLNA 4YN3A 3BHNA 5BSVA 1J9ZA 5FBZA 3VJMA 4GLFA 3KAPA 2P5UA 5AXAA 1D2MA 3ROFA 4JJ8A 4PSAA 2EDCA 3JALA 1V37A 3CPEA 4LJ8A 2CWDA 5THQA 1GT6A 3S8MA 5IAOA 1FP6A 1W93A 5GOTA 4RPLA 1UJ6A 2E49A 1EK5A 5KQSA 2ZSAA 1X19A 1XMJA 1UFOA 4HNAB 1A7UA 2XYQA 4QFDA 1MT3A 4J1NA 4EJFA 4Y30A 5F64A 5BQPA 4B85A 4F60A 4KR2A 3EZGA 4AZTA 1EM8A 5AVTA 1JFRA 5LN1A 2OUKA 3M5PA 3OT4A 4CM7A 3PQ4A 2X14A 2ZYHA 2BJWA 1PG0A 5DHFA 1PNQA 4N8DA 4EKYA 3ZCPA 1Y1QA 2QN1A 4IYRA 4YMSA 4KXVA 2B9EA 3AF4A 2O6LA 2G6TA 3PNKA 4ARAA 2F8MA 3JAKB 3DXFA 3LC2O 1R6AA 3LZCA 3CFIA 1N1MA 4HDRA 3T7DA 4B7ZA 3CO0S 2QTZA 2QXUA 3CISA 4PF1A 2SKEA 3KL2A 5HPYB 2LKCA 1FSSA 5B3KA 2LD4A 2V8BA 2OCIA 2ZWIA 3CVJA 2WF9A 1XTVA 4F56A 4M98A 3ZCTA 4TOIA 3A25A 3JTEA 4YRAA 1VG9B 3CTMA 1N8SA 3PP8A 4URWR 4Z9XA 3UB3A 1NJ5A 2OCBA 1YKSA 1ZCFA 3FTQA 3O5AA 3KWLA 1OA0A 2X9NA 3C85A 3R7WB 3S29A 3TQRA 3WMGA 1AA9A 1T0BA 2ZJ3A 1L7NA 4KFSA 4G1VA 1X7WB 4LRXA 4NU6A 5HF6A 4YRLA 4C0HA 2F1RA 2ZRAA 1MVLA 3QUSA 5FR1A 4DCMA 3DOFA 1NW7A 2GO1A 1J8MF 2FPXA 1ZUHA 2GA8A 1XZJA 2GAJA 1CYDA 3KAQA 4G5QA 4KMMA 4FOSA 2DKNA 2ZUWA 1H9BA 3F7MA 5KVCA 2A2ZA 2HHAA 2FDRA 3V1UA 2XEXA 1YQQA 2L0XA 5HGJA 1VB5A 1E6CA 1TADA 2RHLA 3BA1A 3IAHA 4WPGA 3ZBQA 1OFTA 3TI7A 4WMLA 2BLNA 1L5YA 5L4NA 3CR3C 3DVSX 1BHSA 5L53A 4ROSA 1JYEA 2XA9A 4EKEA 3ZKWA 5I7EA 4BFTA 2IY8A 4RKRA 2Z2ZA 4LVCA 2R8BA 1TAGA 1GXSB 1T8YA 2PMEA 2PZGA 4JELA 3W2TA 4B43A 3X1XA 2IYFA 2J9FB 2Z8XA 1OU4A 4J0GA 2PUHA 2OVFA 4XQEA 4UHDA 1SHTX 2HJSA 3KPYA 5GAJA 5DGIA 5HTOA 2RHWA 3OX1A 4J1QA 4FGSA 2C0QA 3IX7A 3C6YA 1YNOA 4E14A 2WSLA 4ZHQB 4ZMSA 2QM8A 5AJVB 1L5SA 3BG5A 2IEGA 4DM3A 1DKRA 1DWUA 1VPVA 2CXRA 3KYCB 5D7BA 5MN5A 3GEBA 1YZ3A 4YRJA 3LC0A 3EOAI 3C48A 1VIVA 3PA6A 3UJBA 2VNSA 2VWHA 5JFOA 3O4FA 3PTAA 4B44A 3IA2A 4DLNA 4UFOA 4D3XA 3URKA 1OKKD 3EIQA 2BDTA 2DLDA 2PEYA 3LNTA 4HAOA 3BSYA 2KLHA 3PL1A 5LVAA 1GQFA 4LXQA 1MJGA 2QG9A 2LIPA 4Q3BA 4OFWA 1FSFA 5A0FA 1B26A 2JBHA 3AR9A 1L8QA 2X8JA 3WQRA 4DANA 3TQIA 3JQ8B 4CHTA 2J9RA 1TW2A 3HCWA 2C9OA 3QELA 4R41A 1DWPA 3UCXA 1J25A 4Z49A 4R05A 1NUTA 1UXIA 4MLDA 2O2IA 3T3DA 4J0FA 1EKXA 1QAQA 1GPWB 2XD9A 4M83A 2ORED 1UFQA 4MRMA 4X3OA 3V9PA 1NONA 2VP5A 2PZBA 4M89A 4QBKA 2CLCX 2BFOA 5DM2A 4YPVA 5LP6C 1BWPA 1IBKB 3FBWA 4DCOA 2FA9A 4LJLA 3EIOA 4LFCB 3WG9A 4AO8A 2L2QA 2R2GA 3BH6A 3UGKA 3C3YA 3HDGA 2H3EA 4OGWA 4ASUA 3JQPA 1V26A 2DQZA 3GT4A 4AJHA 1E98A 1VGRA 1FRNA 2QL5A 3O3NB 4UMFA 4HAWA 2HU2A 5JNVA 3M70A 3IDSA 3D5QA 2YZKA 3A1EA 3FNIA 3QF4B 4OB7A 4P31A 1TQ8A 1I5EA 4BMNA 4UAJA 1K7CA 3MXTA 3QYPA 4YXWD 3G5TA 2PUCA 3H42B 4JR0A 1IWBB 1MPXA 3I73A 4G26A 2JFXA 5DE3A 2QZZA 5JVDF 4CL3A 1M2OB 2VZ8A 4G07A 4QUIA 1U0SY 5TARA 1CZUA 2XDAA 3VSDA 1U5AA 3GJ7A 2ZJYA 1RKVA 2O8CA 4OI2A 1JL3A 3DA8A 1OX5A 3GZTB 3HJGA 2C7GA 2J4DA 3KJHA 3IT3A 4LQ4A 4MVXA 3V8BA 5C80A 4N48A 4R9SA 3L6EA 5K8VA 5FYQA 4C7KA 2YINC 3V8NA 4I1UA 1W0JA 2YY7A 1EUDA 5F1OA 1G9TA 1YVRA 1FFCA 3CM0A 2PLRA 3DCYA 4G97A 1RCTE 2I6FA 2R7AA 3FN4A 4ZHQF 4HWRA 4NABA 2N75A 1I10A 5JY6A 1W85A 2ONKA 1GA6A 1ENOA 4CEHA 1GQ2A 4BEBA 1TO1E 5A03A 4Z51A 1T6YA 3QU4A 4UXIA 3JRWA 3STVA 1NSYA 3EDYA 1NATA 2JZNA 1SA0B 3VJKA 2HIAA 5IAGA 4RS3A 2CXXA 1TD9A 4IV0A 3RABA 1T6BY 3OIDA 1RI2A 1W19A 3RVSA 1TCBA 3DMGA 3F9RA 4MV5A 5EY5B 4ZK6A 2VUIB 4MVJE 1CS0A 4BDSA 3P0IA 3UKDA 2JFWA 3GUVA 2GK7A 4OLBA 3DQPA 4KGDA 2PL9A 2O9JA 3ORFA 3PXDA 1C7ZA 2MSNA 4MPPA 4OQMA 2GNOA 2IZOA 1RRVA 3PJDA 4IIJF 4OTZA 2J7KA 2NZWA 4OM7A 2E48A 2VQ3A 4H31A 1XYGA 2Z9BA 1VGQA 4LYHA 2IYRA 1PZGA 1CZHA 4TWIA 5HZHA 4QPPA 3MYYA 1EESA 1VKRA 2W37A 4B4DA 3NW9A 2EYQA 4G5FA 3C5CA 1Z3CA 2J0VA 3ZYZA 3RSSA 1SU8A 3T94A 2PTHA 4ILEA 3EXHA 5FBVB 1POWA 1FU4A 1VIYA 1HORA 3EN0A 2XMDA 4OSEA 4ZT2A 1Z5UA 3UJPA 1F38A 1E99A 1EAYA 1MMFB 3HWRA 3PSHA 3RUEA 3U26A 1V9SA 1JG3A 4B87A 1PV4A 2YIVX 3BBPA 3NOQA 3DO6A 3IEXA 4LIPD 4NFYA 4GH5A 2I4IA 1PR9A 1YAHA 1Z4JA 2X5KO 4UHCA 5KWSA 4REOA 4Z9AA 4OAPA 1W88B 4CQMB 3U7RA 4XRGA 1QIFA 1DBIA 4BFLA 5HQTA 1IXRC 3Q7RA 5B53A 2RGWA 2XTAA 3C4VA 4DYHA 2FN3A 3AB7A 2FQ1A 2ZIZA 3MSXA 1PVDA 2DVMA 3ENKA 4UU0A 5FPYA 5HFNA 3UN1A 5H9WA 3U49A 1RQPA 1FW8A 5DX0A 1JE1A 5BV8A 1RWBA 3WMXA 4BN0A 3AY7A 3DAPA 1AUQA 1PJBA 1SCUB 3AX6A 2CVOA 2IXBA 3G0DA 4JGGA 5AH0A 4KX3A 3TM4A 5BOVA 5IZ4A 1FSPA 1Y3BE 1I3KA 1U8FO 2PZAA 4FX2A 4HJRA 3ZGYA 4B4UA 3IMEA 1PLJA 1FTGA 3DC2A 5DNEA 4H3VA 5BW8A 4RVUA 5IC4A 4AY6A 2IU6A 1GGNA 1WBDA 1WCYA 1U1DA 5IT5A 4CTOA 4EX7A 2M6SA 4FIDA 1YCGA 4Q16A 3CUYA 2E87A 3VNBA 1T5LA 2Z2KA 3HB4X 4I9HA 1M1XB 3RUDA 1V6SA 3L0YA 1GYPA 5LQRA 1WBJB 4LRSB 5AVZA 4KK3A 2JHCA 3V6LA 3ZQJA 5AJZA 1GSIA 3VOBA 2A84A 2MT9A 3MA0A 2C3UA 3K20A 1UDAA 4RLQA 4V39A 5ECDA 4I5GA 1TU3A 1AN9A 1VLMA 4ZALA 1LH0A 5BNFA 4CI0B 3LPAA 2GAFA 5LYYA 3TE7A 3DF9A 4RH1A 1X9IA 2AJTA 2CXSA 1A1SA 4AF7A 3PUKA 3T5GA 1HLFA 3NWEA 2DCUA 2PX3A 5B1YA 4GE0A 1NVBA 4NPCA 1ISPA 4W5TA 2DPYA 1LU9A 2CVZA 5J1SB 1M2HA 1RBQA 2EW2A 3VTKA 1E9RA 4Y1FA 1CD5A 2P69A 2Q4EA 5BQ3A 1UT6A 4AQYB 1ZA1A 4HX5A 4KDFA 3UMSA 1G0NA 3WQSB 1XTJA 1P0MA 4NK4A 3SJAA 2FN4A 3NC1C 4UULA 2X9GA 3CMMA 5IP5A 2O8FA 1GRRA 3IJEB 1GFSA 3O3CA 4DG5A 1DIHA 1OLSA 1YFZA 3SJ7A 2O52A 1WF6A 1Z4LA 3LUCA 3UC9A 2P9YA 3WLHA 1UIRA 2R5WA 1EX1A 1DIAA 3NOVA 3T95A 3UJAA 1PAUA 1YZQA 1GKYA 2ZR7A 3GRYA 3R7WA 5KTRA 2RC6A 5B3JC 1BTOA 1OWNA 3RC7A 2XKKA 2PGJA 3N58A 1ZK3A 1MPTA 4ZO6A 2FZGA 1Q0RA 2HO5A 4I1IA 4Q4JB 2ZBPA 1A9XA 5TF0A 1PHPA 1WUIS 2WVJA 4KNVA 3IUNA 5TRTA 1HDXA 4EHDA 4MS3B 4BX3A 4EG3A 3CH7A 1C14A 3FFTA 3FGOA 2XJ9A 4GF5A 5CRIA 2FX2A 3OJFA 5HYVA 4AKIA 1P8AA 3GN2A 3NBQA 4ZXPA 5CCEA 5TIIA 1E4EA 1JIJA 3L8GA 4RACA 2BUCA 3H0KA 1H1LA 3HYRA 5G41A 4MVJM 1E1NA 1E9FA 1JI0A 2CNWD 2ZBGA 1X7HA 4LXXA 1J0AA 4D42A 1BMFA 1CBUA 2C2WA 1UMCB 4DEXA 3F7NA 4PM4A 1QHHB 1TYZA 3ADCA 3AERB 2I2BA 3AERA 2FZKA 4FQ5A 4OKIA 2ZTHA 3ND7A 1VRWA 3L6DA 5EE1A 3BJZA 1G21E 1A9ZA 2GEVA 4MROA 4QKQA 5DTJA 3I01A 4CFSA 2F90A 1QOZA 4LRUA 5EN4A 4HDCA 4G0YA 2P9BA 4OK5A 2ISQA 3JWHA 1UMBA 4IVQA 1UJMA 4WDRA 1R0BA 1KYXA 2P6OA 3NB0A 3UB2A 5MF6A 1FUIA 4IVRA 4EB6A 5K3BA 3AW8A 3Q6IA 2QPOA 1RLOA 2ZSEA 3KZMA 3LUDA 3STYA 3TCXB 4YA6A 3K1TA 1BMQA 3D6FA 3W5IA 3ET4A 3ZHTA 4PONA 4C0KA 5IUKC 4R68A 3V7FA 1LPBB 3BKXA 1F9AA 2ZRDA 3MCZA 4RSHA 2BGKA 4INZA 3LYAA 4EHIA 4F8EA 4O4IB 5KYXB 4DV0B 2I9PA 3KIPA 4QRDA 1RQNA 2FZWA 5FTNA 1AKUA 4MQFA 5B1HA 3TSYA 3U7IA 3DJYA 4BNMA 3DE0X 2JHPA 1XCGB 3I6IA 1L4MA 5KYGA 3EGEA 2YTZA 5LOVA 1XZPA 3BJEA 2I99A 2LTAA 1TYDE 3IVRA 3R23A 1JR2A 1SUIA 4B7CA 5FD8A 1GR0A 2ODAA 3I4FA 4BEWA 5JQGB 2ZE5A 4JWTA 1IPFA 3W79A 1YRQA 3I04A 4O33A 5EIAA 5HCUA 2A9RA 2A9OA 2NXEA 3NVMB 3RI3A 3HKCB 1ISMA 2B4KA 3KTDA 1RXUA 3SS7X 3N07A 3I34X 1VL1A 3A4YA 2MSCB 3BH7A 4ZZ0A 5FBHA 4Z3DA 1IXYA 1NVWQ 3QVWA 4DZTA 3I1FA 5A4IS 4TTAA 3KVOA 4BNNA 4ZOEA 1XSEA 1HTBA 2BSXA 3KPJA 1U5CA 4IYJA 4D2IA 1P0PA 4RK4A 1N2GA 2C5HA 4LTDA 3I83A 3LRPA 3R40A 1NV9A 1WLYA 3L1KA 1P5ZB 1CEXA 1SG6A 1HNWB 1NNI1 1NR5A 3OIGA 4IZHA 4LF7B 1F1JA 3CNLA 4CF6A 2B37A 2YV4A 1AUPA 1NP6A 2H0AA 2IP1A 5LQSA 3HKBA 4DOMA 1I8TA 1R64A 2AMFA 1D6SA 2PRYA 1P2UA 2RFLA 1A5BB 3E84A 3NT5A 1DDIA 1H4SA 1BA3A 3BXHA 2PJZA 4O02B 4V38A 1JEYA 3VM6A 3AQ4A 3IHWA 5I7AA 2ONYA 3QKWA 2HAEA 1V71A 2OVBA 3QA9A 2Y67A 2G07A 1N7HA 4WV3A 1K0FA 3OZCA 1NQOA 2ICAA 3GUZA 3IGFA 2P78A 2WYWA 1DX4A 3EFOB 3IAUA 4U7HA 4XWTA 2V7WA 5JV5A 4V0MA 3QEMA 5DNDA 1F20A 3KKQA 3EUAA 3NT2A 3PICA 1W59A 1Z39A 4IDEA 2EQBA 3V7NA 2P8JA 4DV7B 4Z0NA 2ALJA 4MLCA 4YRKA 1SD2A 4MYRA 4QU5A 1O4VA 2IIVA 1E3IA 2X6QA 4KQIA 2VDNB 4MA4A 3GH3A 3DTVB 3THWB 2G7ZA 3LPNA 2D0IA 5FA6A 4HVCA 4I8XA 3O92A 1MFZA 1ONBA 1SA0A 2ZXFA 3M4ZA 3HFGA 4US1R 1O94D 1P0CA 1GAWA 4CEJB 4FGUA 1J8VA 4HQFA 4BLTA 4E33A 3K31A 8ATCA 1J6UA 3K2BA 3UFBA 3HUFA 4D9IA 2OXCA 1JR4A 5IG2A 4N8EA 1VMIA 2JZCA 4CFYA 2EW8A 4KQ2A 1G4HA 1G8MA 1WUYA 2KW5A 4RA9B 4ZQFA 2D00A 1KYIA 3UJ7A 5HS6A 2J3JA 2WSSD 4JJGA 3EC7A 1QX3A 2CCJA 4I4NA 3TIGA 4MO2A 4N12A 4MPJA 3S2EA 3VX3A 3IEVA 4RWEA 1HK7A 1WCIA 1PG2A 2JFZA 1HL7A 3LLMA 5BR7A 1I7QB 3KB1A 4B3JA 1ENPA 4KKXB 1AKMA 1NE7A 3PVZA 5F3WB 4DIBA 3UJ8A 4YT8A 1U5BB 1JS1X 2AXNA 3B3JA 2HPZA 3DS8A 4XIIA 1T3LA 1L8LA 4M9ZA 5FYDA 3EODA 1FFGA 2BDEA 2CFOA 4Q6WA 4TMTA 2VA8A 3ES9A 2BGGA 3FGPA 1XK6A 1L6RA 1RC1A 2HIMA 2GETA 3H65A 4IDBA 2HBRA 4YXWA 3ZW7A 1ZR2A 3ZNQA 2UXBB 3NIBA 4MICA 3UQZA 1YZGA 3EJ6A 2IHBA 2O1WA 2FGJA 4HFJA 4JU9A 4YEDA 4DJ5X 1PR4A 2A0YA 4C4YA 1IL0A 4TLAA 2Q1UA 2X5OA 4C1NA 3X1ZA 1T34A 3L84A 4FB4A 2PL3A 3K71B 1XMOB 2H4WA 4HQNA 1XZBA 2HF9A 2LIVA 4U7GA 5DBGA 4CF4A 4DDHA 2Z3ZA 4ZV7A 3KJFA 4QYIA 5EINA 2C99A 3C97A 1XNJA 2YYAA 4RADA 4G4SO 3ZU6A 2XUZA 1X77A 3JYLA 3KR9A 3HJAA 2DHQA 3QBVA 1ID8A 2VBCA 3B1JA 1L6IA 2Q4BA 3BWEA 3C6XA 3F67A 3NGXA 1VM6A 4MA0A 4TUYA 2OO5C 1FX1A 4AWBA 4DSOA 1JR3E 2GARA 3KZKA 2PUWA 4AO7A 3OJ0A 4TKZA 4QRIA 5AR1A 3EZFA 4PCUA 5D1NA 5HCIA 2CNBA 3EXFB 1WE2A 3O3MB 3GGCA 4JY7A 5D5QA 1CUDA 5DIZA 2I65A 5FWYA 1C7IA 2Q45A 3DKKA 5DKFA 3VPFA 5BVHB 1QPGA 3NI2A 4LXYA 5FUMA 4NAVA 2IOFK 4NCNA 1UUFA 5D85A 4DGQA 4FR5A 3KSZO 4PG4A 1OBHA 5ERXA 3LQFA 3ZC3A 2PGOA 5GONF 5AIBA 3G2JA 4UDXX 3F8SA 3UJ6A 4JJAA 2GNAA 3V55A 4YRIA 4N5NA 4RTMA 3OQNA 1PWYE 2RMKA 3R9WA 3D6HA 1RYZA 3ZDZB 2GKSA 2ZM5A 3NWBA 1XA0A 4NZNA 3BORA 3OZTA 2REXB 3W3ZB 5DX8A 5IDXA 1V16B 1V3QE 3CUTA 2JI4A 4O2BF 1IAQA 5FXMA 3MMSA 4CKZA 2D59A 1SOUA 1SC6A 2BMEA 4LV8B 5CM9C 3HBNA 5DSTA 1D2RA 4FR2A 2XVZA 5DHRA 1EVKA 4HYYA 3VOTA 1PR3A 1ULTA 2O2ZA 3C74A 1LDEA 1T15A 3JQQA 2VDOB 4KXXA 5DTQA 2ENWA 5IZCA 1NHGA 3TQQA 1ECGA 3OOJA 2IWRA 2AOXA 3NO4A 3KQHA 1QKKA 3HDTA 3IDOA 3ISVA 3FTDA 2QA5A 4DARA 3QU2A 1BE1A 1I2ZA 2OCLA 1NIPA 3DFZA 1EWKA 2NXNA 5KWJA 4GI1A 1JNXX 1LKZA 2FW0A 3QFRA 4DQ0A 3ZHOA 2ZYAA 4NWIA 1RYMA 2H2IA 3CR8A 4PXSA 3CX8A 3AR3A 2WT4A 4K0RA 2VK8A 1GN8A 3SEAA 3LYUA 4GMKA 4B33A 1E1YA 4FC6A 3IKTA 1EPUA 1O9HA 2G36A 4UVIA 2PY6A 3WGYA 3UUGA 1U3WA 3WYGA 1A4RA 5I4BA 2ZUDA 3L4BA 3D8UA 4PEVA 5MGNA 1SKMA 2FEMA 2QT0A 3M2PA 1OVMA 5CB4F 2C2GA 2Q1XA 4QXPA 3GEEA 4LCJA 4WLFA 3UMMA 1JJBA 1QF9A 5DRYA 2QN3A 2VUSA 1GQRA 1XUOA 4UU8A 4AY2A 3BFVA 4WDQA 4GKKB 4KQXA 4TSRA 1N6LA 3JV7A 4JFRA 2GWRA 3M82A 2WTMA 3CURA 3KJQA 4IX9A 4YUVA 3WYFA 3FJ1A 4ZI7B 3HWX1 4F5ZA 1EX9A 1OFHA 2ECPA 1AE1A 2PSJA 4YJ2F 3FLAA 3KCQA 4YR7A 4MIYA 1QRRA 1SVLA 2V54A 1HEIA 3LHDA 3S1LA 1ND6A 2XYGA 1ODFA 3PNYA 2GZ2A 2XLCA 2W8BB 3A10A 3VDMA 3LFTA 3K6SB 5JNLA 5FI5A 1BXZA 5ALUA 1ZCAA 3Q5DA 2B21A 5JPCA 2O8DA 4TVSA 5KDDA 5B2ZA 3SX0A 2VHWA 3RSGA 2R0QC 4RPJA 1SB9A 3ELBA 1ZGBA 4XIGS 1MAAA 1ES9A 2Q3JA 1RTKA 3KVRA 4RSMA 2DU8A 3TFWA 4B75A 4S1TA 3GH1A 4H1VA 4GPBA 5IPFA 3WHPA 1K5GA 1PNTA 3ST7A 2XGSA 1QB8A 3BE6A 4GP6A 4II3A 4BFUA 4LJ6A 2VF5X 2FPPA 3TVYA 1JLHA 1SELA 3ICWA 1MZPA 1FJHA 1YI0A 4DXHA 2RK4A 3GIWA 4N3CA 3QPCA 4GWGA 2VNKA 1KAHA 4J3JA 2O23A 5K99A 3L0BA 3FCXA 5FFMA 1P0QA 1Y9EA 5CNJA 2IITA 4H7FA 1QVWA 3HZRA 1Z9BA 3FUVA 3JQ9A 5C8XA 1GFWA 3FW1A 3NT4A 5DBFA 4F2GA 1IIRA 3LCVB 2ETXA 3SQLA 3TBHA 3WQQA 1BU5A 4BQPA 1ODSA 4ETNA 1KJNA 2AFIB 2FQQA 2B1GA 2SNIE 2YC2C 4IWXA 4RIIA 3V1NA 3TLCA 3JZIA 3W8NA 3BX1A 2C03A 4AP9A 4DT1A 4DR7B 2FFRA 1QAMA 2AE2A 3BWXA 3ONDA 4ZXFA 1X80A 3MGCA 2PMWB 2P2GA 2QTTA 4AVYA 2CV2A 4PNHA 3RS8A 3S7TA 5DH9A 4U2KA 2FX5A 3RC2A 4G56A 3PYLA 4JZKA 5EUQB 4Z9FA 5IWCA 2UXDB 3QW2A 2H4ZA 2FWAA 1YTLA 1QZZA 4ZAYA 4Z9YA 4GICA 5GZ1A 1PFWA 5AW1A 1GLGA 3AG6A 1BXGB 1FA9A 3COVA 1VE7A 2Z57A 3JYPA 2JEOA 3WAKA 5CMLA 3WIBA 3BFKA 2UZ1A 2ZI6A 2CSXA 3LT1A 1ZH6A 1FXWA 1HA3A 2AYYA 2QMUA 3HYSA 4KIJA 4KHZA 4YAOA 4RENA 1CR4A 4D45A 2JKYA 2QSZA 3LK7A 3P9CA 4ZDIA 2C2YA 1UK9A 2B99A 1DARA 3EW7A 5I9TA 1AKQA 3M89A 1SXJC 4D4GA 2PO5A 4G25A 5BMVF 1KR2A 3USZA 3GFSA 4HD8A 1T26A 4BKQA 4OVKA 4CLRB 1ZGAA 3CLUC 1HBJA 3HRKA 3WLTA 4ZRMA 4LVNA 3V1KA 4RQUA 4UUPA 3GLTA 1KFBB 2J3QA 5B1EA 2VRCD 2ZIVB 3UATA 3PEUA 5K0JA 1N5LA 5KB3A 1UBNA 3CNBA 1TAUA 3A05A 2WP8J 4MUHA 5BR1A 4F91B 2O05A 5ERYA 4U7DA 1SOMA 3IJ5A 5CA0A 3QQ5A 1WY7A 4B3GA 5LJLA 3CT4A 4CM9A 4ND7A 3Q3HA 4M9XA 2C3MA 4G1EB 1Y1SA 3R9IA 1YZFA 1FXWF 2ZJZA 2IEBA 4UHFA 5BWCA 2J33A 1OXUA 3MD9A 2VQ6A 3TSWA 4M1EA 3UICA 4YR9A 3GK3A 4FZ3A 1T1IA 1QS0A 5BWNA 4QDJA 2LCFA 3WXMA 3HKDB 2ECOA 4ODIA 1XKQA 4PTYA 2C4MA 1T9HA 2QJRA 3HR4A 4HDKB 2ZM6B 3D3WB 4C3VA 1Z16A 3RBXA 2NZVG 4NLLA 1XQVA 5FTWA 3IP6A 1FYWA 2ZYRA 3WWCA 4NH4A 1CYEA 1X7YA 2F3QA 3SYKA 1H93A 3CKMA 4R9UC 3UAGA 4DLRA 1CR1A 4F3CA 3OY2A 1DWOA 3GDFA 2XVYA 4DG8A 4R8SA 3PFIA 4JXKA 2A86A 1IM2A 1R5NA 4MB6A 4LTMA 2BFEA 4CM8A 2NU6A 2H1LA 3R9XA 4MKHA 2JATA 4W8OA 2BD0A 2H07A 5EP2A 1UOOA 3ESXA 1E1MA 4DLWA 3QU7A 4CW7A 3KSAC 2UUOA 2GK3A 2NT4A 4BX9A 1EVZA 3EPKA 4LPKA 2IXAA 3WE7A 5LP1A 2KS6A 2Y4OA 3EXG2 2CJPA 3VQTA 3X43A 1QK3A 1FF9A 2DMRA 2Q8NA 4HDNB 1CRZA 1J8DA 2GHIA 3ZE0B 4GRAA 3K2IA 1F14A 2IX3A 5FEMA 4MQ6A 3EIWA 1LK0A 3QTTA 2Y9MB 3FLMA 3AV3A 4PFSA 1ONNA 2H1SA 2QMZA 1JMYA 1X7XA 1FDWA 3IQHX 4PQEA 4E70A 4LHYA 3JR3A 3IRUA 4U5QA 1U0OC 1RXEA 2D7CA 3F6SA 3H04A 4DXDA 3H2KA 4XCVA 1KXJA 3JARA 1G4UR 1ZC4A 4JSRA 3BWBA 3K5HA 2FPSA 1EK1A 4EHFA 2JGNA 4RJIA 5L6LB 1UT5A 5HRUA 4JROA 2Z30A 2X15A 3TW8A 4JBHA 2XMRA 4RVHA 4KN6A 1TKRA 3PXXA 4LYGA 2OAGA 4NMLA 2J30A 2X5XA 3WO1A 3AF0A 2INGX 2R8ZA 3HTXA 1HNZB 2JH9A 4G8CA 4LOIA 1I6LA 1KGDA 1YUNA 4CKBA 1FUKA 5FF9A 5TGTA 1DLJA 3VH3A 1RJ9A 3N0TA 2VDMB 4MV6A 3WWOA 1RHUA 2W7TA 5KHAA 4BO1A 1NMEA 2H92A 4Z0TA 1KI6A 3E22B 4OQLA 2FEKA 1B16A 2XX3A 4L57A 3VPGA 4EGAA 1B00A 3C3WA 3EF1A 2GYWA 4TWRA 4PZAA 2B1QA 5FV7A 2QKYA 4B3CA 3CGGA 2OD9A 2Q7OE 121PA 4PC2A 2DQKA 5JNRA 2VHCA 1N2EA 1SVMA 3GJ3A 3TZHA 4OU5A 1EBFA 1QGUA 1JJ7A 5FO1A 1HDCA 3RVOA 2F8LA 2XOEA 4AZ0B 2J3LA 4HUTA 3CVXA 1KJ9A 1X13A 4PYIA 5GZ3A 4MVJG 2QRNA 5FP0A 1J21A 1THGA 3HPQA 4RNDB 5IBPA 4I36A 4Z54A 3H4VA 3AVXA 4I4IA 4XX0B 4L4RA 4AROA 4B45A 2J48A 3ODPA 4D26A 4U2FA 3D31A 4JA0A 5FT9A 1LWNA 3TR6A 2AOTA 3Q4GA 5C5EA 4RTRA 2IH2A 4KRYA 2AGVA 1CB0A 1L4UA 3CO5A 3CZ5A 3A4LA 3FPHA 5CURA 4RHFA 3H9GA 2G1KA 4Y9TA 2AI2A 1Y8QA 5HF9A 1VJTA 3DEIA 1T9ZA 3NUZA 1JV2B 3PXEA 3T3GA 1P0IA 3LS2A 1SD1A 3AEKB 1UEJA 2H5IA 4P7KA 5HCNA 4YRGA 1TF7A 3MK31 1NF2A 1UM9B 4PCAA 3O93A 1Z0FA 2BFFB 1AQLA 1EFUA 1Y9ZA 3LI2A 3UBMA 4F5EA 1J1IA 4WXMA 1YR8A 4MVWA 4FM9A 3WLQA 4E2XA 4W1PA 1GD1O 3BTSA 1NRWA 3M8KA 4DJDC 3H8SA 1X1SA 1HEUA 2Z56A 3Q5EA 2P1ZA 4DR1B 4BY9E 1C80A 1TU4A 4MQEB 1Z4OA 4LYDA 4R2XA 3W9YA 2VXBA 4YLGA 3ZE1B 2GPBA 4MS3A 3S28A 3MELA 3Q7IA 1S4QA 5IC6A 5EEGA 1RZRA 1E7WA 3NHMA 2ECFA 1MO3A 4JEIA 5LU8A 1OJLA 3S99A 1KBQA 1J70A 2Z04A 1PYOA 3B1ZA 2IOFA 3F6EX 3HFSA 3HN7A 2Z1MA 1A71A 3I01M 1WKVA 1DIGA 1BA2A 2PXCA 3V1TC 1PR6A 2KX7A 4DWVA 3EGOA 4ANFA 4X9XA 4C0WA 5AI9A 3WS7A 3L40A 1OLUA 4OQFA 4LQLA 3O8DA 1XZCA 2O2HA 4QHSA 2YHIB 3C70A 2UZAA 2QX7A 3HCCA 3CMCO 3LKDA 4Z2YA 5HKAA 5I47A 1CR2A 4YRTA 5L3QA 2RHCA 3F9CA 5IZCC 3IMFA 5CXUA 4YPOA 2PANA 4EL0A 1N92A 2XGOA 1C50A 1MDBA 2Q3EA 4MITA 4YH1A 1RWOA 4LJAA 2B9VA 1H0HA 1EGHA 2X4LA 1D1TA 1MABB 3LGSA 3QA3E 2WM3A 3TR0A 5JYCA 1QG0A 1PSZA 4OQ4A 1RZRD 4J2TA 3HNOA 2QP3A 4QTUB 4EF4A 1ZZGA 2WKQA 4L3OA 1CT9A 1UZNA 3PD0A 3HYTA 3G85A 4DB4A 3HR8A 1WMFA 2R66A 2D1QA 4FYWA 3KXDA 1QRSA 3DSRA 2AEFA 4FHCA 1EDZA 1ZJZA 5GJWC 3TIFA 4TSFA 3P0RA 3OCVA 4C30A 3UH0A 2QLLA 5T5QA 1TTTA 1MQ8B 1BE6A 1U2EA 1YB4A 2J6IA 2HFJA 3GAMA 5KWVA 1L3BA 1E6EA 1WPGA 2HU5A 3ER6A 1GZUA 3AEZA 3KSRA 1KZ6A 4FEYA 4FOLA 4FOTA 4JIGA 2YRWA 4C6RA 4CHGA 1QH8A 4BV2A 5B7PA 4MW1A 3VNQA 5IN4A 5HFAA 4URHA 3V1MA 3ZWWA 2OQVA 1VBNA 3OSZA 5HUJA 1JECA 1HI9A 3QNMA 5GQSA 1L5GB 3HA3A 4G5RA 2EKZA 1BDMA 3WWDA 3QVTA 4DZZA 1H8EA 1L0BA 1P7VA 3G2KA 4RDCA 5AKJA 3GP3A 2WHPB 5KCMA 5H7XA 3L7LA 5DNAA 1E66A 2YCBA 2FDXA 4XZ3A 2WIKA 1UKEA 2H17A 3GPDG 3I72A 4CR6A 3K9WA 3A6GA 3CRZA 4XEUA 2LPMA 2X3UA 1ZIYA 2QEQA 4ASUD 2JIQA 5DWQA 3DQZA 3T3IA 3M5WA 2IZZA 2OBLA 5JJKA 1IN4A 2BGTA 2WJPA 1TQDA 4TL9A 3LSYA 3I0NA 1BCRB 1JDBC 2QUJA 5KDLA 1Z62A 2ZJ2A 3I12A 3QF4A 4MQMA 3AESB 1E2PA 4UCFA 4CLOB 1MH1A 1YZKA 2FPMA 4NENB 4MVJI 5I7RA 5JFGA 3WLFA 2K7ZA 1YOVA 3PDCA 3KQWA 1G19A 1XZAA 1Z0AA 3ME5A 1I3OA 3CZPA 5HG0A 1GCIA 2B7LA 3NFYA 3WGQA 5I9IA 1XC7A 2J0QA 3R0ZA 1MC4A 1GGEA 1T4DA 1WVMA 4AXXA 1Y5MA 2Y99A 5DFAA 3C87A 2BFFA 2HUNA 3SMVA 1X1RA 5C8DA 2WJGA 1QQBA 3AHEA 4TQ9A 2ZAOA 1IY9A 3SC3A 3VKVA 3IV6A 4U9HS 3LC7O 4KBFA 1DXQA 1E94E 3K9LA 1HRDA 2QD4A 3W77A 4XUDA 1AV7A 2BFEB 1S2NA 2KM1A 2XRFA 2YMMA 3TI9A 3V8QA 1HDOA 4CM8B 4N7BA 4IQ0A 3H1TA 4YCDA 4NEHB 2CK3A 4ER0A 3G8BA 5KX5B 3KB8A 1Z12A 4QZVA 1J2JA 2C5EA 2VTBB 1E3DA 2Q46A 2R84A 4CFZA 1ZM7A 2AI3A 4MCIA 5JXHA 4DIMA 3VR2D 3L7KA 2AD5A 2M6RA 2NSHA 1F06A 1G291 2MIIA 3LY8A 1A88A 1P33A 3P4UA 4QXAA 3HP1A 4KLRA 3PC4A 4FXPA 3O94A 1SZJG 3W3AA 3AH8A 2CXQA 5TJ9A 4B6SA 4C4PA 3L0IB 1U1GA 3CFAL 3D1JA 5K9ZA 4WXEA 2QVGA 3P52A 4D8XA 3RU3A 2OPHA 1Z8FA 2N9UA 3RJTA 4EF5A 1P80A 2POCA 1Z6PA 4ZVOA 2AQKA 2V7BA 2O8CB 3PC8C 1A3CA 5LZ4A 2FW7A 2G5TA 3BXPA 3MFQA 4MI6A 5E1MA 4PYNA 1BFUA 5C2JB 3EHDA 1TFUA 3I0ZA 3FH0A 4OXYA 1IN1A 2CFCA 3GVCA 4FLFA 4H7PA 3WRYA 3ZOZA 3HK2A 1JHVA 3RVPA 2EKLA 1MR3F 5DRTA 1Z33A 4ENUA 5JYBA 3E4CA 3GWGA 3LA8A 4PZUA 1X8JA 3E2PA 1UJCA 1K86A 2PVSA 5CNKA 3E9EA 3JVEA 1D2NA 1G8AA 1DC8A 2D54A 2ZSUA 2ZT8A 3HXOA 2H52A 2QX8A 4GXNA 4QQ8A 3OPXA 4RD4A 3V3TA 4QXQA 4CKXA 2IEIA 4UQOA 1GWNA 2WVAA 2VRBA 4CCAA 1MO6A 1Q16A 4U3JB 1OTHA 2I87A 4F3YA 4I99A 4XWGA 2C2XA 4I3FA 3D7MA 2ONCA 4KI0A 5J47A 4I1SA 1BCSB 1UPBA 4YLEA 2BLLA 3U7HB 2VH2A 4HGOA 3MINB 2RGAA 1N2CE 2VO1A 4OGFA 2NZXA 2Q3FA 3MGAA 1I36A 2C92A 2NT3A 4V02A 2YHIA 3ZQKA 2G06A 1OH7A 2BFAA 2RGRA 4JBWA 2HT1A 1NE2A 4PLGA 1MHTA 1OU0A 4CM3A 5CJ2A 3BIWA 3GA5A 2ASVA 1SU4A 1ODTC 2WJAA 2YNMD 5FV4A 1YB1A 3LOUA 3E7WA 3AVYA 1O08A 1FXSA 4YTEA 5DOVA 1MABA 4XGIA 3A1CA 2DJ5A 3MQ2A 1PFQA 3NYQA 3ZY6A 4FB5A 4D0GA 3ZCRA 4G1MB 4CNBA 5SY4A 2ZIXB 1L1QA 1GPNA 1LC0A 1K6JA 2EYUA 1JEOA 4FYPA 1QBGA 2H4YA 4W1QA 4DMMA 2CNDA 1LI7A 3JSXA 3E8MA 1YV9A 2HH9A 1E79D 2I7XA 3PPWA 4OJNA 2QPAA 3T41A 3T7JA 1L7BA 1CFZA 4FBGA 1NT2A 3KXKA 4R8LA 3IOMA 3QEKA 3SVLA 5EE9A 2IIPA 4K6FA 4RBNA 5U1PA 2X4GA 1LRKA 3RU7A 1OREA 4OXXA 1SIBE 4LTNA 4H0FA 4BATA 1OIWA 2OMEA 4ND2A 4TLBA 4ZJUA 4XTRA 4CMEA 2QVLA 3GEGA 4E09A 1M2VA 3PNMA 4HNRA 3I6BA 5CW2A 4CQMA 3T9AA 5DP1A 3FLEA 3HHPA 5EMMA 4F1JA 3NHJA 5JMPA 4EGQA 2UYCA 4L8YA 1VOTA 3X1JA 1T0JB 1EQAA 2OFFA 3GYBA 4I9GA 1GYQA 1QFMA 1PDVA 4C5AA 4I1PA 1AQJA 2VVTA 1HE8B 4NULA 1XKLA 8AT1A 5GIPE 2DR2A 3ITNA 1G5PA 2Z43A 4QM6A 1QH9A 1DO2A 1ONOA 2QW0X 2RKWA 1WD5A 1Y82A 1T2AA 3CLRC 4QU9A 4B3IA 5BPHA 2CXPA 3G6KA 4Q9HA 1FE8A 4K86A 2RIRA 4ZQCB 3OOWA 3QYFA 1ID1A 1CTQA 1X9HA 4FMCB 5EFZA 1GLNA 1HV8A 3N7TA 3WB2A 1ODLA 4NFHA 4AN1A 1NXTA 1WABA 3OFND 1VGVA 3E3MA 5JI2E 1XL1A 3TLAA 1FUEA 4DIUA 1E64A 1H4VB 4F7WA 2J6HA 1RT9A 3HSSA 2C8JA 3R0XA 2PT9A 4C7VA 3AFIA 3VKUA 5BSFA 1M2WA 3D1LA 3MMZA 3TINA 3D2AA 3JQRA 2O2SA 3UAWA 3FBTA 3VI4B 2D5AA 3E27A 1FFDA 4ALJA 4YT2A 1TEZA 4FONA 3FVQA 3GCWA 2JGLA 1QO0D 2Z83A 1OYOA 2Z2JA 1RLJA 4JBNA 1C4XA 2H2DA 1ZK4A 2B78A 5H16A 5ICSA 3VKGA 4YUYA 2PEZA 2VAPA 4M7RA 2WDPA 4EYSA 1QFZA 1JWAB 3RRYA 2HL6A 1QYVA 2K6GA 4NBVA 4Q3AA 2ZTMA 5AI5A 3VHQA 3AU8A 2GF0A 4G84A 1C3EA 3EE6A 4CKWB 1P1FA 3TD6A 3TXYA 1E5VA 4IEEA 5A5FA 2PSSA 1AS2A 4D0LB 1V8BA 1ULUA 1KFCB 3TQTA 5HRAA 5HK8A 4KQFA 1TE2A 2BELA 4FK8A 1QZUA 4MTLA 4EPRA 3FAZA 3UUFA 2ZS8A 2BL4A 1RJWA 3C0KA 2ZIGA 1OGJA 1IXKA 2DPXA 1S02A 2IUUA 3G0OA 4JU8A 3LY7A 4DAEA 1SKQA 1V2GA 1U7DA 5EXTA 3UZUA 2QRMA 3UW3A 1WX1A 2JIPA 1F8GA 1L7PA 4IWYA 3TG8A 1KZYC 4O3MA 2ZR9A 1OH6A 3SMQA 2OK7A 4GMFA 4IIGA 2NU9B 1ZWKA 2DHEA 2WAXA 4H7EA 1BEZA 1T9CA 2N46A 3K2EA 4K9DA 2WQ6A 3ORSA 5G4LA 1G55A 5EZSA 4DRYA 4JYMA 3UFXB 1W6UA 4KK4A 1Q7EA 2Q5LA 1SUCA 2J3IA 2JGDA 4LXIA 1E7YA 3NHPA 3MS2A 3PF8A 3HVIA 4PTZA 2PRSA 1JFFB 1X94A 5C35A 2IKQA 4PO9A 3AT1A 4UUMA 1IE3A 3EVZA 4ZZ2A 5SYAA 5BNZA 2F3RA 3ABRB 3GJ8A 3R41A 1L3IA 3QK7A 4B48A 3J7AC 5IH3A 4JV5B 1DRVA 4O4HA 2WWRA 5CGQB 2X0EA 1F0PA 2BEUA 1NVXQ 4DMCA 2RGDA 4WKGA 1I7DA 3RVKA 3ZXYA 1G3UA 3QJYA 4QA9A 3PXCX 3P9YA 3SFZA 1JG4A 4NNPA 2X8LA 4OBEA 4CIBA 4KUGA 1WDMA 3ASZA 3H11A 3NIDB 1GOTA 2JI8A 4PG6A 1KIFA 2X1VA 5A06A 1UJBA 3BC1A 3BH0A 1ABEA 1GDDA 1TOAA 2WAOA 2PX8A 3LRTA 4RPIA 1JTFA 1V5GA 3W6UA 1W25A 1H9CA 3AMVA 3I9OA 3ZWAA 4Z3KA 2AT1A 1EUZA 3RTBA 3EVCA 4GPEA 4FMDF 2C3YA 1UJ2A 1M2JA 1XD8A 1MEOA 2J41A 2PQ0A 2QLNA 4FINA 4G2TA 4ON9A 5E1OA 2QR5A 4JUAA 1D5CA 3SZLA 4QDZA 5CDHA 2IZ6A 4GOLD 5CLIA 3CZAA 5FLYA 1S8AA 5A6SA 4LI3X 1GTRA 1NC3A 1VCMA 3RFUA 3GGDA 3EULA 5DCLA 4EG7A 2FMTA 5FTJA 2AFHA 4II7A 2FUNB 3IAEA 3RKUA 1CLEA 3LM8A 5K5EA 5EXXA 4R6XA 2WFZA 2PD3A 4LDPA 3ZHCA 1Z2NX 5IBQA 5JSYA 1A69A 2YS6A 5JCJD 2PAAA 3GGSA 5ALTA 3PE6A 1GCGA 3BOSA 1S3SA 1D4FA 1XBTA 1KK2A 2P62A 1ABFA 5AHRA 3AUKA 1K3TA 1GKIA 2FMUA 5AKLA 4N3AA 4PU0A 4LYEA 3VFDA 3IHLA 1FTWA 4EY6A 1KH2A 3KYDB 4KV7A 1M34E 3S1SA 4TZ0A 4N5IX 2HLDD 1WXGA 1U9IA 4LK2A 4OIFA 3RAJA 1VPEA 2ZZNA 4IJMA 2FPKA 2FMFA 4JK3A 4RHUA 3U6KA 1D04A 1Y8RB 3C6QA 5DLPA 5LZ9A 2X2PA 4P8RA 4OMUA 1Q5PA 2IJGX 1ZL2A 3DD5A 1HFEL 4CG2A 4HPWA 2ZSFA 3L0DA 3MJDA 3IELA 3W5HA 2FH5B 3CF6R 1CUGA 4MR7A 1B7GO 1FK8A 1H85A 1L3CA 1C81A 2XUPA 1UAYA 5TMDA 3DL4A 5K3OA 3JPYA 5G2FA 1K89A 1U28A 1FRFS 2RH8A 4GBED 4S24A 1FFAA 4HX2A 3GLGA 4IDFA 1R0YA 4DIOA 2FYTA 4F6RA 3RR2A 3ZNPA 2CUNA 1OVGA 3VR3A 3EYWA 2NOAA 2OZPA 1D09A 2R4QA 1QQ6A 2VWPA 2WJHA 4JLSA 3PUJA 4PPFA 5G0VA 2OLEA 3O3OB 4RFVA 3K0AA 3C1OA 3Q1KA 4NE2A 4OGGA 1SBTA 1VE3A 2AG0A 3RK0A 1G9SA 1DS6A 1YFKA 1Q44A 3G1UA 3RSHA 1G18A 1XAIA 3EQ6A 2BY4A 2CBXA 5CPBA 2BTOA 1CVLA 2VIIA 3HBFA 3PTLA 2W6JD 4PBTA 1MT0A 4KWTA 3DOUA 4NCHA 4NJEB 5JY1A 1GCUA 1KO7A 1WTAA 1B41A 4KO3S 2CZQA 4BKUA 2FY8A 3B3QA 2O8BB 3KQQA 3CB2A 5F2EA 5HKKD 1YS4A 4EP1A 1PT8A 1SHKA 3AL3A 2C78A 3TRKA 5LXTA 2XW6A 4AKHA 3NUGA 5F52A 3EWNA 2IVFA 3PHBE 4EKDA 1OIXA 1L1EA 4BWVA 1G9XA 3QFHA 3DDOA 1QPZA 5A9TA 3P45A 2DR0A 2FZLA 4MSUA 1W5EA 3PLAE 1YQWA 1BGVA 3HYCA 3NOOA 4FMCF 4JQZA 4PZ0A 2DPHA 4B83A 1W5BA 1Y80A 2JIZA 2W6ZA 5ALRA 2ZRIA 5A3QA 2G2SA 1M1YE 2PGXA 4X63A 3NEAA 3WYCA 4MW9A 4PG5A 1F2DA 4BAUA 4JAVC 2VEOA 2X8WA 1L8OA 2XMPA 3NV9A 2OD7A 4MWDA 2FW9A 1NBMD 3UB4A 3C5EA 2CK3D 4EB3A 2QUAA 4W5OA 1RQLA 2XNDA 3WRXA 3O8CA 4AWAA 1U5BA 3U61B 2TSYB 3COWA 1EE1A 1SCUA 3IVMA 2O7NA 5E9AA 3DEAA 2X0IA 3NX4A 1GG9A 3K9FC 3PX7A 3KM0A 1ZK0A 2RETA 2O6HA 4QGHA 3V8RA 2RBEA 4IHJB 1E2IA 4AQ7A 5KYXA 3EZYA 1EB9A 2C82A 1NRIA 3KYIB 4MUFA 1AGXA 2Y1FA 4HN4B 3WK4A 4HJXA 3X0DA 1QMPA 1L1RA 2YOGA 4J0CA 3QMWA 2ZB2A 3VR5A 2AKAB 3FDFA 3JAWB 2OV8A 3QMVA 3W0LB 3R76A 5FH9A 1DCKA 1ZK1A 2X2FA 3PITA 3HZOA 1P6UA 4BNLA 1W36B 3KOYA 1BKDR 4FGKA 3NWJA 2ZCUA 3Q7PA 4RYDA 1XP5A 2X4IA 1HDIA 4G5HA 1XTKA 3GBVA 5U9CA 5KINB 1D0IA 1U1FA 3PHLA 5CB4B 4PX3A 4DUGD 2AW3A 1MV5A 4MWEA 4FWTA 1SK9A 2XBLA 2WWIA 4X0EA 4X45A 1Q91A 3WI7A 1Q14A 3WYDA 1PZHA 1EGQA 2IC5A 5H68A 2EATA 1R27A 1Z6YA 1ZCBA 1C8KA 3SAJA 3RUPA 3U1TA 3K0FA 1ZLYA 1LZKA 3HXQA 5EWJA 3UMFA 4EQ6A 5CLLA 3VDRA 4ZI7F 3HB1A 2GZ1A 5DTRA 1NLZA 1ECBA 2V7VA 1DAHA 1KBZA 1ZH0A 4D56A 5KDOA 1YJAA 2C0PA 4JXZA 2H31A 4V3BA 2AYZA 5MFPA 1WP9A 1G7RA 3OT1B 2DKFA 1BJTA 1Z0JA 3M3HA 1KDYA 1EB8A 2PUFA 1ZD1A 5LYJB 4LE0A 1B74A 1X1BA 4Q3NA 1RCUA 4EAQA 1DUSA 1C3XA 5TGZA 3B2QA 4PX5A 2X1LA 4Y2VA 3A0RB 4B6OA 5JLJA 1XA3A 3FUTA 1U0GA 3OHSX 3QX9A 4WXHA 4P4LA 2WJ6A 3ZD9A 3KOWA 3SGLA 3T3NA 4JNKA 1G2IA 3MGGA 3UMCA 2IYXA 2PYIA 5DASA 2UAGA 4F1WA 3OG9A 2H18A 2D5IA 3OOSA 1ZQ9A 4I4CA 3RCBA 1R8SA 4QGAA 3GLFE 3AHCA 3WMWA 1QFXA 1Q57A 4HRYA 4LF4B 1G5TA 1RAIA 4Q5IA 4MMYB 4YAWA 3N0VA 3ZV6A 4BWGA 5AFSA 1QH1B 1NVVR 4MV7A 4ACAA 5H8WA 1YOBA 4L75A 2CLIB 5HHTA 4WY8A 3DT9A 1FS4A 1RKXA 1M76A 1NYQA 1TUGA 1ZJYA 1HE3A 2V6MA 3F6BX 4HKTA 4OUKX 2Q0XA 4LJ7A 2VPWA 4AICA 5AKZA 1PJTA 1U0LA 421PA 3DBOB 1H1LB 4LXHA 2ACVA 2WJWA 5JRDS 4DWWA 1H3FA 1E9EA 3OY7A 4L9SA 3RDPA 2GT1A 1Y9DA 3T5AA 2AR7A 4BGIA 1CDZA 2B69A 4LWPA 4Q3CA 2WG0A 1M34B 2GSWA 1TQHA 2J45A 3FDZA 2A5FA 2EP7A 4L8VA 5DGTA 3T3PB 5JHGB 1FL9A 1KDZA 2FZCA 1A9XB 2W6ID 3CONA 2HA2A 2A1TR 4N0PA 2HMUA 3UJDA 1Z0IA 5FUBA 5L7WA 3SKYA 3CUSA 4ESOA 5B58T 3WGUA 1E6KA 5ITVA 4LJ9A 2A0FA 4WASA 5BR4A 1ZNYA 5KX5A 4R84A 4X66B 1ZYUA 2J09A 5DBEX 3VR4D 1S0UA 3S8YA 3ZY5A 1VXOA 1JDNA 1UBLS 3G79A 1J39A 2O2EA 3L2OB 4D6XA 1YFJA 2W2NA 3EAGA 3RSFA 3VTAA 1B8NA 2G1PA 2FG7C 3MINA 4CLDA 4L4SA 1Y42X 3L8HA 2I2CA 3E8XA 4D4HA 3JWGA 4KYVA 1MJ5A 2OORC 4NZYA 1JIUA 4YJDA 1N8TA 2QG6A 2AE1A 2O8BA 3S2IA 1L4YA 2A0XA 2YXEA 3CG0A 3N2GB 3LT0A 1YR1A 2D0PB 3QUCA 4R1TA 4U7FA 2C84A 4O8CA 1ZAYA 3JD3A 4KYIB 2I4LA 1I9GA 3U4QA 4O5OA 4KR6A 2FN7A 3OPMA 1NBOA 2IKSA 4ALKA 2DHDA 1XLUA 2WWHA 4YIKA 1BQEA 4BLPA 2OECA 1U3CA 4HAUA 3ROEA 4FOOA 4X93A 4PSCA 4QGFA 3CH4B 1OF1A 4P6VF 3F46A 1N1EA 1VFPA 2AC7A 2BGWA 1JR3A 3U7JA 5FPPA 3ZY3A 4HP8A 1O54A 2V6GA 1I14A 4NAUA 4RJ2A 4EB8A 2IYWA 2OO3A 3EIEA 4X1YB 5FB3A 4DDVA 1DHRA 2JBAA 2ZRLA 1YRHA 1FYFA 3PRYA 3TH5A 4M1MA 2GH1A 3SC6A 5ALXA 4JP8A 1NF9A 1VRVA 1H5QA 5SICE 4EVIA 3KQLA 2N0SA 1Y7PA 3VISA 2GLTA 2DQSA 3VZSA 3GEIA 2OZLA 4DQXA 5C5IA 5TS2A 5IF9A 3DAGA 4JBGA 4OHRA 1R0RE 5F2KA 3LYHA 4J94A 4HWOA 4JUIA 4RTSA 1XAGA 3TMYA 1NJFA 1XLTA 3ONWA 5F98A 3T3OA 1V11B 2Q5JA 4URVR 1SKBA 5JPIA 3W5VA 5TX7A 1GIAA 1KBOA 1WB4A 5KYKA 1KAGA 5C32A 3UMBA 1NT4A 1HT3A 2WPNA 3PB3A 3GRKA 4ETMA 5C1DA 2D4HA 4CG1A 5JZBA 2Z58A 3ONNA 3QFFA 3KRTA 4JSYA 4E51A 4C5CA 5HW0A 1BZYA 1E6MA 1Y37A 3C3CA 5DXAA 5CEFA 3CRRA 5EIHA 3AKDA 1XWIA 3WNZA 2H2GA 3PD1A 2I1VB 1QMGA 1PFGA 2P3OA 1Q77A 3VXKA 3H2YA 4JI3B 2ZVPX 3H6KA 2XYRA 5ARCA 3TXAA 3OZSA 5FHRA 2CYAA 3EG9B 3KSBC 2PSDA 4H7DA 4AZSA 2AOVA 4WACA 3S44A 3E6AA 4IIJA 4X95A 1OYVA 1VCHA 1Z7EA 1E1KA 1PLKA 1Y9JA 3EXG1 3E1KA 3LGAA 3MWJA 3NDRA 3IR5A 1EGMB 4OGKA 4QNRA 2ZAYA 3RODA 3TUJC 3HBAA 3BXZA 5M7EA 1C7RA 1R6VA 4LZZA 3NH6A 2LP4Y 1U2TA 2V96A 1FPQA 4W5JA 3VVBA 1WM1A 4KPGA 5C8ZA 5IHXA 4FYIA 5G1NA 2IHTA 3VYWA 1T24A 4BDTA 4PHTA 1JIKA 4O2LA 5CT8A 4OHMA 2CDRA 1T2FA 4GZ6A 4CKEA 2N47A 2HJVA 2ZOSA 4I8DA 4UM5A 3KPUA 3ESYA 2LV8A 3Q6MA 1C29B 1R9JA 4RMGA 1DJMA 4OQZA 1ENZA 3L05A 4Q1BA 3T7TA 3W1VA 3QKTA 4F2HA 3DT6A 5DNCA 4QAJA 5CCBA 2G72A 4V0ME 5C52B 1BVYF 1CSEE 4PG7A 4S1VA 5FHQA 3H6HA 4DMRA 5JWRA 3PPIA 3ZHSA 1PJLA 2V9CA 3ENVA 5FUVA 3ZI0A 4HRXA 3KDSE 1O95A 1TVKB 2XMBA 3K6KA 5ALIA 4ZYVA 2QLMA 1QC5B 1DKLA 4XD7D 4WD3A 4F7DA 4EMTA 2W2TA 3RFCA 2IY9A 3QFTA 5NULA 4I46A 3ZN2A 1GSHA 4X6UA 1JI3A 4P34A 4FZJA 3GA7A 4U4AA 4JP3A 1SEPA 5IT4A 3OZAA 3CNNA 2VJMA 3NXSA 3OA0A 1JFVA 2VRNA 5TXGA 3JAMA 2JS7A 3K53A 2WY2D 3SDBA 2GRAA 5A0VA 2E5WA 3ZEIA 1VA4A 1BH6A 1XMVA 1U1IA 5LP6B 4R16A 1Y48E 1VJ0A 5A02A 1K63A 2ZCJA 3EXHB 4N18A 1W4RA 1G3RA 2FSUA 3N75A 3R5HA 3CRQA 2C4HA 3EH2A 1Q11A 2AN5A 5C31A 4YJ3A 1G2PA 2HLNA 4KOAA 4L5BA 1IONA 2QTGA 1YIDA 2PM8A 4A0RA 1Q7TA 3CUEF 5K1ZA 3ZGZA 3ML1A 1XXLA 3WISA 4GQBA 3BS4A 1Z6TA 3EPPA 1Y3HA 2R11A 3A6KA 2IYQA 1JVNA 5CIQA 4TXMA 5BQ5A 3CX7A 5CDGA 3RUCA 5JZMA 1KQFA 1UBEA 1JXMA 1UKCA 3RC9A 1QVVA 1C8VB 2IIBA 4B3HA 2CL7X 2FPIB 1GFZA 1P9RA 1USIA 3AB8A 3I2GA 4JQYA 4KMRA 1Q95A 1MW9X 2WU8A 3B1XA 3O2NA 1YXMA 4GHWA 4CU5A 3LY5A 2I4RA 4G6ZA 1Y0BA 4U63A 3TGWA 1E5LA 1XXHE 1UMBB 3BE8A 2CDBA 3DEFA 4WTOA 5C4GB 5JZVA 2ZU0C 3BGWA 3FYUA 1RYDA 2JIDA 2RHMA 4EJSC 1IG0A 2VF7A 4COOA 1DT5A 2PXAA 3A4VA 3V2UA 1TA9A 3K30A 4RZXA 5JD5A 1V0JA 3QPAA 1B3BA 4JVLA 1NJ2A 3QLTA 2FSGA 5D3MA 4PWYA 4L8GA 2I91A 1U80A 5K8TA 1WHSA 4GQIA 3I42A 1MAVA 3HC7A 3U3ZA 2WF6A 1ULAA 4F93B 3MWKA 4RGBA 5A2GA 4OHCA 3NTRA 1GVNB 1FU8A 1PEYA 4OHYA 1DADA 1V1MA 3BSSA 3BVPA 4HBZA 2VJOA 3DVAA 3M9WA 1N0IA 1ODJA 2AXPA 1KSGA 3C5WP 5ALDA 3VO1A 1VKJA 4CUZA 1N2CB 2I3ZA 1SOAA 2W4IA 4GWKA 3WKAA 2OOSA 5AUOB 2FW1A 2V7QD 3GGOA 1BDHA 3OZDA 1Y3CE 3OSUA 1OBVA 2ZWMA 1AIPA 4BLQA 3RJ5A 2ZQYA 3U1VA 4EFDA 3AYZB 4BQIA 2BFDB 2VRWA 2X5NA 3P2KA 4OEHA 4A0QA 2HPHA 1T4GA 3SIRA 3S8EA 1R6XA 2NW6A 1RLUA 1DSSG 3L1UA 2D5BA 2GJ9A 3JZFA 3KT3A 3QLUC 2Z5LA 1A72A 1F2UB 3EIHA 1RIFA 5AWFC 4B2LA 4ZT4A 1T5OA 2JKZA 4DA8A 2CLDX 2Q41A 4JDPA 2Y0PA 1T1JA 1Z7WA 5CGZA 4YLYA 4W7HA 2O0JA 5LQNA 2VF2A 3MJTA 1OAKA 4EFNA 4PG8A 2FQYA 1FP2A 4RA9A 5BT9A 3EMVA 2GYVA 2R8XA 2IDKA 3FKSD 1M0SA 2Q3LA 2QRGA 3P94A 4DQDA 1Y5IA 2EG9A 3O95A 7ABPA 1A8IA 4BMVA 3F5DA 3DE6X 5JXIA 1XIVA 2ACKA 2VT3A 5CH8A 3CNQS 4ZVTA 4V0NA 3MC1A 3T34A 3SICE 1R1DA 4OYHA 4KYTA 3PEWA 3THYA 1ZEJA 4WFIA 4UNSA 2ZB3A 2X9QA 1C1DB 1USKA 2QMYA 1NW3A 4N41A 1K4KA 4ZQEA 5F1PA 4X1IA 4PSVA 1NW6A 2WKRA 3ZGXA 3TRIA 3NASA 3P9SA 8GPBA 3BHIA 4WNIA 2WJYA 4EUKA 3G2MA 4RIHA 1KETA 4R7TA 1ACLA 3D4PA 1WRBA 3VO9A 1XLWA 5CH3A 1LF0A 1E9BA 1O7JA 4N6NA 3LKVA 5CW1A 5JDCC 2R1ZA 1UH5A 1UC5B 1L5WA 3BL6A 4FXOA 4P35A 3SE7A 1QU3A 1SZPA 1KOLA 1WXWA 4E7OA 4RZ3A 2XNKA 3Q3VA 3CKYA 4WNCA 4AZWA 4PSUA 1KRXA 2HMTA 2HGSA 1YRWA 4AKTA 4D57A 3L7AA 4LQCA 3DOOA 2DFVA 3NHZA 3FNEA 2AHRA 1RACA 5LLDA 1XCLA 4HG2A 4ALNA 1XTZA 4QVIA 3KLBA 5J5CA 3ZWOA 1EP9A 1PUIA 4RD3A 2F1IA 3D1VA 2GCPA 4G4GA 5HMMA 5LQCA 3MQ4A 2QHXA 4DQKA 1JDVA 3WGOA 2GM3A 5LQMA 1TZCA 1JSCA 3QE4A 4RGQA 1IEWA 2RBKA 4RGVA 1K2VN 3RG8A 4A2CA 1ST2A 1N4AA 4IGKA 5GJVC 4A0GA 3EGIA 7MDHA 1QAOA 1U99A 2RIPA 1DGQA 1D8TA 3WQHA 2LDXA 3CXRA 3M1YA 2WW8A 1KYTA 2YWFA 3FUWA 4Q19A 5JBIA 2DSNA 4UDNA 1A27A 1Z73A 4XD2A 3ZTTA 4DHEA 1Z4KA 1YA8A 4FE4A 3IPAA 5ICCA 3QVVA 1SEVA 3HH8A 3CN7A 4PO8A 4EBFA 2NU7A 1JPVA 2HK7A 3BDAA 1BE8A 1PGQA 4BHTA 1CUJA 1VIMA 4TZKA 4QLBA 1TQ6A 1LV8A 3T5CA 4YRZA 2FMKA 4KRXA 3UPUA 4QASA 5JVDA 3FVRA 2RB5A 3K6SA 3THXB 3AVVA 4GDMA 4Q00A 2XPCA 4Q02A 5CYGA 1NQAO 3W4JA 3S40A 2WFMA 3IUJA 3PEFA 4FI3F 5LMCA 3O38A 4HX9A 3FTPA 3QENA 4IUDS 1FMFA 3BQ9A 1LI5A 3I9JA 3S0JA 1HT0A 5B4TA 1Z47A 3L0OA 1GNSA 1G6OA 5ECGC 2QX6A 3H1PA 5J59A 4UHHA 2F43B 3VYSB 4S0XA 3L49A 1N3LA 2HCBA 1LPOA 3D2LA 4N5HX 1AHHA 3MFYA 3NGLA 4UTOA 1ZOLA 2RJOA 1LPMA 1CQWA 1SBQA 1DC3A 3CZQA 1SG0A 3H13A 5CT9A 3U62A 3HSKA 1C9DB 4Q6BA 4NNOA 4UUAA 4J76A 4RULA 2FMXA 2GCNA 2VC2B 2JPDA 2WWWA 4F4IA 5JALA 4XPIB 5T41A 1IDOA 1XCOA 2MJLA 4LSWA 1I7PA 1S3GA 3RF6A 1L5FA 3Q9UA 1M6HA 1W1UA 3VR1A 3GRPA 1CS4C 3VR6D 4CR7A 4JYAB 3U4CA 5TC4A 2DQYA 3AV0B 3ANTA 4MJ7A 4MP3A 2QENA 5A3VA 3BXEA 1EZ1A 3KUUA 4XDYA 2ZATA 4CG3A 1Z45A 3QVJA 3AO0B 3OM0A 1NOIA 2CC2A 2ZJAA 3LCRA 2W2KB 1U3DA 3SZGA 4DBZA 3EPJA 2C9DA 4IEIA 3GN1A 4BNHA 1C9EA 3HU2A 1YASA 3P9ZA 1BROA 4L2IA 1K08A 1OBCA 1ADBA 2NUPA 5TEVA 3LW8A 4TT8A 1VKNA 1OCEA 3KOUA 3OUZA 1GQOA 3H05A 4HZIA 4XOIA 4NHEA 2GZRA 3KO8A 1QGOA 2I7VA 3AHJA 4IOMA 5FTKA 5TB5A 4A3SA 1V48A 4BV9A 3H4MA 4D1YA 1PJ8A 3C8DA 4Q05A 1GZHB 4TQUS 4YASA 4GZLA 1YKFA 3HBMA 2G9VA 5H81A 2N1MA 2PRJA 1XQWA 5AOVA 4ZC8A 3WHLA 4AU1A 3H4TA 1PU2A 1RZVA 4HADA 4IQ4A 4OHOA 5I7OA 4B2YA 4FHDA 4I9FA 3V3KA 2HN9A 5LXTF 3PNOA 3TB4A 2IVZA 2MYPA 4BZZA 2O8FB 1YVDA 3G3EA 1HFWA 1KNQA 1T2NA 4TWBA 2JLQA 2ODQA 1CRPA 2WWFA 1Z8HA 4BNTA 4IXNA 2M2IA 2PD4A 1JDJA 3KJNA 4HSGA 3ZUPA 3W6OA 4DA4A 4ZYUA 1FDVA 1O5TA 3JWPA 4IJKA 1AGYA 4GD3Q 4ZDKA 2W2XA 1HE4A 4EY4A 5BN4A 3MOSA 1H1DA 3GZNB 1UP4A 3ILSA 4EI8A 1N2BA 1SWWA 1WOMA 4DUYB 5JFTA 2PUAA 4BC0A 3ZIDA 3EXHC 1L7EA 2BR5A 3L8EA 4H0CA 1YFLA 1BXRA 3AP1A 2P5YA 1JFFA 3O47A 2QL7A 4IHJA 1KS2A 1W2HA 2GZMA 3VYUB 3G5MA 1W2GA 1P6XA 5ANRB 3WA6A 4KMSA 4HGPA 2BKLA 1RAEA 2BBWA 1S2GA 3B1KA 3VPCA 3LNCA 1CZNA 3KKPA 3BF8A 5IAEA 3U3OA 4CQNA 1JHPA 4F12A 3G88A 3C2QA 3N87A 4D7AA 5JTTA 2JJ2D 1GUFA 2BSQA 2X0DA 4BGEA 4UASA 3MJRA 2VNIA 3HEAA 3JRXA 4XDHA 3TEJA 3ZE9A 5ADWA 2F3SA 2A5LA 4MVJF 3FDZB 4OI4A 4DLXA 1MQ9A 1K6IA 2H54A 4JIMA 3WGZA 2A57A 2BEWB 3LUHA 4EG4A 3LT4A 1Q19A 3PQ5A 4B7XA 1I24A 1KMMA 1R00A 2C83A 4NP6A 5EKTA 2H3HA 2H1FA 3DW1X 5BV2P 3JVUA 3OCUA 1MGOA 3L7NA 5I5EA 1AGRA 3NBZC 4LJ5A 1TVCA 4Q4LA 4BUZA 4GDFA 5EWJB 4JGIA 1PR5A 4XSVA 2DWCA 2XT9A 1Z4QA 4JP1A 3ZDDA 2GR8A 1Q1BA 2VYVA 3KJXA 4J1SA 3UM9A 1J8FA 3CEPB 1VLVA 3BULA 5ALEA 3LIPA 1K3UB 3AG5A 2QVBA 1BHQ1 1XFAA 2KSQA 2FSSA 5A1TA 5CX4A 2OHOA 1BS2A 3O4JA 3Q8XB 4BQSA 4CU2A 1B73A 3A6FA 3H5WA 4RIFA 3CKKA 3QPBA 4IRXA 4ALMA 5K4GA 4DKJA 3A7EA 4AL4A 2MSEB 4IGAA 2IA5A 1SHJA 3ITKA 3IR6A 4XGNA 3P9XA 1VMEA 2JFPA 4XQ9A 4H77A 1ND5A 1ZD8A 3QVOA 3H18A 1DRWA 2I8AA 4F5DA 4Z8XA 1ZXBA 3I61A 1Y5NA 1FVHA 4ZKEA 4P3OA 3GLGE 1ZW6A 4ND5A 4C2TA 3KKNA 3ETLA 4EBBA 2X3YA 3NAQA 2C95A 4EY5A 4EYQA 2ZRGA 1H8HD 5TS3A 3VZCA 2E21A 4D79A 3E5NA 3KBBA 3A06A 2E3JA 3WMRA 2ACWA 1UBMS 2ZE6A 2DZDA 2ZTSA 5IEBA 4C4OA 4CF7A 4X8OA 3ER9A 1IEXA 1EFVB 3MAAC 3K0FB 3NM6B 2OCXA 2X2EA 5JCXA 3RVNA 4MR7B 4ZJPA 4AWXA 2XUDA 4TKVB 3NYIA 4PAOA 4BVGA 2QSYA 4U5XA 3BE5A 2JLWA 1YH3A 1P61B 3ND8A 2QZ4A 3QLEA 3QXCA 5HEKA 1M34A 1R18A 2BW0A 3KKMA 4KGXA 3WL7A 1BWSA 1ZD9A 2D2IA 1FOEB 1O3YA 2QF7A 3DBHA 3NNSA 1MOPA 2CNKA 4GPTA 4L5JA 4RVSA 4CODB 3ERCA 4HQ0A 3R3HA 4BRUA 4F11A 3R9XB 2NTVA 3PWZA 1TA4A 4CCYA 5DCYA 3JR7A 3EJWA 2WPDD 3TR5A 2ODTX 3L4BC 3BZWA 2EZ4A 1RNLA 1ZN8A 3CNEA 3ZBTA 4F8YA 2A94A 4M46A 1XMPA 4E2ZA 2HCFA <