3IOCA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.50 ang resolution in complex with 5'-deoxy-5'-(benzyldisulfanyl)-adenosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
273
Chain Sequence
b'PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 86
structure length 273
sequence length 285
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iocA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iocA01
1QU3A 5TEWA 4MWCA 1JIKA 1K92A 1CT9A 1OWLA 1YIDA 4JZYA 2E21A 3GUZA 4MW4A 3C8ZA 4EG7A 1NUSA 2HMAA 1B6TA 3IODA 3MMXA 1K4MA 1H3NA 1T6YA 4XFDA 4MUKA 3SEQA 3NBKA 3IOEA 2D13A 3COWA 1JEEA 1KQPA 1M8JA 2C5SA 2CSXA 3RHSA 2E18A 3CLSD 2QUJA 1JECA 5LLTA 4HJXA 1WXFA 4MW5A 4NATA 5HG0A 3AKZA 2ZP1A 3RK0A 3CLTD 1O96B 2V0CA 3Q4GA 1KR2A 2RD2A 2AZXA 1O96A 3L92A 5K0TA 1IH8A 1J1ZA 4KR9A 2ZUEA 1SURA 3CLSC 2EJCA 1MOPA 4MUGA 3P0JA 1Y42X 1KQOA 1G8HA 4MW0A 4ZCQA 3CLTC 4R0NA 4HJRA 3NBAA 3ZIUA 1T6ZA 3BL5A 1EFPB 4EG3A 2QJTA 5KCMA 2JA2A 1VLHA 3IVCA 2VTBB 1EFPA 1YUNA 4G6ZA 1IHOA 2VTBA 3U1VA 1KKUA 1TFUA 1F4LA 3TZLA 4PBSA 4HK4A 5J58A 3TZEA 1N2JA 1N1DA 1PG2A 3KT6A 4ARCA 4CT0A 2H2AA 1OWNA 1MBZA 1WXEA 4WSOA 1ILEA 1OD6A 4KPUA 2HGZA 1I6LA 4L2IA 4R2LA 4NAUA 3ND7A 2A4MA 3ZJUA 3QTBA 3ND6A 1MB2A 2H29A 1X6VA 3A4IA 3K32A 1HYBA 3GLVA 2QJOA 4ZT2A 1GTSA 1TYAE 1M8FA 1T6XA 1ULHA 2PXHA 3SZGA 1XNGA 4G5FA 2J4DA 1EUQA 1WQ3A 2VXOA 1MAUA 4P2BA 1N3LA 4R2MA 3HGMA 1OBCA 4EF6A 4ZCSA 3RFFA 1J21A 1D2RA 5TGTA 2X3FA 3Q10A 1O97D 5DEOA 4MLPA 2WQ7A 4AQ7A 2CV2A 1KP2A 2CYAA 1JIJA 1VBKA 1N2HA 1ZH6A 4JXXA 1GTRA 4MUHA 1P7PA 2XRZA 1EFVB 1YIAA 4F4HA 1UFVA 1JZSA 2QTNA 1IVSA 3H05A 1EXDA 3IMGA 4RPIA 1O97C 3PNVA 2GKSA 1WY5A 5FNZA 3L93A 1J70A 4MUFA 4HPWA 1JILA 4AS1A 3AFHA 1OWPA 3IOCA 3PNBA 3G59A 1KQNA 1MC1A 3FWKA 2YWCA 1I6KA 4CDMA 2TS1A 4ZCTA 4WNYA 4X0EA 4DE5A 2D5BA 2PZAA 4I6GA 3CLRD 5H7XA 3UMVA 4DJAA 2RE8A 2QUIA 2QUHA 1VBNA 4QREA 3ZJVA 2A88A 1N2IA 4I6EA 1IQUA 2GOYA 4ND7A 2DXIA 4K03A 1NUUA 1ZUNA 3CVYA 2V0GA 3FDXA 4GRIA 4H3SA 3KT0A 4ZT3A 5H16A 1WZ2A 4MVWA 5LM3A 4CDNA 3CLRC 2CV1A 2JAXA 2B7LA 1V8FA 4MVXA 3A04A 3HZRA 1GPMA 4NX2A 2NSYA 3H99A 2IJGX 1H1TA 2IP1A 1JGTA 3FH0A 4NAHA 1O0BA 1BS2A 2DUMA 1RQGA 2QJFA 2ZUFA 4MQ6A 3SYTA 1I6MA 4MW9A 2OV4A 4F3RA 1M8KA 3PRHA 4DDMA 4A91A 1VBMA 2E0IA 1YULA 4ZT4A 5EKDA 1IFXA 2YWBA 3TQOA 4EGAA 1LI5A 1N2EA 3X1MA 3SZ3A 5F23A 4KR7A 4XSVA 4OUDB 1N78A 1KH2A 1O6BA 1G8FA 4OUDA 4I6JA 2HZ7A 3ZXIA 1MAWA 1M1ZA 3X1JA 3FHJA 1YI8A 3CLUD 4MW6A 3UOWA 3DO8A 4ND6A 1EUYA 1VL2A 1QRSA 1KAQA 2XRYA 5IHXA 3DV2A 4KPUB 4RUKA 2DPLA 4L2IB 4DLPA 2J07A 1XNJA 3NV7A 3RK1A 3CLUC 1PFYA 3DPIA 3MLAA 5TS2A 3IH5A 1H3EA 2Z3VA 2PIDA 4MW7A 1XJQA 2EL7A 5LFAA 4DNXA 4CQNA 1NUQA 1M8PA 3I05A 3A2KA 4U8HA 3VU8A 2CT8A 5DK4A 1O95D 3ILVA 3G5AA 4ZCPA 5J5AA 2PG3A 4YP6A 1IQ0A 4EG6A 3KFLA 1ZJWA 3COYA 1JHDA 4EG1A 2CUZA 2R5WA 4QRDA 3AG5A 3TQIA 3FETA 5HUHA 3HL4A 4QBTA 3IUBA 5FO1A 4JYZA 1GZUA 4EG4A 1KH1A 5JBNA 1O95C 1LI7A 3HFJA 3LOQA 3FG9A 3GMIA 1K4KA 3OP1A 2CYBA 4TS1A 2A84A 2J5BA 4MUIA 2JANA 1M83A 4MWBA 3ZGZA 1A8HA 2DETA 4EG8A 1PFWA 2PFSA 1K97A 3SDBA 1I2DA 3LE8A 1U3CA 5J59A 1QRTA 4MAFA 1COZA 1QJCA 4U7JA 2CYCA 2D54A 1F7UA 3HV0A 2J08A 2CV0A 4EFKA 3RJZA 3SP1A 1IRXA 3AIIA 1F9AA 1O5TA 3ELBA 5TEVA 2A1UB 3MXTA 4J76A 1LW7A 4K0RA 4YBRA 2A1UA 4KR6A 5DASA 2YY5A 1TYDE 1NURA 1TYBE 4GU5A 4UZEA 1DNPA 3M5WA 1TQ8A 3ZXSA 4BWVA 4E1AA 1U0BB 2Z09A 3D6VA 4NZPA 4YMIA 2WB2A 1F7VA 1GLNA 2NZ2A 4EG5A 3FOCA 4MULA 3ZJTA 1EJ2A 2J09A 4U63A 4DDKA 2G36A 2PZBA 2QTMA 1JEDA 1G59A 1H3FA 3IVGA 5K0SA 3HMQA 4FZJA 2IELA 4ZT7A 3ZUGA 2PZ8A 4JXZA 3LCJA 1QQTA 1WXHA 3Q12A 1GN8A 3X1KA 1JMVA 5AHWA 3UC5A 1MJHA 3FY4A 2AKEA 2X1LA 2A1TS 3K9WA 4MW1A 1KAMA 1T9GR 3FI0A 2A7XA 4J75A 3KT8A 2E89A 4Q93A 1TEZA 5FO0A 1WJGA 2WQ6A 1OWMA 1MRZA 3MUEA 2O8VA 4OJMX 3TNJA 3CVXA 3H9CA 2BYTA 2I1LA 3CR8A 3H97A 1KH3A 1PFUA 3KT3A 1QNFA 2GM3A 1R6XA 2OQ2A 4XFJA 1WXGA 3N9IA 3INNA 3P0HA 4PBRA 4PY2A 1R6UA 1JIIA 3G6KA 2Z08A 4MUEA 5KWVA 3ISJA 1QRUA 1QTQA 1N2GA 1NUTA 1OBHA 3IMEA 3QE4A 2BTEA 1NSYA 3PNYA 1S4MA 3VGJA 2X0KA 5KHAA 1N75A 4MUNA 4ZCRA 1JZQA 4YP5A 3TS1A 4YP7A 1J09A 1EE1A 3IUEA 2X1MA 3FNRA 1O94D 1WKBA 3FIUA 4MWEA 3CVVA 1G8GA 3QTTA 1KORA 5BNZA 1O0CA 1FFYA 4MUJA 1WQ4A 2DLCX 1OWOA 1N77A 1J20A 1KP3A 4ZT6A 1U3DA 1TYCA 4JFAA 1O94C 2A1TR 4MVYA 1IQRA 1U7DA 3PXUA 1NP7A 1WOYA 3P52A 3IMCA 3UY4A 4MVCA 1M8GA 1NZJA 1NYLA 2A86A 1T9GS 4DDHA 3N2YA 3OTWA 3S3TA 4PBTA 3JXEA 4MW2A 4NDAA 3UK2A 3RBAA 1R6TA 2CFOA 5IJXA 1Q77A 4KKVA 3AL0C 3MLBA 3IVXA 1GAXA 3SEZA 4UZFA 1WXIA 3P0IA 1MB9A 3A05A 2DEUA 2DR2A 1J1UA 3IOBA 3D6UA 4Q16A 1N2BA 1YUMA 1PG0A 3CVUA 1Q15A 5HUJA 4S1OA 1ZH0A 4MWDA 3CA8A 1NI5A 1X8XA 2DERA 2QTRA 2WSIA 3VRHA 1FYDA 1V47A 3IDFA 3ND5A 1EFVA 1U7XA 1XNHA 3N8HA 4ZT5A 5DB4A 2QUKA 2O5RA 1QU2A 3H9BA 3CVWA 1NUPA 3F3MA 4ARIA 2AG6A 3COVA 3DLAA 3N05A 3E27A 1Q19A 1PFVA 2YXNA 1N2OA 4G5YA 3AG6A 3COZA 1Q11A
chains in the Genus database with same CATH superfamily
4PRZA 3CWZA 4H4CA 3WV4A 3UAZA 4IFIA 4OXNA 2A53A 3CX8A 4YJHB 4ERNA 5C7IO 5JDIA 1VBFA 1T3TA 5F2KA 3PPYA 3ZEIA 3F8SA 2W6MA 3ONDA 4EG7A 2HMVA 1UWKA 2X4LA 1CEEA 3LP5A 4LZJA 3GOHA 4RPHA 3B53X 1RYBA 3ZLJA 3LH5A 3R7AA 2VJOA 3F3SA 1HLPA 3COWA 3ORFA 1K6JA 1YNSA 3CBGA 1E4OA 1E66A 3M6MD 1XTJA 3AEKA 3RVSA 5AKYA 2GK6A 3UUFA 3GG2A 1U0EA 1HM5A 1L7VC 2RHRA 1GGKA 3IA7A 4NENA 5CLGA 3U4DA 4PQGA 1SEPA 4BP8A 1XCGB 5JW6A 3OT1B 3HG7A 3T7RA 1EESA 5DWVA 2V0CA 2AZMA 3K5HA 1Z13A 3GRFA 4MDHA 1E62A 2O2XA 2TMKA 4HDKB 5BQ5A 2REQB 5C52B 2AZXA 1SM4A 2JC3A 2WFZA 3IAHA 2XXAB 3DDWA 3LRXA 1LX6A 1BHQ1 3FSEA 2ZIWB 2NTYC 2JLCA 2GD2A 3OWHA 4X7RA 3FUTA 2YN2A 2JPDA 1EUCA 4YQEA 1ZM9A 4WACA 4D57A 3DBIA 1WZIA 3F2VA 3LD9A 4UJ5A 4MIOA 1GQOA 1ORTA 4QTTB 5FBKA 3UAOA 4EAAA 2BGJA 1NR7A 2G5ZA 2VUTA 4I08A 3KD3A 2ZT8A 3E15A 1BE6A 5DSTA 2WJHA 2FMTA 5EXCA 2JA2A 3QMWA 1Q7CA 4O3MA 2V7GA 3JR7A 4D81A 4WT7A 4TYPA 3THRA 1NJGA 2ZETA 3DZKA 3MINA 4FEEA 5FWYB 8MHTA 4QATA 3AIOA 5J2UA 2CW5A 1JFFA 2B8NA 3K09A 2ZPAA 1WB4A 4XYBA 2C4NA 3JVDA 1N2JA 4RFVA 1T4BA 3KT6A 3WL8A 1ISGA 2J9XB 3NT4A 3I8XA 2O2YA 3KAQA 1MP0A 4N6NA 1SBQA 4JA2A 4FMCB 3R1IA 3T3EA 5BSEA 4GM4A 1U28C 1R6VA 2C7GA 3I39X 4Q9KA 4MMXB 4R84A 3TGLA 3HM9A 1XAGA 3ND7A 1EHYA 1QAMA 3OY7A 4U2CA 4CKBB 5BW0B 2HJ9A 1C8KA 3QELA 3KWLA 2ZJ0A 4K9NA 1MB2A 5D3ZA 5F1PA 1VG0B 1YZ3A 4XDHA 4Y2TA 5AM2A 1GDTA 1P62B 2ONCA 1XA4A 3WY9A 1FU7A 1M2JA 1M75A 2RHHA 2VRNA 2GGSA 2OAGA 1U0SY 3HDTA 4DM3A 2OFOA 3TLGA 3TRKA 1XNRB 2C99A 1IONA 1ZAKA 4CM3A 3NVAA 3Q5EA 2XECA 2VNSA 3HCDA 2FPIB 2QJWA 1LD3A 1Q7RA 4I50B 4EWLA 1GGEA 1PV1A 3KOUA 4R2MA 5TJ9A 1XXLA 3AEUA 1RZUA 4BNDA 3RK4A 3D3QA 1J9ZA 3S2GA 3KJZA 3SXUA 3WNVA 2OSVA 3RC2A 5JEDA 5KAMA 3PXEA 3K72B 4D5EA 1OAAA 5KMGB 2PRZA 3FAKA 2ZIUB 4F2GA 4YQFA 3QPBA 6ABPA 3ED5A 4RZQA 4NKRA 2FMKA 2Q07A 4D8YA 5BY2A 4ESEA 1NMYA 2HM7A 2ZUCA 3RVKA 1AIPA 1V7PC 1YZFA 2LCIA 3ED1A 3A1TA 3MGKA 1SHUX 3OSUA 2G63A 3SSNA 1KC1A 2WWTA 3K96A 5IX8A 1RADA 2Q6IA 2FX2A 5TMBA 3VV3A 3R3JA 3VYRB 5K8CA 2AYYA 2WG0A 3A0RB 3CUTA 5CFMA 1J70A 2FOXA 3NEPX 3K1ZA 5FD8A 1YQWA 4RVSA 2AFRA 3HJUA 4X00A 3DFUA 5EIBC 1MMFB 4NS4A 1FSPA 3IDQA 3Q6NA 3O4RA 4FMPA 5F5XA 3CZMA 3GGDA 4B9EA 4F96A 2NTJA 5AXBA 2QMYA 5KC8A 4N3AA 3Q0TA 2BEUA 2FPSA 2VOJA 3B2NA 4LJ9A 4QX6A 2PZAA 3NQ41 4I6GA 4F71A 3EUWA 3G2IA 3VR4A 3VPBA 3ZK7A 3PITA 3OOSA 2W83A 3EOZA 1I94B 3SBXA 2RBEA 1NBME 3EB9A 1W85B 3QVVA 3G0GA 4JGGA 2DXIA 1RHMA 2BHRA 5CA0B 2PH1A 5DTJA 2BSQA 1AKTA 2PQ6A 5G2OA 2A56A 5EG5A 1EQ2A 2OXCA 2PMWB 4AJHA 2G09A 4E4RA 4R0VA 1R4NA 2WZQA 3RC8A 5JD6A 2NP7A 1V11A 3OU7A 5IEJA 1X1EA 1X3SA 3DTYA 5IFKA 1V8FA 1WCWA 4MVXA 5C5EA 1FYWA 4M1ZA 4NOLA 3ROZA 4NPAA 1U4NA 2NSYA 1G5IA 2Z5LA 3O4IA 4GYKA 4MJLA 3KZNA 2AQHA 2Q1YA 4QARA 3GHHA 5INTA 3ODPA 4IDCA 1Q22A 2A33A 4M8NE 2FQYA 3T94A 4XWAA 3HQ4O 4DG5A 1EVLA 4M0KA 3GLKA 3QWAA 2OHGA 4QGGA 2OV4A 1WMBA 4GI1A 1PSWA 1EE2A 1HEIA 3L4BC 1M34E 1TYEB 1F06A 4PSVA 3ZG6A 2Q8NA 4EPXA 1E2BA 4EA7A 1VA5A 5C8YA 5JC8A 5EIEA 2Z30A 3TQOA 2OKCA 2VN8A 4L4YA 3OJLA 1EYZA 4Q9NA 3BTSA 2FQXA 1NBWB 4HDCA 1IB0A 2FWRA 1J2UA 1TTHA 4Q3AA 3DDCA 3OLVA 3SN6A 2E7ZA 2O0HA 3LNCA 3C3EA 3FDJA 4RZ2A 1T2UA 1Y8RB 2OL4A 3RFUA 2JLWA 4CETA 2VDUE 4WXHA 3ZCPA 3LQ1A 1F2UA 3CCCA 5DW3A 1RQNA 3F4BA 4MLDA 5FPTA 3AVXA 1NL3A 3R0ZA 4NR0A 2HREA 3CLUD 3K8YA 4KZPA 4XOUA 2W2QA 3ZK9A 3R7BA 4G86A 3GLRA 2P9CA 2RDMA 3KUUA 4JB8A 1G5RA 3LLSA 1EUYA 3DZCA 1NNSA 4D4KA 2O8FB 1TKBA 2O57A 1PNVA 2QY9A 2EW1A 1ENZA 5T57A 1J0DA 1K7FB 1PGPA 2FRVA 2OD7A 3EGEA 4CF5A 2AMFA 1B14A 1F6BA 5ALXA 3FZEA 4NJEB 2WMOB 3GO4A 3MLAA 3BGOS 4MYDA 2W70A 4W8GA 1KJYA 1YZHA 3GVIA 3K16A 3NW9A 4MW7A 4Y6LA 4K6GA 4Z8YA 3W5HA 5LPNA 4MSUA 4YVFA 2QUBA 2E3JA 2GTPA 3K9BA 4UU1A 3ZX5A 4U8HA 1RQ7A 1OAKA 2ZI4A 3VU8A 3EX7C 4D3FA 2WUEA 1KXZA 5F5NA 2X5KO 1IPHA 2WIJA 3EAFA 1XQ1A 5BN3A 2V7PA 4WD3A 4FONA 1UIMA 1PIWA 2IUFA 2ZJ5A 3T54A 3L8CA 1CEYA 4MS4A 2A67A 3UMBA 2X7HA 4OAPA 1XTBA 3QVUA 3BMXA 5BYKA 1IWPB 1EEXB 4Q6WA 4JI5B 4O1HA 4ZV9A 1Y5NA 1ECBA 3TCXB 5I48A 1KH1A 1Y4UA 1NUHA 3ZWWA 2XE8A 1ICIA 5ALLA 3UATA 3R3WA 1CQWA 4FBLA 5A5VA 1ANKA 2NO9A 2DM6A 2OHXA 3ESQA 2D6FA 2AX3A 3OP1A 3ZH2A 2FVYA 2HA6A 2Y1EA 4W9NA 2GB4A 5AJTA 1FMLA 3H11A 4O0LA 3HO1A 4MWBA 4K9RA 3IDZA 3PQ7A 4BO1A 4RZXA 2ZE7A 4BGDA 2FPUA 2YXLA 3V7WA 1APBA 2PFSA 3CZCA 1JHXA 2BTQA 4GX1A 4F4JA 4QQKA 5E3HA 3O9MA 5ALDA 3GU3A 3NBZC 4M8IA 1F7UA 3O3MB 4PO3X 4XGIA 1UZAA 3ZDYB 4DQKA 5KPJA 4QICA 1TB4A 1OZGA 1QFXA 1HFEL 1N9KA 4EFKA 2Q5QA 2HHCA 3JARA 4H08A 3I9FA 4G0UA 1CUIA 1CR2A 4V02A 2HDWA 2VO1A 2JHAA 1CTQA 1OLUA 2IYFA 2V59A 1BFUA 3I45A 3KYIB 4JVNA 4LMPA 5CNKA 1V71A 2WYWA 4UFOA 4WASA 1HEUA 1LW7A 3DFKA 5THXA 4MWZA 2EGHA 4J1QA 2A1UA 2AK3A 2Z83A 2YY5A 3LWZA 1XMJA 1QLWA 1SEVA 1I5RA 4P92A 4KHZA 5DM2A 1Z6QA 3LV8A 1UK6A 3HCEA 1FX0A 1DG3A 1MKYA 2AB0A 2IZ0A 4GU5A 4E1AA 2A52A 2JFWA 3DAGA 5FT9A 5CCEA 1A9QA 1XNQB 4Q02A 1G55A 5IAOA 2JCGA 1QB7A 4BWFB 3K71B 4YI5A 3SOPA 4EP1A 2YFKA 4QXAA 5JNLA 3RB8A 3VTKA 4C3OB 2PWAA 2YOHA 3T4PA 5D3KA 4CLDA 2QSJA 2OHFA 2PT5A 4UQOA 5HA5A 5T5QA 1NJ2A 4XTCS 1ZK0A 3RUEA 3R74A 4AZWA 4CMKA 3IVAA 3WISA 5K6TA 1RC1A 1TAHA 2IPAB 3LWDA 4MWGA 4ACAA 2O8CA 4DIOA 5A0VA 1NDHA 4HQ6A 4ZOLA 2MSNA 3BULA 3HMQA 2GHQA 3PD7A 5E0OA 2PFKA 3ML1A 1XPRA 3ZWOA 1PVOA 4L4SA 5AJWA 3C41J 4OYHA 5DXJA 3JQCA 4TV9F 4RNCA 5KI6A 3FPCA 1A2QA 2IKQA 4WESB 1VL5A 4J0EA 5AESA 1AMOA 2PUCA 1GN8A 3IELA 1R50A 1UMDA 1CD5A 4BFYA 4ZVRA 1QJ4A 3W04A 1C8LA 1QGYA 1G2OA 1NT4A 4L9RA 5EZYA 1VL8A 3PUJA 4OOEA 3V9AA 4TWBA 1LPNA 2XA1A 3GLFE 1RXVA 5CJJA 1E7RA 1SKMA 4A23A 1Z6ZA 5H8WA 5TQVA 3SC2B 2PBLA 5IBPA 4PSCA 5TPZA 1PTJC 4O4LA 3SKXA 1K5HA 2CBZA 2GARA 5K8TA 3PXXA 1ECPA 2BRUA 4FR5A 2IEGA 3PGJA 2XCOA 3B8HA 3MPUA 3QTLA 5FKJA 3AOGA 2ZUVA 3UJ3X 5HOQA 1XDZA 3B78A 2A5YB 2I1LA 1D2CA 4UD2A 2INGX 4EB6A 2H9AA 5HWSA 1RWPA 1OW3B 2J31A 1DIBA 3K4QA 4P58A 2OQ2A 4CIAA 1V7QA 3KFXA 2YTZA 2CLIB 3STTA 4D44A 3QPVA 4M76B 2I0FA 1T3LA 3OQMA 1VGVA 2QF7A 5EP3A 3EXHB 2HIMA 3UUEA 1FMCA 1VLQA 1YE3A 2CD7A 3PWZA 5T7BA 3GFPA 1OLOA 2OO7A 1B73A 3GPBA 4NOKA 3VNQA 3QX9A 3AQ4A 5C46F 3FTEA 3P9RA 4MUNA 4ZCRA 4YP7A 2VSOA 3G5TA 4C3ZA 1NJ5A 2BF7A 1J7JA 3KU1A 1UM8A 4U2FA 1GTMA 1IHDA 2EQ5A 3OKCA 3RU3A 3RS0A 1HZZA 3RIMA 1PWHA 4PWZA 3WWDA 1I9CA 4L6AA 2JIRA 4ZICA 3RYTC 1ZM4A 4UUPA 5LOVF 1G38A 3EIXA 3T4UA 4Q21A 5A6SB 4Y6SA 1Q3HA 5F12A 5FADA 3ZY3A 1V9SA 3T9FA 2D5AA 3Q2IA 1DUVG 1DTWA 2ZIAA 2XT9A 2QIOA 4OB6A 3T3IA 3HVRA 3H0KA 3PCTA 4H1TA 4I99A 5D01A 5BSRA 3VAYA 1HYQA 3H5AA 3AI3A 2J45A 3KEGA 1JEAA 5CITA 4OBBA 2QLMA 2PX3A 4AVYA 5HKKA 1J0CA 1X8JA 1NN1A 3KKOA 3JAWA 2PNJA 2MR5A 2VJYA 5EMHA 3E9DA 4EHLA 5AK5A 2FWMX 3TXYA 1FP7A 3VVCA 4EH1A 3GFOA 5KJCA 2ZT6A 3OHSX 3PKIA 4MW2A 3BL6A 3H9JA 1NPYA 5LP1A 2JFBA 4WUVA 1NRWA 2V5VA 1Y1SA 3PPXA 3ESBA 2IQIA 3QHQA 3FTNA 1TAGA 3IV6A 1FFXA 1NJSA 1SFRA 1XCOA 2CNKA 2D00A 2CVPA 3H5TA 4UPDA 4CWAA 2JIDA 3CT6A 1LS6A 1S2OA 3G7NA 2HA2A 4G24A 5AHXA 3MTQA 3SQDA 3GNSA 5TMEA 5TQJA 5HRAA 3IOBA 4DLBA 3WK8A 4AKSA 3VMFA 1M3SA 1NLFA 3A6KA 5BSWA 1RYZA 3U1TA 3CFHL 4EYOA 2J5QA 1V48A 3L40A 3LHIA 4HS4A 3C16C 4H1UA 1FQKA 4OHMA 5HIAA 1DP4A 1G0OA 5FUMA 1PCXA 3DLIA 3EBPA 4WKGA 2XF8A 5F9HA 1KDVA 4RV9A 4DC1A 2Y2VA 3IMKA 1QH8B 1H66A 1V1MA 4ZT5A 3WLAA 3L46A 3PR1A 1KFEB 4KACA 4CKEA 2A0XA 1LDMA 5KNDA 1OB5A 2HA7A 4X62B 3T9EA 3OLZA 1H9BA 3GAZA 3RYFA 4BATA 4QDTA 4OYRA 1IRIA 2IE0A 3DD1A 4HLQB 5FTNA 1XGKA 1E6EA 1GA1A 5DBOA 3SVLA 4MVJE 1S8FA 4OI4A 5K5EA 3OM8A 2ON6A 2Z57A 4E33A 2CFCA 4F86A 2O23A 3U3MA 1XTPA 2QVXX 1CT9A 4KSCA 2Z2XA 4E5UA 3M0EA 3PTZA 4O1MA 4N65A 5EYPA 4KXVA 3AVQA 4D3SA 3OE7D 2QLFA 4FE4A 3Q6MA 4ZXPA 5ED0A 3C43A 2QN9A 4GWKA 3UW1A 2WICA 1Z6TA 1BVHA 1KYQA 5J5VA 3HLYA 1G16A 2HA0A 4U39A 3CUWA 4EYGA 3BTUA 3UANA 4B3CA 2ERXA 2FZWA 1NFFA 1WHSA 4DBLC 1WZEA 1I0ZA 1HFJA 2BEJA 3S8MA 1RZRA 2NTEA 3MW8A 4KPFC 3DBHA 3AEKB 3JQBC 4JS0A 1UXHA 2ZVQX 4AQYB 1RR6A 1YT5A 2QAJA 1MB0A 4NENB 3T9BA 2ANCA 3VAZA 4PQYA 1JECA 1H5NA 3TBHA 4OIMA 3V2UA 5F7OA 4HJXA 3VMMA 2RJ3A 1MX5A 3G0IA 2JLVA 2G1UA 1TMKA 2JL1A 3KKPA 4GXQA 1KERA 5EJ9A 1CY0A 5KTYA 4X20B 1DPFA 2GNOA 1SRRA 2K7ZA 2XNDA 4QA9A 2HIHA 3EASA 4UVIA 4DC9A 3NOVA 2AD5A 3K70C 5ALQA 4EB0A 4O8CA 1ZJJA 3FNHA 2PUFA 1M5RA 2EJCA 4NOJA 1S2NA 1YR1A 2JI6A 4MUGA 3FYDA 1LPOA 3MOIA 3BMOA 3P0JA 1EUCB 4ZCLA 4QTZA 4BRWA 3EWNA 1FTYA 2FR8A 5FHRA 4ZYXA 4ZU6X 2JCSA 3SYKA 1Y9JA 2IYYA 1XWWA 3PC7A 1KJJA 4HFMA 1PR1A 3IVCA 3MINB 3G2MA 2OGUA 4WN9A 1WUYA 4FSXA 3V7NA 5J2UB 2ZRKA 4HUTA 5UKDA 4A0RA 3TG8A 3ZCUA 3RI3A 4DKJA 1NN0A 1U2ZA 1B0UA 2ZG6A 3MWDA 4NNPA 1QG0A 4RV5A 1BIFA 2DX7A 3HJCA 3BSYA 3IR6A 4WNCA 4ZDKA 2O6HA 4FN4A 2GR9A 2OBXA 4IM7A 3H65A 3ZHUA 4NU0A 4RJ2A 3WFZA 4JKOA 1FS4A 1MW8X 2RGNA 1QK4A 1A7AA 2Z04A 1FTNA 5F64A 2EU8A 3F73A 2HGZA 1PEAA 4M8KA 4E2XA 2BE9A 1N3YA 4L2IA 3D64A 1VFNA 4YRGA 4D4HA 2P4HX 4RIEA 4BV2A 3CURA 3QELB 3VDQA 1W2HA 3EQZA 4FYPA 2OXFA 1U04A 5CJPA 5FOUA 2B0CA 3FW1A 1V4NA 3GYBA 4E03A 4W63A 3N8GA 5IYZF 3K9CA 3OG9A 2TMYA 3TNYA 3C6BA 3HA3A 2OGTA 3RRNA 1O54A 3L0SA 4IWNA 4WXPA 2HYDA 4TSFA 3RSCA 3SF0A 3UWOA 4BWYA 3D6TB 1U9YA 4FILA 4UUNA 3AWIA 4H17A 1TW2A 3AEUB 4IQGA 4E7OA 1DELA 3DOJA 5AM4A 5AVXA 4MHTA 3IT2A 1UJ4A 2VT3A 3AF2A 1VYUA 1X7HA 1XCLA 3MCZA 4FZRA 4QWMA 4LDQA 3SXUB 3U3OA 3V8NA 4EHKA 1D2RA 2IU3A 4X61A 3UA3A 3FDFA 3WNBA 1D0IA 2K5UA 2VRCD 5CLLA 3V34A 1Q12A 4G5OA 4G07A 2CEAA 1SHKA 1PLKA 4TZTA 5H81A 2O52A 3KWFA 3PSHA 3ZTTA 2IECA 5GP1A 1HDOA 1W4RA 2DJ5A 3HSKA 1SR8A 2R7NA 1X1CA 3PFNA 4YCNA 2QTNA 4EA9A 1W75A 4G56A 3ZWMA 5CB4F 2L2QA 2QRMA 2P79A 4N54A 1ULZA 3R0QA 2QZPA 4R2KA 1RWVA 5JCOC 1T0UA 1XZKA 4J0JA 5GONA 1M74A 3O92A 4ATNA 2AR0A 1DFHA 2BBWA 1U81A 2R8RA 3DMGA 4GXNA 4MR9A 2B4AA 4PINA 1QX4A 4LA4A 4GE3A 3FNIA 3Q8LA 2OZVA 5ERYA 2WJYA 3E8XA 1KY5A 4C5AA 3RS7A 2XWJI 3UT0A 4PAMA 1UZMA 2Q21A 3AV3A 3ZDEA 1VQ1A 5FNVF 5IVKA 3NDJA 2BEUB 5LZ8A 4I9NA 1PNOA 4EUEA 1Y4AE 4WNYA 4QLOA 1EDBA 4QOJA 4N03A 4QQFA 5H7XA 3ULKA 3HB9A 1OSNA 1RTKA 2AR9A 4MKHA 4YCAA 4B4WA 1BWPA 3O38A 4KWCA 3GEGA 2AKYA 2QAGC 4E21A 4MCHA 2JGJA 3UCXA 1FTGA 1L6RA 2HFKA 4FQ5A 1KSGA 3NYIA 5IDXA 4BMCA 2RGUA 1ZSYA 3GELA 3LT0A 4IKOA 5LLSA 1QGZA 1A8QA 3CX7A 5AI9A 1FMJA 5L45A 1M6VB 4QG7A 2I34A 1EU1A 4LJKA 1IYZA 1R4NB 2R6R1 1MGOA 4Q18A 3OX4A 5C31A 1V11B 3CYFA 1H2BA 3QFRA 4A8PA 3ZGLA 4QPPA 1DXYA 2BMJA 4UTOA 1U28A 2ZWOA 1BX0A 4C21A 4CLXA 3ABOB 5LYYA 1WX1A 2AQ8A 2X6RA 1W0KA 3QU7A 5SZIA 3TG2A 1EWRA 3UKDA 3RS4A 5EL0A 4HMOA 3UO8B 3DV0A 3W3AD 4CEJA 2WAYA 1IUKA 4UM9D 1RBQA 2GRUA 1BOOA 3U7QA 2PEZA 3W5VA 1GPWB 4AIIA 1JSZA 3ZNOA 5TE9A 1AC5A 4HDOB 4HRYA 3WGKA 1U5AA 2I52A 3K0EA 4H77A 3L18A 2C5BA 2FSGA 1QAOA 3FM9A 3FI9A 3U61B 5KYKA 1NXQA 3E3NA 2QRGA 3CH5A 3KG2A 3IP1A 1DBVO 3EPRA 1NIPA 2C97A 4ZU3A 4M9ZA 5B1DA 4CT4B 5AW5A 5HXAA 2EOAA 2HPVA 3NNNA 4QE3A 5LU8A 2DU8A 4KTTE 3AETA 4OUDA 1Z15A 2EJVA 1OAOC 5EE1A 2FJPA 3SQOA 2GCPA 4UTRA 1QP7A 4JBHA 4EAQA 4C1NA 4TV8F 4XB1A 3SE0A 2R66A 1DZIA 3QUSA 5AJVB 5KDLA 1U0LA 2HT6A 2DR3A 5CGQB 4ZDWA 3E7WA 3R0XA 4JYBA 5FPKA 1R4MA 1LV8A 2DFTA 3QNUA 2FFQA 1XLTC 2IQ5A 3RSOA 3ZQUA 4Q4JA 2WP8J 3MC1A 3KB8A 2G72A 3RCBA 3GGCA 1XJ0A 1KO7A 1OY1A 4OBXA 3HU3A 3SQXA 3J7AC 1TECE 4C2AA 2IF0A 2NXNA 3RSGA 2QX7A 1VRVA 3G23A 4RJIA 4P3NA 4URUR 4OUKX 5TS2A 2YOFA 3DMPA 4UQLA 4IVQA 4RZSA 5LFAA 3A36A 2YBEA 3R0IA 5FOVA 4N3CA 5BR4A 2HZBA 3QKSA 1RYNA 1E89A 4EG6A 1PFGA 1G5HA 4MS4B 1MXHA 2OK8A 2BAGA 1BX3A 2I7VA 1ULUA 1LGYA 1MPTA 4QRDA 5JISA 2FW9A 5CM2Z 4D8WA 3CBQA 3KU4A 2XVZA 2Q62A 4TXNA 4R7TA 3L7CA 4IZ6A 4LYAA 2J67A 4DWVA 2PMDA 2WDZA 2ZTLA 3PIDA 2C7PA 1P33A 3GCXA 3D8HA 4L9SA 5KUTA 2VNKA 4FCVA 2W6ID 1B6GA 1NAIA 2JW5A 3NWBA 3QYAA 4ND3A 3GMIA 4DCOA 1Z74A 3N0XA 3H11B 3PGA1 2HA4A 1KZ4A 5F21A 2C1ZA 3MT8A 1E3TA 1E2EA 1UP6A 2BTQB 1X7YA 3IT3A 3N2IA 4GW3A 5JIBA 4AO6A 2P90A 2BISA 3B38A 2YC2C 3EQ6A 3IJEB 3L4BA 5IDQA 4KO2S 3OT5A 4YQYA 1BN7A 3AUYA 5E0KB 4RTOA 1GKUB 2R7LA 4OO3A 4PSDA 2I4LA 1KDTA 2GQ0A 3FB1A 3VNVA 2CL5A 3C3WA 3H5RA 1MAAA 1DV1A 3L7LA 1OLUB 3N0TA 4X8MA 4PC1A 4F7DA 1PJQA 3U7GA 4YUXA 1KYYA 1OX5A 1VYHA 1YWGO 1QG2A 1RMTA 3BXFA 3KXLA 1E58A 2Q9AA 2A1UB 2ZROA 4JXJA 5TEVA 4BU1A 4BZWA 4DPMA 4M98A 5K3AA 2CSUA 3OTOB 3VPGA 1RYDA 3CSUA 1FX0B 4D8TA 3I12A 1ESMA 1KEVA 1XG5A 2V8OA 1QP8A 4IP0A 4HR7A 5GGXA 1YRYE 3SF8A 3WB2A 2IYNA 5BWLA 3CSSA 4LBWA 3UT5B 2NNWB 4F93B 5TRTA 4EL0A 4JEMA 3HXMA 4YC7A 1KFBB 2CXTA 4Q00A 4NZPA 2WB2A 1L8QA 1TO1E 4J9VA 1XZAA 1RI2A 2OBBA 3GEEA 3ZH9B 2VWGA 1JMKC 3T38A 3NP9A 1KJ9A 3M89A 4HMQA 3M4NA 1NIJA 3KETA 2Q5HA 4AI6A 4X95A 3UKJA 3I0NA 3GH1A 5JI3E 3RC3A 1KYWA 1TIKA 2PAFA 2O8CB 3F5FA 4JCCA 2B2CA 2SKCA 2XB6A 3VNRA 1LH0A 1ZNXA 4ZOLB 2YV4A 3IVGA 2B3DA 2WTMA 4HX9A 3AKCA 4M83A 3VH1A 5DN6D 3UH0A 3GDWA 1A9TA 4FZJA 3IJPA 4HL6A 1NXXA 3PDJA 2AW3A 4UCWA 4CR8A 4ZEXA 4Q47A 1QQTA 4WIAA 4YRSA 1PGJA 1WXHA 1UMDB 3BRSA 3DM9B 3KKMA 4OLAA 5MFZA 2R9VA 3H5LA 2IEBA 4C6TB 3GBPA 4DCGA 3NHZA 1Y1QA 5DYIA 4BLTA 4BDSA 2HQSA 5LYJA 1KKLA 1RRFA 1W5FA 3I83A 4Q93A 1PUXA 4JI0B 3JQDA 4PYQA 1DLJA 1SGWA 4D5GA 4GKKB 3ESXA 2J9FA 3P5SA 1U7OA 2RC6A 1T8RA 5DLQC 2WQ6A 1KJWA 3F8TA 4RF3A 5CTJA 4DCCA 4EHNA 4CGZA 2OB2A 2G40A 2WT4A 4FI3F 3O8DA 4FFVA 4P33A 3RASA 4Z7NB 4I2NA 3VDXA 2XMRA 1WETA 1P5FA 2G1PA 1EWQA 3BUSA 3RU2A 1IWOA 1T2VA 1LZKA 5JECA 3Q9UA 4GI7A 5D85A 5ETJA 4CMGA 1QGUB 1FY2A 3IC5A 1Q20A 1VTKA 3GJXC 5IZCA 1OR8A 2QKYA 1Z08A 1JNXX 1RRMA 3HN2A 1OLXA 1RQLA 1PI3A 3HABA 3I28A 4OQLA 1M33A 3LX8A 1DOHA 3B2QA 3DKIA 4M22A 4BMZA 1WMDA 4P3XA 4EUFA 1OBHA 1MUUA 5LXTB 3HBNA 2XVAA 2A78A 2G8LA 4I5GA 1ITZA 1YJAA 4N12A 1YGYA 3ZV7A 1UKZA 3RIXA 5A7FA 1GCUA 4YDQA 1N75A 5K0LA 1ZUHA 2O3UA 3QUQA 3UAXA 4B3BA 3JATA 5FLKA 4PSAA 3H2HA 1MIOA 1W9MA 4NABA 4L6CA 3S0JA 3UJHA 3BFVA 4O4HA 5AM1A 4DWWA 2IHTA 4AZSA 4CMAA 5I9NA 3D8RA 3VNSA 3L7JA 4DUPA 3RDPA 3GY0A 5B2FA 3U5TA 1KORA 3QPWA 4MVJF 4PYRA 4MUJA 1WQ4A 2YINC 4DY6A 1MQAA 5CHEA 3OQOA 3P2IA 3OH8A 4LVCA 5BSVA 1GT6A 1KP3A 2ECFA 3U19A 1E0KA 1A5SB 1Q1BA 1DTWB 4DABA 2J3EA 3QPDA 1CZRA 1PNTA 2Q1XA 3C97A 4IUBS 5GGYA 3IUYA 4JI6B 2HNKA 3GNLA 1CRPA 1WOYA 3STHA 2EKDA 3JAWB 3LY5A 1SRQA 3M9WA 3P4YA 1TZBA 2DUWA 4J0IA 1GZ3A 1EA7A 1QR6A 4O02B 5FHQA 4PBTA 5GV7A 5J4HA 3JXEA 5TVGA 4MKGA 4R40A 2XIQA 5ENDA 3A9SA 4BCCA 1J24A 1FFXB 3CNEA 2HJWA 1R6TA 4ZAGA 2ZOSA 3PXAA 4KVGA 3ZWAA 4BU0A 2IVFA 2GO7A 1M1NA 3D6UA 1KHHA 1PTJA 3TRHA 1YUMA 2PS1A 1SVNA 3MS7A 1NLZA 4XLZA 2DULA 5T6BA 4CL8A 4I4LA 1W8IA 4MKFA 3R24A 5LD2B 1ZH0A 4EO9A 2RCNA 1Q1ZA 1EH5A 1FF9A 1G6Q1 1H2XA 2Q2QA 2SICE 3MS4A 3OZRA 1SWVA 3PHBE 4IIGA 4MQBA 5TXGA 4AJ4A 4DQUA 1K2WA 4UBKA 3OJWA 4AX8A 1N33B 2NYUA 1RPNA 1V1MB 1UP7A 2D0DA 2OBFA 1ZPDA 4CKEB 3K05A 3G9ZA 5E9JA 2GBGA 4P7GA 4UNQA 4R69A 4UCQA 3BWYA 5IK2D 2R8ZA 1QF7A 1U2RA 3OHMA 3RYFB 3SM3A 2C59A 3DKPA 4PTYA 4XE5A 1SK9A 2IA5A 3SY8A 1WPXA 1DWQA 3HU2A 1DQRA 3GP8A 1I14A 1PNRA 1R12A 1VLJA 3JZDA 3SR4A 3FSGA 1W6RA 3M6IA 3DLAA 1P31A 2PEYA 3TGPA 2JLZA 4TRNA 5HFNA 4KIWA 4EHAA 1Z73A 3BE8A 3GZTB 4I4TA 3SFZA 2C9YA 1J2JA 1EVJA 4YV7A 5TVKA 5A9SA 1EVQA 1OYVA 1Q2UA 2WU1A 3RVNA 2C03A 5H9WA 1Y37A 3OOJA 3WBJA 2FSHA 3KKEA 2RHLA 4NONA 1OXBB 1OYWA 1Y7HA 1L4GA 2O0MA 2Q27A 2XVYA 1R3UA 2AH5A 2JAUA 2O8NA 3FFTA 4O2AF 4M1MA 4UQPA 2ONJA 3PHLA 2BGRA 3O1JC 3FNEA 1JSXA 1ULAA 3O03A 2OP0A 3OC0A 2V55B 2HADA 3B5IA 3MMXA 4KODA 4LI0A 4TSRA 3U7FB 1WHSB 2FI1A 4YXFA 1ZZGA 2BFAA 3JQGB 2FG5A 4QAQA 5B1SA 2DMRA 3UHOA 3DBHB 1SQ0A 4LFBB 1YOVA 1RHKA 5LU9A 3TLCA 5KEIA 4YPFA 5F35A 3KP1A 1IUOA 1E2LA 4DQ0A 1IEWA 1FUUA 1DUIA 3NHLA 1T5DX 3RTAA 4CKZA 5HGXA 1C3LA 2HWXA 2WRZA 4MW5A 1T9HA 1GU0A 2N42A 5HG0A 1Y3FE 3KRTA 4PHFA 1T6BY 5D1NA 5EKSA 3VR5A 5KOYA 1EFAA 1Z28A 3CLTD 3BM5A 3R9XA 1UKYA 5G40A 4LMRA 2XQGA 2BC9A 3DYBA 4ZI7A 4P08A 5HF9A 1RCFA 4KR9A 3KQQA 4JYCA 1EAMA 1ECLA 4GDMA 4LV8B 4TUYA 3TPFA 3UJ7A 5KTPA 3IQFA 1O4VA 4ZYWA 4PZPA 1WSDA 2AS0A 3O4FA 3SQWA 1B0ZA 3WDKA 2C3MA 1G8HA 3FUUA 3G5LA 4C29A 4HJRA 1X70A 1CR1A 5ALEA 2BPOA 3ES9A 4JEHA 4O29A 1ZUD1 3KE8A 3M1LA 5GINE 3F6EX 1ZY2A 3M1AA 121PA 4KO8A 4WN9B 4Z9BA 4J3JA 3IIKA 5AJUA 1EFPA 1YI1A 3E9QA 1YQ9A 1YDMA 2RHTA 3KO8A 1IHOA 2I71A 3R5JA 4PZAA 5E7JA 5HKLA 3ROXA 2XR1A 3MWDB 4CODB 4AMZA 3JAKA 1HWYA 1S4QA 1Z4QA 3GFGA 4L7QA 4TRRA 3ZXYA 1W5EA 4F5WA 1Y7PA 4R54A 1K8QA 3WIBA 3X44A 5G02A 4WY2A 3TQCA 5DYYA 1OWNA 2Y1WA 3O73A 1GRRA 4RESA 2Q7OE 2FNAA 5FUXA 2NV6A 5B1YA 4NI5A 2C92A 4CM8A 4PPYA 4DM4A 3UXYA 5JOQA 5KKAA 5K3SA 4WNIA 1BW9A 4R2LA 4DPKA 1AHPA 2NMVA 3FJYA 4JP5A 1U99A 4J3FA 2GASA 2SHKA 3QTBA 3KKLA 3GNTA 1KJQA 1S3SA 2Q0HA 3HBJA 2IIQA 1LDYA 4J1SA 2PRJA 1SHZA 5KNCA 2VZ9A 4J7UA 2Z1MA 3Q7QA 1X15A 4IEEA 4EW2A 2EP8A 2Z8ZA 2HEIA 1TYAE 2PSJA 1KE2A 5AVRA 5HSGA 5E2BA 1Z12A 5JARA 2WYUA 4FGLA 2A9VA 1QB8A 4U7DA 3MM4A 1RKUA 1QOPB 1WQ3A 4DCNA 9LDTA 1Z45A 4H6WA 3NAGA 2Y3IA 1I3MA 1MV5A 1NNUA 1EX1A 2V5AA 3PDHA 4J7CA 2XB2A 1U6KA 2NYVA 5DT2A 2Y77A 1CDEA 5C1PA 3G0DA 5EJAA 1ESDA 4Q37A 2C3PA 3W1WA 3BAZA 2WQ7A 3I0ZA 2ZULA 4UMFA 2CYAA 3JQBA 3M4YA 1UJNA 3ZWCA 1M72A 1N2HA 3QE2A 1ONBA 2O5VA 3OOHA 3A1FA 2FSVC 2PUJA 1SXQA 5CXUA 4FFMA 4B87A 4UVEA 1RKVA 3ZDDA 3RS9A 2PBRA 4B5LA 1IWBB 4YR7A 1GGNA 2GFQA 4F4HA 4G1UC 1WULS 1G3MA 3C98A 1OXTA 2F8MA 3KFVA 4FMBB 1ES9A 3BBPA 3LECA 4IKPA 4MQFA 3VU1A 4M9XA 5GONB 5E7IA 1WY5A 1PKXA 3QBDA 1TK9A 2BWJA 3C3JA 4AS1A 3USCS 1AUXA 3N8IA 3E3MA 4BVJA 4TROA 1XU7A 2HCBA 2I65A 4W6QA 2C84A 5FJJA 1QUFA 4DR7B 1W46A 4UW9A 1UP4A 3EVTA 3CH7A 4Q66C 4WOJA 4AD8A 2ZYHA 4DXAA 2EERA 4B8YA 3ECCA 1E1RA 4Q3LA 4JL5A 4EJSC 2P0YA 1Q0QA 1F20A 4Y6RA 2H2HA 4H1VA 1C7RA 1F8FA 2JIMA 3FLAA 2NVBA 3IBYA 3KQYA 1R0RE 4J4HA 2XCTB 1W581 3D6NB 3V1UA 3WHLA 2C0PA 2JI7A 3CCFA 4TT3A 2W6QA 4MV7A 1BS9A 2JI8A 1JG3A 4GXRA 4POAA 1L5RA 4QWWA 5LWHA 4LNUA 3UICA 3C7CB 4WOCA 4E07A 2C20A 3FPBA 4E5DA 1YKFA 2IUEA 3NKVA 5T67A 2A6PA 2WSSD 2ZB8A 3HBLA 1OE0A 4TX1A 5DX8A 5EHQA 1MV8A 3CF0A 2VJCA 4L5AA 4WY5A 2X0DA 5LUBA 5FEMA 3IAXA 2IS4A 3IA2A 3DV0B 4CEJB 4G9EA 4I36A 4BQPA 4Y9TA 1O0BA 2QZZA 3H2GA 2HIGA 2DUMA 1I33A 2WLSA 2AEFA 5K3BA 7REQA 5HQ3A 2FB9A 1LRJA 1FDSA 2OG1A 1UJ2A 3HKDB 4QT4A 4JL6A 4MW9A 3PRHA 4HGYA 4QM6A 2WSMA 1JW9B 4YLEA 1ZMOA 5FA6A 3TRIA 3G3EA 1WCIA 3M9XA 4P80A 4LKOA 5CX1A 2BW0A 4UAJA 3ZBTA 4LSWA 4D74A 4MO2A 1SWWA 3ZCVA 3MJ4A 1V2GA 1P4JA 4RWEA 1YQEA 3ABRB 4UMVA 5F7JA 4RHXA 4O5OA 4URWR 1KWKA 5F23A 1YQQA 3IX7A 4UVGA 3CZ4A 2H5LA 3IERA 4Z4QA 1ZOPA 2OBYA 3AETB 4OUDB 4CLOA 2WMNB 1J8YF 3O8QA 4LS3A 4EEKA 4TLEA 3WQQA 1OBVA 2PT7A 3P7MA 3SXJA 3UH1A 1EWTA 2NSHA 3LY9A 1SQFA 3NETA 4R1SA 1GXSA 4C03A 5LB4A 4WBXC 3UGQA 3A4MA 4JDUA 5CVCA 1R4MB 4LEIA 2QN1A 3V4RA 1USIA 2Y27A 3G89A 3GVPA 1FS5A 3Q1LA 4LQCA 5JCOA 1U2SA 4Q4JB 5JQGF 4ND6A 4X3OA 2X5OA 5E9QA 1CXZA 1VL6A 3WGLA 3OQBA 3DV2A 1OF1A 4KPUB 1K7XB 2RAFA 5E3JA 3HDHA 4I5FA 2F00A 3L1VA 1L5FA 1R0ZA 2VP0A 2C00A 3M9LA 5SY9A 2C1EA 3KVNA 1QGAA 2O50A 2Z0MA 1VSBA 1POWA 1UOEA 5K45A 3JRNA 1K7YA 3D4IA 2DYKA 4RJJA 3BXOA 4L3OA 4M7RA 4AY3A 4YCDA 3TQRA 5K4HA 1L4EA 2AFHA 1C29B 1W5BA 2QTAA 4LJ8A 1RNLA 3SJUA 4II7A 1N1GA 4BMOB 1GQ2A 1H94A 5ARDA 3W5CA 3AP3A 3ABIA 3AM4A 3SBDA 1DJLA 1ZEJA 1KNXA 3PDCA 3V2GA 3QKSB 4K46A 1YMUA 3O47A 3RTGA 1L4KA 1IIRA 3CJTA 2ZYTX 3ZDBA 1TEVA 3DHNA 3RUCA 1NYRA 1RAFA 4EG1A 4U6NA 2CUZA 2PN1A 1X80A 1U8UA 3AG5A 3I1JA 3SLKA 3PHJA 2K7FA 1UJMA 1YGPA 1K8RA 4G9BA 1U8XX 2X14A 2AT1A 3EZLA 1DZ3A 3GGJA 1FZQA 4XPZA 5EUCA 4ETMA 1ISRA 4Y7CA 1QRAA 1UBNA 1JT2A 2VQSA 3TTYA 2NSLA 3AEZA 3SJ7A 3V4OA 4K6KA 3VR4H 3CS3A 1QH0A 2VPPA 3NHRA 4YALA 4WXRA 3HFJA 4JR1A 5K8VA 5JO9A 1UXIA 1M1YA 2CDBA 3WRVA 4B4DA 4BY9E 2IU6A 3LWNA 1GLVA 2P9YA 4AL4A 1LC0A 4RPGA 1XMPA 1B8UA 3DL0A 1ESNA 4N3GA 4WJZA 4LF8B 2VJKA 4YAJA 2PK3A 2H4WA 3AFNA 5SYNA 4DMHA 1GFWA 2QRZA 4GSYA 4MK4A 2AKEA 1QRTA 1U0NA 1QJCA 2SBTA 3BRQA 4HGRA 2CYCA 1FYEA 3RU7A 3AB7A 1GPKA 2WYIA 5J3JA 1RDFA 3MRXA 3TR6A 2YHAA 5G4KA 4A82A 1TLTA 3FRJA 4ZI7B 7ADHA 2GCIA 2CV0A 5AK4A 2YYSA 2P9FA 5HS4A 3PDIA 4R2IA 3RRJA 4EMBA 4WZ6A 1TQDA 1O5TA 3FHOA 3PUXA 3K1AA 521PA 3AUXA 3A0UA 1NW3A 3A6LA 3L8GA 3H1GA 3SF8B 1G3RA 1QFJA 1ZICA 1OAOA 2QLBA 3DWEX 3M1IA 4MLZA 4UZSA 4BO9A 4ROSA 4ZVNA 5ICFA 1KU0A 2LW7A 4ASUD 1NMZA 3C8HA 3WSTA 2HF9A 3IVMA 2Y0CA 3IAS6 4CGYA 1W5AA 1OIWA 1YB6A 4Z5XA 4D26A 4G0VA 1EJ2A 2G4VA 1XLTA 3MUNA 1KFJB 1TEXA 5CVEA 1FP4A 2CB0A 5DNCA 4MVJI 2QGNA 1DKUA 1ECGA 3DF7A 3E5NA 1GPAA 1T26A 1H65A 4C0XA 1CB0A 4P0TA 2A35A 2AJCA 4BJ3A 4H6PA 1G9SA 3E8SA 1I7NA 2O2IA 2ZK7A 3WYFA 3LCVB 3PNLA 3ZVKA 5HZKA 4EITA 4FLFA 2Y8EA 4EHBA 3LCJA 5DRYA 5B12A 4URXR 3PJEA 4X6YA 5LN1A 1E6CA 3H86A 3H3JA 4UDYX 2M6KA 4JOSA 5E38A 4BJ6A 2OV1A 1HQCA 2FUEA 1H8EA 3ZHTA 4KMSA 2O2GA 4KC0A 4EX7A 2ID9A 5LYJB 3SHWA 4JLDA 4PWYA 5KSWB 1GWNA 4ISCA 4MA5A 3N3BC 3U9SA 1GQFA 1S5PA 3PXDA 3QWIA 5LQNA 2J9FB 4C06A 3Q0EA 1WUJS 4INJA 4KWHA 5M3BA 1E5VA 4IFEA 2UZ3A 3DXXA 4IJQA 5EA2A 4B35A 1VKNA 5AHOA 5JZVA 1I3CA 2QX6A 3MUEA 4FZVA 1U90A 4AICA 2UZ4A 3X0DA 3FCXA 3SZLA 1EP1B 3EXG2 2F43A 3DEAA 3PQFA 2HCJB 1AGXA 3TFWA 4R1NA 4A6XA 1XQVA 3BTVA 4HT3B 1H8HD 3M3DA 4XD7A 3VC2A 4D3DA 1RJWA 4BZQA 1AGPA 2TSYB 3NJ8A 2O0JA 4HNSA 1OLXB 3NC4A 1GG9A 4HNAB 5BMVA 5KSOA 1TZKA 2PZJA 1A9YA 4G81A 4UOQA 2C88A 3UPDA 1DRWA 1QTQA 3KQPA 4OQXA 2CMDA 3G85A 2ZI7A 3D8SA 2FZEA 3GJRA 3IPXA 3LJKA 4LJAA 4RH1A 1AGRA 1UFRA 2VHYA 4ER6A 3F6YA 4DA9A 3FFXA 4DCJA 2YWXA 2Z4RA 1SVWA 2YXPX 3TGWA 3WYNA 1MIOB 4FT2A 4YP5A 3DE3X 1UWLA 3G2PA 3W5DA 4O4HB 2CUTA 4EVRA 1Z2DA 4IY1A 3UFXB 1XFAA 2PLRA 3I2GA 4YUZA 1A4UA 3T1OA 1O94D 2DSNA 3FIUA 2CXHA 1Z5WA 3BX1A 4P6VF 4Q48A 4ESOA 3EHEA 1AKMA 1PO7A 3Q9NA 2HQ1A 3VZRA 1ZXXA 4HQOA 3L0IB 3PQDA 3OIFA 1UMKA 5EHNA 2ETVA 1BMTA 2FX5A 1TK2A 2FGJA 3HY4A 4W7IA 4ZEMA 1ZK4A 3FNBA 1B1AA 2IEIA 3FPAA 3B6JA 1L9KA 4OHWA 4XGQA 3VKVA 1ADJA 1FDRA 1XALA 3RODA 2Y1OA 3T35A 4C78A 1ZQ1A 1QIDA 1KMQA 1AZSC 1E5LA 4PHTA 5BV0A 1IN6A 2HLPA 4D8VA 2DWCA 1UR5A 1E99A 1ORVA 2ZI9A 4GUAA 4YDSA 2C77A 3L8MA 4FHCA 1M2NA 3WKAA 1OFGA 1GSAA 2H4HA 4INAA 4HNTA 1G17A 2CNOA 4NK5A 1HTTA 5CUQA 2I7TA 1K7CA 1GKLA 1UPFA 2IF2A 1OXXK 2J6IA 3S3TA 2ACWA 4EHHA 4OQFA 1Y1LA 1SOMA 4MKIA 4NH4A 5IAKA 4DLSA 5A04A 1OH7A 2E49A 4ZYTA 2H48A 3AL0C 2IHKA 3CX3A 4MUMA 5B3JC 1SOWA 1AGNA 1RZ3A 2PZMA 4JAVC 3F8WA 3UMSA 2GN6A 3FSJX 4UUQA 3NGXA 1C9EA 1WB6A 5A3VA 5HUQA 1ZN7A 1GA4A 4E70A 2A7QA 4BB5A 2PKRA 4H1HA 4RTJA 1PSDA 2R8EA 3GUUA 1U3VA 4WZAE 4YMWA 16PKA 2IWHA 4UXHA 1F17A 2B2NA 3PFIA 1Z22A 2YHSA 2GXAA 1VJDA 1TVEA 2P3SA 3ON5A 4KFRA 4WLOA 1MA0A 3NOQA 3PA8A 2UUOA 4O3FA 4QSHA 2BBSA 1XMXA 1SD5A 3QVXA 4FGSA 2Q7XA 3N8HA 2VHWA 5JCZA 3MHPA 5JSUA 2QA5A 1OTXA 2PH7A 4JBWA 4AZVA 5A02A 3PJRA 1NHWA 5DBIA 4L15A 4EF4A 1NUPA 5ADWA 3OUTA 1UQTA 2AUMA 5EUMA 1CLEA 2QUZA 4WZZA 4MP8A 1BSVA 1LNZA 3LYLA 3NHFA 1TYZA 3R7LA 4YA6A 4Z99A 5KJ6A 3BZUA 4I4TB 5AICA 1M6EX 3EG9A 3C8MA 3H5NA 1DKQA 4INPA 5A9SB 3AG6A 4W5JA 3PEVA 4OI2A 1SNYA 5K0JA 2B1GA 1QU3A 3GVXA 1BJKA 5T3YA 3UWDA 4EHFA 2WT9A 3IUSA 2VP3A 1OQAA 5HF8A 4C7BA 4ENSA 3HY6A 4CQLA 4D9KA 3OIDA 3OPMA 4UBNA 1EZZA 1MZVA 2GPBA 3EMVA 4QGFA 3VVBA 3L5KA 1JJVA 2Z8YM 4CM4B 3OAAA 3HEMA 4LOLA 3A8TA 2DVMA 4IXNA 2XDWA 4ER7A 1YOVB 4WZAB 3H2JA 4DGQA 1T9KA 2XTZA 1I2CA 3ENVA 1JX6A 2C5SA 1LBEA 1NF9A 1QHYA 5GZ6A 2E18A 4MRRA 2VH2A 3T3GA 3R41A 5EESA 1P72A 1XL0A 2I91A 2YJ4A 1ADCA 4JBIA 2XQKA 4R1MA 2UYYA 3ADCA 1R18A 5DCWA 4B48A 2BGTA 3AKZA 4DSZA 3R9XB 1II8A 1ZK2A 3MWKA 1A5AB 2BCJQ 1T1GA 1EJ0A 5PNTA 3V8RA 3PSAA 1N3IA 1P4SA 2V5UA 3K92A 1N7GA 3ABQB 4TUYB 1E7WA 2C2WA 1ST2A 4XM2A 5BQ3A 3MIIA 4JWTA 3T95A 3ZLVA 4OXKA 1WMEA 4K9MA 2QTLA 3HKCA 4ND8A 1XD8A 2WAMA 3Q11A 3DOCA 4MW0A 1X1TA 1QBGA 2FWIA 1E2DA 3AR5A 1LK5A 4IHJA 5E7MA 3IP5A 3ORRA 4EI7A 5C8VA 3WAGA 4QBKA 2H9IA 2ZM5A 4LYFA 2XADA 2H31A 2WVAA 1EFPB 2EBFX 3FD8A 4MINA 2IU0A 2FMUA 4NYJQ 5THKA 1HL7A 5GZ1A 4PV7A 4HYEA 2G5PA 3JAKB 4FKMA 4JWKA 1Y7TA 3U4IA 4WKNA 5DZSA 3RE1A 3H2YA 3WRWA 2VEOA 3S2EA 2QT1A 2R97A 3D4LA 5G0VA 3DEYX 3ELWA 4QQ8A 4RVUA 4KREA 4JKIA 2FTKE 3TL6A 1PDWA 3ZS9A 2G80A 1XUOA 2VLBA 2OQVA 3RUPA 2M1XA 2H2AA 3R5TA 4IGEA 1WAMA 1PHRA 3EA0A 4XYLA 4OH1A 1CY8A 3PLNA 4JP2A 3MJTA 2NZYA 4NAUA 1RVV1 3CPJB 4UNIA 3EGOA 1JDZA 2UVPA 3NTQA 1LNQA 3O84A 1E9BA 5EPEA 3VH2A 1A9PA 3C85A 1GZ6A 3M6LA 1AM4D 1WL8A 2VPQA 3DP9A 3SGLA 3SJZA 3MCAA 3RS8A 1PK8A 1QYDA 2IIPA 4NTZA 5KNDH 1K8XB 3D7RA 4RANA 3U7JA 3GJ3A 3ABSB 4WKOA 2Q5LA 5CBPA 3K0BA 1IMOA 2PS0A 2PYZA 1KYZA 2VHUA 1VKHA 3IURA 2J87A 1GGMA 2VXOA 3HXQA 1QFMA 4P2BA 5A7GA 2I5PO 4KNVA 5TC4A 1ENOA 2CXRA 4IF4A 4II2A 5IXSA 1GAEO 4N40A 3ZDZB 4ZCSA 4DWJA 5JNUA 3R6TA 3FUCA 2FUNB 2HBRA 1LBIA 1O97D 2H17A 2D06A 3CY6A 3FFWA 3D7LA 4RXTA 2PHZA 3A4YA 2Z9DA 4PZYA 1EB8A 1LTKA 1ZH6A 3GD7A 1Z17A 2VQ3A 3R20A 1QYIA 4ZXFA 5BQFA 1GTRA 3KWMA 3TQSA 1KS2A 3A25A 5JD5A 1P7PA 5LIPA 1NW8A 1J49A 1V4BA 2ZVJA 2ZS8A 1AUVA 2W8BA 1GYPA 1VYVA 2W2PA 3NBYC 4TN5A 5LL6P 3DA8A 3DFZA 2J0SA 3HYTA 2ZYGA 3KCQA 1NX9A 4MQFB 1RE1A 3LPNA 1K5DA 4IJKA 4D25A 3EZGA 3P96A 5LUAA 4AJJA 1DJMA 4L16A 2P5YA 5HOEA 2BP7A 2ZTHA 3K70B 1S0UA 4PICA 2JF0A 5EKXA 1I80A 1IJKA 4OU5A 2WBLC 3CRQA 1W47A 4UE2A 3AFHA 5BW5A 3IPLA 4KP7A 2QVGA 4LOKA 5L3VA 1Y6RA 3G2KA 2X13A 2YWCA 4NOMA 1A9XA 5AOVA 2OLEA 2ZS9A 5LA6F 8LDHA 3H13A 3KJEA 3AESA 3F67A 2PUVA 4CDMA 1KOGA 3CN9A 2Q8QA 2V6JA 1ZGHA 3AW8A 1M5TA 1XDUA 1AA9A 4B6PA 1EG2A 3A4VA 3TTVA 3VPCA 3WWYA 4IR7A 1BWRA 3ILHA 1KYIA 4R8KA 1S6YA 2EARA 2HMTA 2JASA 4B3RB 2DQSA 5CLQA 1E4VA 3LG2A 3U0VA 4WW0A 4OQNA 4I3HA 1OI3A 3FOEC 3A3KA 2CFRA 1ENPA 1X8KA 3FDXA 3MA0A 4LNUB 2F55A 1VLMA 4KIFA 4XVQA 2DQKA 4PZCA 1ADGA 2WHEA 4J6EA 4GGMX 5KQLA 2JK0A 4IGFA 3CLRC 2CV1A 5CVDA 3CMMA 4DCVA 2I9PA 2J6CA 2C96A 2NW6A 3ILYA 1GPYA 2OM6A 2A2ZA 3DYIA 2JVJA 1XAIA 4XUDA 2X4GA 1Q91A 3URMA 2HHHB 4DG9A 1NGSA 1SC3A 2QVLA 3H99A 5EHGA 3FH0A 2BI4A 1XELA 1CSEE 1HE1C 1PHPA 1JXAA 1GQYA 3KQTA 2C7VA 2VDQB 4G5HA 4HDNB 4LC1A 3RLFA 1OYOA 2A9KA 2HDNB 3REGA 1OHHA 1Z5OA 3WMFA 2K2QB 3CRMA 1E1CB 2JGAA 1AQUA 2O0LA 1WCIB 3LZCA 1LJUA 1RCUA 5CX1B 1CJKC 1G8JA 2GJSA 3KKQA 3RSZA 2WPDA 1E1QA 4K2HA 1QO0D 1XDBA 4KXYA 2Q5IA 4RTQA 1D4ZA 2O9JA 2P2GA 3BS4A 1FK8A 3L0OA 3P9ZA 1YRWA 2P6NA 1QIIA 2NSJA 1TU4A 1XZFA 4GZLA 4C01A 4U2DA 5F4ZA 3OUZA 3LSTA 4YMUA 4JBYA 3ZV4A 1CQIB 4M0EA 4IG9A 5TGDA 1ILWA 3R0VA 1H93A 1ZCJA 2VJPA 3VR6D 5ERGB 1CULC 3O8QB 4CLOB 4E5NA 1FFBA 2FSVA 2HK6A 3LX6A 5AI0A 5IC4A 1JJBA 3OQIA 1IVNA 1G8FA 1W52X 2NP6A 4KQJA 1RSZA 3LRTA 2EX1A 1NP3A 1FU4A 2GEBA 3P2JA 5MGNA 4BJ5A 4GRAA 2GFIA 3U26A 4CPDA 2UVQA 5A06A 1MQ9A 3A6JA 5HF5A 3SHQA 2R7MA 2GK3A 2YCLA 4MV4A 3A37A 4YFVA 1J7KA 4N82A 1L5KA 1KAQA 3SWWA 1QRSA 4LTMA 3VTAA 1SOUA 4M46A 2UVDA 2YJZA 4YS6A 3T1NA 4CDGA 1TC2A 4L8FA 2G67A 1E79A 4KPEC 4LXGA 3ROGA 3L4JA 4RIFA 2AN4A 3DMTC 4MMZB 4ESVA 2YICA 2ZYDA 2NYAA 4OA8A 1DBIA 1ZMBA 1S2DA 1IHPA 2C9ZA 2OOKA 3HA7A 3VC3A 3UGJA 1NUQA 3HVUA 4JC5A 4REQB 3W4IA 2QAGB 4B6RA 4EJSA 1B6RA 1SCUA 2FFBA 1NHGA 1LC3A 2JD2A 2GF2A 3UMMA 1E77A 4JDPA 4QDKA 4BQIA 2WHXA 2ILVA 2XUJA 3C6MA 4QYWA 1ZJWA 1ML3A 4NRDA 4F4IA 5DP1A 4GFDA 3QVTA 1TO2E 2XUPA 3B3QA 4R8MA 2XUQA 3DMRA 3H5VA 3ZJ4A 4L95C 3FVRA 3B85A 4WA7A 1G4UR 1XTKA 1VE7A 1W4BA 2RC5A 5FO1A 3VR2A 1WCYA 2ASEA 4P7FA 1TA0A 1ZJ6A 3T0GA 5I51A 2O2DA 3UC9A 1EP9A 2LXNA 2YMQA 2WMYA 1CEXA 1LI7A 1M1YB 2FR0A 1SUAA 2ZYAA 3D9QX 3EVEA 4DIKA 2P9BA 2GNAA 3VGPA 3FNGA 1F5SA 3F5QA 4FFRA 2AVDA 3AHHA 4YRMA 2Z8YA 4G0QA 3ZGZA 1ZD3A 2HOQA 1TO6A 1IHXA 3OEWA 4GH5A 4LXTA 4HUQB 4LZNA 4Q4AA 5AI6A 3RW9A 3STWA 4C0JA 5HJEA 3LE8A 2ZUDA 2PX6A 3L41A 3V1MA 4YACA 2IYEA 3K2QA 4GLOA 4GIBA 1FFEA 1YQXA 4KQ6A 2JGIA 5G4KB 3W5IA 3X2SA 2IDMA 3ECAA 5DBFA 3OZIA 3PDIB 2XZTA 4FOSA 2EVWX 1P5ZB 3OQHA 3R5XA 3K1AB 1PEDA 1UOPA 3M81A 1AF4A 4XJTA 1U1FA 5H59A 1QYRA 4AG6A 4IO0A 3NATA 1W5SA 4HH0A 4HVAA 3GVCA 5GOTA 2ZSJA 3EVNA 4YO8A 5FUVA 1CF2O 2CZGA 1VB5A 3W6NA 3M5WA 4MIYA 1TQ8A 3MELA 4HAYA 1XJ5A 1RD4A 2VYNA 3B7PA 4OB8A 4YRLA 1YF3A 4J2OA 3TOZA 1T6NA 5DHTA 1K6IA 2QXUA 3NFYA 1K89A 2NZ2A 3U5ZB 2HMWA 1LLQA 1OC4A 2EKBA 4QGHA 1ATZA 5FJIA 1L4YA 2ZDGA 1FP4B 2G9UA 4OGLA 2V6BA 4RKEA 3RIYA 3KVYA 2VYVA 1RWQA 2C2OA 2ZIFA 3QUBA 1TX4B 4UE3S 1U3FA 2L42A 5DBHX 1WDMA 2X8JA 2RHOA 3P4UA 4YAFA 3COPA 4AM8A 1VMKA 5JNWA 1NC3A 4V24A 1AXRA 1G6HA 5BVGA 3LX4A 1GRQA 4LGVA 3A6ZA 4U2EA 5JTTA 2IZ1A 4JXZA 4UM7A 1RT9A 5A03A 2FOIA 4O2LA 1PNQA 2Q3EA 2VDJA 4G01B 1XZ8A 2E55A 3JYLA 3BK1A 3D5QA 2WF8A 4D96A 2JGRA 1BO6A 1IY0A 1RXEA 2WWVD 1QHNA 2I33A 3I4LA 2X1LA 3JD3A 4D98A 4JOCA 4Q9IA 3K9WA 3VUFA 1TADA 3P2MA 4B7XA 4CFSA 4LJYA 1WBDA 1ECCA 3CFYA 3SZMA 3OKFA 2P3LA 4YT2A 1YJBA 3B8EA 4DJTA 1KQ3A 2VBGA 3E82A 2HK7A 2RK4A 2WIKA 3D3KA 3ZX4A 3VJRA 4LXHA 2QQ0A 1UBLS 2F43B 4FI3C 2ZUWA 3HN7A 4F11A 1N7JA 4CI9A 5TMPA 3RHZA 3TLMA 3CO5A 3D4NA 1UDXA 5DK6A 1NU8A 4CR7A 1UJ6A 4Y6PA 5JSQA 3THWA 2UAGA 4G37A 3ZW7A 4AXXA 3E2PA 2QG9A 2CHGA 4B6OA 1P9WA 1I7QB 4JIMA 5A4KA 3CFFL 2VF8A 1QFZA 3QH4A 4W1QA 3ORYA 2UZ0A 4HH1A 4B6EA 4BUCA 1EGAA 4PYNA 4ZIRB 3AK4A 1TJNA 5K3FA 1U4OA 2LPMA 1BHSA 1I24A 2OCYC 1AKEA 3JQ7A 1Z6PA 2XXBA 1GP2A 5AJYA 3RS3A 1T36A 5CEFA 3ZHVA 1DADA 2V7WA 1ULBA 2UZAA 4OIFA 2R84A 1NVGA 4G67A 1J8FA 3HKEA 1YIOA 2I7XA 3C74A 4IJ6A 5LQKA 5DLYA 3C3XA 2DTDA 2Y99A 1TVCA 1XMQB 1XVTA 2I03A 1THTA 2GAIA 3HHPA 2IV3A 3BCUA 4UNSA 4BNHA 1DBPA 2JG3A 2JLRA 3UUGA 1NBOA 3AW9A 5HRCA 4WEOA 5A05A 2IFTA 3QOFA 4HXYA 5JVDB 1PDOA 1MJGM 3Q2KA 2Q3BA 2VPYA 2Y6VA 2QNIA 3AUTA 3INRA 4HEA6 4DILA 3I42A 2ZM6B 2X8LA 1CUXA 4LKRA 2FZKA 5CAEA 4E88A 3ISVA 2O0KA 2DBVO 2P2CA 1QS0A 2PLWA 3AFIA 3EAQA 3L7MA 2Z5FA 3NWJA 4LE1A 4TXMA 4A73A 4C4YA 5JS7A 5GJVC 3W2IA 1OGIA 1YVEI 2DQZA 3BWMA 3PI6A 2OK7A 1QKJA 3BFPA 1LX7A 5EIAA 4Z7QB 3FOZA 3B3GA 2BFDA 3EEBA 4ZZ1A 3NEAA 4L22A 1E8MA 2HIAA 4ZVPA 5LDHA 3GQBA 1FYFA 2GLXA 1NYLA 1RXUA 1TMOA 1AKWA 1W94A 2VCHA 3DE0X 1NP6A 3EEFA 2W4MA 2W58A 4HAUA 5CYPA 3SD7A 2MTBA 5IMSA 5DHPA 2DAPA 3B5EA 3KCNA 4TV9A 2NZUG 2I29A 4MITA 3GT3A 2XNSA 2P5SA 3BERA 3RBAA 5IJXA 4KKVA 2GEVA 1ZIDA 2DY0A 3V7UA 6CHYA 3GBSA 3DR5A 2CE7A 4FYWA 3CW2A 3T9DA 3FYSA 3TOSA 4BNNA 1CIPA 1FNMA 2A0UA 1DKRA 2DGDA 2ZR0A 3O5AA 3TUJC 3C7DB 4N49A 4CKYA 1RCTE 1AU9A 3GJTA 3GVHA 4AJ9A 1EUDA 2HI0A 2ZJOA 3FTFA 1EFVA 2ZJ6A 4X1OA 5A4JA 2FGKA 3CRNA 3LC1O 2BEWA 4NEHB 5K3EA 3RIHA 1X7ZA 1EUZA 2OSBA 2XOEA 3LFUA 3QWFA 3GDOA 3R6LA 5G0TA 3ZOZA 1CERA 2B9VA 1GQRA 3LKVA 3PTLA 2AG0A 1EIZA 4F2DA 1Y1KE 2SKDA 7YASA 3CKKA 2P5UA 2ZYRA 4FDVA 5TF0A 3IEVA 4GKBA 5CW2A 2MYTA 3BA1A 4BVGA 5K6AC 1FL9A 3SIWA 3G7UA 5KU1A 3HP1A 3TCKA 3BMCA 4UKDA 4W82A 2DQ4A 2J3DA 2IPNA 1IN7A 1KI4A 4HH4A 3SHTA 4AJLA 1XEFA 2VWQA 3K0AB 4C4OA 3K94A 4L51A 1NZFA 2G5CA 1CJSA 2NV2B 3HY3A 3Q98A 4RKRA 5HYVA 1QP4A 2PM8A 3CE6A 1X0XA 3IHKA 5E1DA 4MQ5A 4DCSA 2G7MC 3QXCA 4MWCA 4PFJA 5JFOA 2OWEA 4DNPA 2WOOA 3BIOA 3L9XA 3MRVA 5BSTA 1ACMA 1L5QA 1Q1QA 2QRLA 3QSGA 4GO1A 4H7JA 1Z6YA 4UUMA 1J1IA 2QLJA 4UM5A 2DECA 3C8ZA 2VUUA 2XYQA 3CW9A 3VFDA 1W49A 5EUBA 3WDSA 4LUCA 2AOUA 5C5DA 5LMUB 2C2GA 1NVXQ 3K73O 1T9CA 3C15C 5A0FA 3DFFA 5HBRA 4ZRDA 4EUSA 1T1RA 1QR2A 2NU9A 3TLJA 1AS0A 3JQ9C 5DTRA 4FFPA 3W5UA 4AROA 4PS0A 5CBKA 5LOVA 1JYFA 4ICIA 4RA6A 3BGWA 2G9NA 5HF6A 5AVYA 4K8RB 1OXMA 3RHSA 4Y98A 3AVWA 5KNDD 4JQOA 4ALLA 2F59A 1MTOA 1T43A 1TM7E 4UCXA 5IN4A 3FBWA 5ADHA 2CNDA 4K9QA 5C18A 3QPUA 4BEJA 4C7OA 1JAHA 1T4CA 1XVUA 4NATA 2O14A 2E6UX 4PPFA 3SQLA 3ZY6A 3EISA 4BUZA 2J0QA 1SG9A 4QIHA 1PKEA 3B70A 3QX8A 1N36B 1IH8A 1JLLA 4B9AA 1NMEA 3R3UA 5B3JA 2W0SA 4HSEA 5ENVA 2PT9A 1EK6A 1SIOA 2H4JA 5COBA 4Z3DA 3HKCB 2VXCA 4ND8B 4J7XA 4L76A 2HRQA 5CFQA 1G8MA 1HTWA 1KQOA 2CFSA 1ATIA 2R25B 2WU0A 4IHJB 2QNRA 2WU4A 3EJWA 4A0GA 3FUVA 1P2BA 1NBAA 1NI3A 1TMGE 4KW7A 4XQEA 1QPZA 5AW1A 2I2XB 3OFNA 2ZCJA 5A0TA 1YUNA 1E3DA 2N3ZA 5CXQA 2D59A 1IXSB 8AT1A 1GQSA 2ROQA 2PWYA 4G4SP 1K3TA 1GN9A 3H17A 1HZJA 4AP9A 1YL6A 1HDIA 2Q0QA 2WWWA 5FLEX 4JI7B 4LF4B 2OZKA 2BMFA 2B6NA 2IOQA 4FJ0A 2WKPA 3O21A 3IB6A 4KXQA 3SX0A 3VKWA 4R5HA 1FRFS 3T1QA 1FVHA 3HCPA 2GR7A 1LQUA 3TLKA 1O77A 4WWHA 2NO7A 3G7SA 4AG5A 4BL5A 2JFZA 4B33A 5JAHA 3HADA 3BEDA 3ICCA 4W5WA 1W0JA 1LEHA 1PBTA 4OKSA 4RHUA 5DM70 2Q2WA 4FFSA 4XIGS 4KOAA 1I2MA 2NT4A 2VTKA 4UAVA 4BX0A 3R9WA 1G1AA 3A2MA 5CBPB 3PPWA 4G5FA 4B75A 5LLDA 1FNBA 3NTRA 1P9LA 1T4MA 3RRZA 3AP2A 1R9GA 3Q3GE 1G20E 4XIFA 4ZARA 1GKIA 3CINA 1UDWA 2RI6A 2AMYA 4BZZA 1GIAA 2ZYUX 4E5KA 1GKKA 2E5WA 1CP2A 3Q10A 5LB2A 2PV0A 1AH2A 4AQ7A 4L72A 4O5AA 2CV2A 1KP2A 1UBTS 4GMDA 3DKVA 2IXTA 4ZTZB 1RI4A 2OV8A 2ZJ4A 5ALRA 3P5BA 1W35A 3NHYA 3QQ5A 1UKCA 5H68A 1PR3A 1HRKA 2W8BB 3TN7A 1IK4A 3NDPA 2R62A 4LZWA 4JQYA 2R00C 5CFPA 3WVNA 4ID3A 1R5JA 1MT3A 2H5IA 3MPOA 1E9EA 2ZRBA 2QTZA 3LAWA 3QPCA 5EIHA 1EXDA 1YBHA 1ZU5A 3FWPA 4V39A 2BP7B 1F0KA 1L0BA 2H2FA 3B1JA 3L7DA 3GA5A 4DDWA 4YRNA 5JQGA 2FZVA 2D1QA 4PG7A 3KD2A 1E9VA 1MAVA 4L0DA 2F3UA 1KVUA 1IDN1 3AEQA 4L8YA 4OKIA 4KN8A 4X93A 4JI8B 4JBGA 3QUCA 1JKJA 1FUYB 1B1CA 1EJBA 1M0WA 1NQUA 4JNKA 2XV1A 4IRUB 4JUCA 4GYYA 4N39A 5K0NA 1YBMA 1YR6A 3VC1A 1P5JA 1N1EA 4IV0A 1JLHA 2ORYA 3EEYA 1TJ3A 4XASA 2VKQA 4KQMA 4BVHA 4DV5B 1ZCAA 2ZU6A 1HDYA 3VR5H 3ETDA 3LUCA 5JZBA 3IBSA 4FDAA 4P32A 2QPOA 3ZIAD 2ODAA 4NZMA 1D6JA 1TMYA 3KJIA 4Z4EA 4PRYA 4A6PA 3GBVA 5IXYA 1HC7A 2IH2A 4HNHA 3LLCA 2PMFA 2ADOA 3NANA 9ATCA 2PA0A 2IHUA 3CVYA 4P0PB 3WLFA 1PGNA 5H16A 3OF5A 4X1KA 5G53C 1NQTA 4ITRC 10MHA 4K0KB 1VJGA 1XLUA 5LM3A 4YJ2A 2Q1UA 5DNVA 3N74A 6GPBA 2GCNA 1ZA1A 4HEJA 1I3KA 1NN3A 1D09A 4XPIB 3W2GA 3WGYA 5B7QA 3RADC 1TKRA 1XRSB 3UBMA 3BIFA 1XYVA 4IZHA 4NX2A 4YMVA 1U63A 1AQJA 1EDEA 1UFKA 1T5LA 2AOXA 1NBMA 5H4GA 3K4PA 1I7SB 1JQ5A 2P78A 3B9RA 4H7DA 4QYMA 3BWBA 1JHPA 2AMJA 3PEWA 3EBOA 3WJAA 3LT2A 5JLAA 2PVCA 4IL5A 2UXBB 3EZYA 4G09A 5IYZA 5AW2A 3HCAA 1CJMA 4OY3A 4DLNA 1Q14A 2WD7B 1OKKD 3DUWA 3TAHA 5KYNA 2LMEA 1MRNA 1XI2A 3S8YA 1V5IA 1CDDA 4NIMA 4I2VA 3PD1A 3G2QA 4TKLA 4C2BA 4EKDA 5BR7A 4IIXA 2I4IA 3WHKA 1JAZA 1XTIA 2Z6AA 1C4WA 3U2QA 2C2MA 2R8BA 4BZPA 2RB5A 5KNCH 2Y1XA 1RLJA 3DXYA 4K1LA 4KXUA 3T5DA 3KR1A 1E6LA 4KQIA 2NV0A 2GD0A 3LVQE 2BMDA 2RHDA 3HJFA 1RRCA 5H80A 2BSXA 1DO2A 1V2HE 3HJAA 4ZAWA 4HY3A 4ZALA 5ILGA 1NQOA 3NUZA 4HQLA 3N76A 3V1NA 3WOVA 3FMPB 2AR7A 1YV9A 4GGOA 2QZ9A 4PF1A 3RVRA 5JPCA 3Q8KA 3MTAA 1YR7A 3B1ZA 3WBBA 5CB4A 4RFSA 1D6NA 4QC2A 2Q46A 5DM4A 2AFIB 5CXSA 2UYHA 2IL1A 2W2TA 3WE7A 4R05A 4H7IA 5JJBA 3EYWA 1BDBA 1OVMA 2XDYA 4O6VA 1JJAA 2ODPA 3EIUA 1R8YA 1RMYA 2XLCA 1E9CA 1BZYA 4B7ZA 4EJFA 3HCWA 1Z9BA 2BJWA 2OCLA 1FSZA 4B79A 4A15A 4AKHA 2DPMA 1CZUA 4MVJM 1QIHA 4XTRA 3LXRA 5F1OA 4QL3A 4D4LA 1YS1X 4WK2B 4D0SA 1E8NA 4ZO7A 2O7SA 4GBGA 2Z3VA 3PEFA 1DDOA 5FNVA 2PRSA 4EJSB 1PW7A 5A4AA 3DDHA 5JATA 1XCPA 2JJ2A 3A1SA 1SCUB 1Z8DA 3K9FC 4GR5A 2QRVB 5CURA 5F2OA 3ER9A 4UEWA 2CT8A 3AHGA 4OGKA 3EY4A 5IUNC 3A7EA 3GJ0A 4IIBA 4ZCPA 4Y8VA 4MRSA 4Q1FA 1CUYA 1AOXA 1NG9A 1H4SA 4B31A 2EQAA 2G2SA 2G7ZA 3KFLA 4HC4A 1Z56C 3U17A 2J1LA 3TLBA 2B0JA 3MCWA 1N5DA 1XVVA 5A5FA 1URPA 4HATA 3WP1B 3PLAE 1U0OC 1IOZA 4HUJA 3EGXA 4ZCIA 1DV2A 1ABFA 2C2BA 1V16A 2QTVB 4LCEA 2FFJA 5JBNA 4DEVA 3ITEA 1J9EA 3NM5A 4DDUA 3ZWBA 2G0TA 2GAOA 5BMOA 1O6GA 4FW9A 1FNNA 2C2HA 4C30A 3IULA 2Q9BA 5CT9A 1U11A 4A7PA 2VSNA 3QZUA 1CUJA 4UTZA 1EHIA 1VKJA 4Q4AB 5SYMA 3BXHA 1QYVA 3IAS1 3V2IA 1T8TA 1DGQA 3I9MA 2EFJA 3B52X 1I2DA 3NTXA 2J5RA 5CD9A 4GQIA 1UZUA 4LDNA 5J59A 1UAAA 5D86A 5CGZA 4BP3A 1EGVB 4YREA 2DWOA 4AIRA 3PGLA 1F9AA 4ZAXA 1C9MA 3EFEA 2BDEA 1TM2A 3ZQKA 4E30A 3SYNA 5BV1A 2H7XA 1UBSB 3IRVA 4IEFB 1D2HA 4YBRA 4B3IA 4F12A 2PX8A 3Q3EA 2HAEA 5M2QA 1YCGA 3F2IA 5I7AA 2XCRB 2Q6KA 4MKRA 4CEIA 4RK0A 1TYBE 1AX9A 1XRLA 4LRTB 4BWVA 5CB6A 3HXOA 3K9NA 3CGGA 4LBYA 4HLCA 3UN1A 3U81A 5JAQA 2EC5A 3CX6A 4DYDA 4NE9A 4A2WA 4TV8A 3BB1A 1BGWA 1UDBA 4G8BA 3VZBA 4IEIA 3ZEAA 3ZIDA 1RHRA 4LXUA 2RAUA 4FZ5A 3GEPA 4FD2A 2NU7A 2P40A 3G2NA 2X8JB 5HTOA 2WTNA 3ZKAA 4WKPA 4WV3A 3TFQA 3TKAA 4DL9A 1M6WA 1Z33A 2YC4C 2OQRA 4JODA 5AP9A 5DGDA 1AO3A 1ZOIA 4BFLA 2D0PB 3EFBA 4IIJF 1IPFA 3DMTA 1EJ6A 2HLNA 2LIPA 4W1SA 4DCUA 3F5DA 3NV9A 3FUWA 4JLAA 1QV6A 2IGTA 3GIDA 1G4AE 3LIPA 4YRDA 4JP8A 4ARUA 4QLBA 3V7YA 1NLUA 3PXCX 3LCUA 4LHZA 4QNMA 3IQIX 1U8ZA 3LW7A 3LZDA 4UE6A 3L5OA 1L6IA 1CY4A 4Q7QA 1KAMA 2NZVG 2B8JA 3ANTA 3HI4A 3CUUA 3KT8A 2HQRA 2ZIGA 2ZBFA 4KBYA 3LYAA 1KEKA 5FTLA 4YPVA 3OPXA 2HJGA 4Z4IA 3GT0A 5LP6F 4G1FA 4YT5A 1BVYF 5FV7A 1BX1A 3JZAA 4DXDA 4YHHB 3S55A 3H9CA 2WINI 4QHSA 4IJ5A