3IOCA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.50 ang resolution in complex with 5'-deoxy-5'-(benzyldisulfanyl)-adenosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
273
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 86
structure length 273
sequence length 285
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iocA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iocA01
5TEWA 1F9AA 5FO0A 1NUSA 1G8GA 3D6UA 3CVYA 3KT3A 1J1UA 1FFYA 3KT8A 3PNBA 4MVXA 2CSXA 3Q4GA 1O95D 1Q11A 5H16A 5HUHA 4JXZA 3LCJA 1J09A 3PRHA 4NX2A 4UZEA 1MOPA 3OTWA 5JBNA 3LOQA 1JILA 4MQ6A 1VBKA 3AFHA 3G59A 4R2MA 2A1TR 1V47A 1ZH0A 2QTMA 3K9WA 3ZXSA 4K03A 1ZH6A 1NI5A 2QUIA 3HFJA 1QRUA 1N78A 1KKUA 4I6EA 4BWVA 1OD6A 4DE5A 1B6TA 1I6MA 4MUNA 1NYLA 3COWA 3H9BA 3TQIA 4KR6A 1I6LA 4QREA 2QJFA 1MRZA 3CR8A 1KORA 4F4HA 1JIKA 1OWOA 3CLSD 4KPUA 4MUJA 4MUEA 1U3DA 3Q10A 3AL0C 1R6UA 3KT6A 3CA8A 1UFVA 1J20A 4ND7A 1M83A 2X0KA 4ZCRA 1EUYA 4JXXA 4MW5A 4CQNA 5HG0A 2Z3VA 4DLPA 1V8FA 2IP1A 4PBSA 3D6VA 1O0BA 1T9GS 1K92A 5K0SA 2A84A 2ZUFA 4JZYA 3RJZA 3N2YA 1H3FA 4KR7A 4PY2A 5TGTA 1M8PA 3CLTC 3RHSA 3FETA 4DDMA 3L93A 1TYAE 3FHJA 3HMQA 4CDMA 1PFYA 1WXEA 4J76A 5DB4A 3X1JA 1BS2A 1PG2A 4MAFA 1N2IA 1O5TA 1YI8A 3MMXA 2GKSA 3AKZA 1EUQA 2QTRA 1OBCA 1X6VA 1N2JA 1QQTA 2WSIA 2YWCA 5J58A 2CFOA 2JANA 4MW6A 4DDHA 3RK1A 3TQOA 3LE8A 1IQUA 4DDKA 1NUQA 3SYTA 4CT0A 1EFVA 3ZIUA 1VBMA 4OJMX 5F23A 2RD2A 1GAXA 2CYAA 3FY4A 2V0CA 1LI7A 3SP1A 1GZUA 4RPIA 1K4KA 1OWPA 1NZJA 3S3TA 3U1VA 2IELA 1WXHA 2YY5A 1IQ0A 2QUHA 3H9CA 4NAUA 3AG6A 3DV2A 4P2BA 3FOCA 1TQ8A 2X3FA 3ND7A 3PNYA 1MB2A 3G6KA 3FH0A 4G5FA 5AHWA 4MUGA 2OV4A 1MC1A 4MWCA 2QUJA 1Y42X 5KWVA 1ULHA 4F3RA 2VTBA 4MW4A 4MUKA 4WNYA 3P0JA 1G8HA 4MULA 1JMVA 4MW2A 3TZLA 4YP6A 1WXGA 1OBHA 1NUPA 3FIUA 2YWBA 2D13A 5J59A 1OWNA 2CV2A 3IMGA 5TS2A 1YIDA 2PIDA 2HZ7A 4MW0A 1N77A 1H3NA 2E0IA 2HGZA 3IMCA 1SURA 1WQ3A 4PBRA 5TEVA 1KH1A 1G59A 5KHAA 1NUTA 3G5AA 4HJRA 4ZT3A 2XRYA 4J75A 2DXIA 2EJCA 2CV0A 4OUDB 2PXHA 3P0HA 1MAWA 3C8ZA 4ARIA 3E27A 1O96B 3FG9A 3P52A 3CLTD 1F7UA 3QTBA 3P0IA 1XNGA 3CVUA 3COYA 1GPMA 1T6XA 1TEZA 1T6YA 4S1OA 4ZCSA 2OQ2A 2C5SA 3UOWA 1XNJA 3TNJA 1EE1A 3CVVA 1EJ2A 2H2AA 4K0RA 4R2LA 2WQ6A 3IH5A 2QUKA 3BL5A 4G6ZA 3IODA 4MLPA 1WZ2A 2J4DA 1F4LA 4PBTA 1IQRA 3I05A 5DASA 2AG6A 2AZXA 1Q77A 3TS1A 3VRHA 2ZUEA 1QNFA 2BTEA 2X1MA 3IUEA 1R6XA 3ZXIA 1NURA 1LI5A 4XSVA 1CT9A 3RFFA 3UK2A 4ZCPA 1JEEA 4ZT2A 4X0EA 2CV1A 4CDNA 1IH8A 3ISJA 4OUDA 1H3EA 3H99A 1JZQA 1O96A 2WB2A 3GUZA 4MUIA 4YP5A 4EG3A 5LFAA 1WKBA 4L2IB 5LM3A 3NV7A 3X1MA 1F7VA 2J07A 2V0GA 1KP2A 3N9IA 3INNA 4KKVA 1FYDA 3CLUC 1R6TA 2DLCX 5HUJA 1T9GR 1KQPA 4MWBA 5KCMA 4HJXA 1KR2A 2D54A 2WQ7A 1TYBE 1NP7A 5DEOA 1O97D 3HGMA 1IRXA 1TYDE 3QE4A 2DEUA 4MWDA 1A8HA 2QJTA 3VGJA 4EFKA 2Z08A 3TZEA 4TS1A 2G36A 1PFWA 4JFAA 5H7XA 4R0NA 1XNHA 2A1UB 2GM3A 2QJOA 1JIJA 4QRDA 3COZA 2BYTA 2VXOA 3ILVA 4NDAA 1RQGA 4RUKA 2I1LA 1X8XA 5BNZA 4U8HA 3DLAA 4DJAA 1DNPA 2E89A 2CUZA 1N75A 4EG6A 2R5WA 1HYBA 4MW7A 3ZJUA 1MJHA 4AS1A 3UY4A 5K0TA 3IVGA 1O94C 4NAHA 4EG8A 2PZAA 4H3SA 4ND6A 2Z09A 1EFPB 1WXFA 2IJGX 1NUUA 3HZRA 3DPIA 4GU5A 4AQ7A 3MLBA 4MVWA 3IOBA 4NZPA 1VBNA 1M8KA 2O5RA 1U3CA 3PXUA 1M8JA 1O97C 2A4MA 4WSOA 1KQOA 3RK0A 1WY5A 4Q16A 2HMAA 2NZ2A 3IDFA 2E18A 4QBTA 3SZGA 2A1TS 1OWMA 1IVSA 1GN8A 1Q19A 1QU2A 1H1TA 1QTQA 4XFJA 2AKEA 4EGAA 2A1UA 3HL4A 2TS1A 1K97A 1N2OA 1KH2A 4MWEA 3IOCA 4FZJA 1GLNA 3A4IA 1N1DA 3NBKA 4GRIA 1M1ZA 1JHDA 3L92A 3K32A 4XFDA 4ZT5A 4I6GA 3HV0A 2PFSA 3CLUD 1WXIA 1MAUA 2X1LA 4NATA 4MVYA 1Q15A 1IHOA 4HK4A 1EFPA 1MB9A 1PFUA 1TYCA 2D5BA 3SEZA 1IFXA 4ZCQA 1WJGA 3FWKA 4KR9A 1P7PA 2PZBA 4EG5A 1QRTA 3ZJTA 3ND6A 3MXTA 3CLRC 1KAQA 4ZT6A 3AG5A 4ZT4A 1M8GA 1T6ZA 1U0BB 3ZUGA 3SDBA 3ELBA 1D2RA 1KH3A 1JEDA 3ZJVA 5EKDA 1N2BA 2JAXA 3FDXA 5FNZA 4EG1A 1EFVB 1JIIA 1PG0A 1GTRA 3CVXA 2DETA 1I2DA 2CYBA 5LLTA 3QTTA 2A86A 3SEQA 1PFVA 1XJQA 3JXEA 3ND5A 1YUMA 1S4MA 4YBRA 1MBZA 3GLVA 1ZJWA 1K4MA 1JGTA 1O95C 1N2EA 5IHXA 2YXNA 1N2HA 3AIIA 1QU3A 4MUHA 3F3MA 1LW7A 2E21A 1O94D 4ZT7A 3A2KA 1TFUA 2EL7A 1O6BA 3MLAA 4JYZA 1ZUNA 2H29A 3A04A 2JA2A 2XRZA 1O0CA 4MVCA 2DUMA 3DO8A 2A7XA 3IMEA 2J5BA 4ARCA 1U7XA 4Q93A 1NSYA 4DNXA 4ZCTA 2DERA 3IOEA 1VLHA 1J70A 3N8HA 2VTBB 4MW1A 3Q12A 2ZP1A 2A88A 1YIAA 4HPWA 2CYCA 2QTNA 3CLSC 1U7DA 4G5YA 4YP7A 3PNVA 2GOYA 1COZA 3X1KA 1KAMA 3NBAA 3H05A 3M5WA 3CVWA 1YUNA 4MW9A 1J21A 2J09A 3N05A 2DPLA 2PZ8A 4YMIA 1ILEA 2CT8A 3UMVA 3RBAA 3COVA 1KQNA 3A05A 3UC5A 3FNRA 4E1AA 3IUBA 4MUFA 1YULA 1JECA 4U7JA 2NSYA 1N2GA 3SZ3A 1GTSA 3KT0A 1JZSA 5FO1A 1KP3A 1VL2A 4L2IA 3MUEA 1QRSA 1QJCA 1WQ4A 4EG7A 1EXDA 4U63A 2O8VA 2RE8A 4EF6A 3KFLA 2DR2A 5IJXA 3OP1A 2J08A 3IVXA 1N3LA 4I6JA 3H97A 4UZFA 2PG3A 3GMIA 2B7LA 1G8FA 3CLRD 3VU8A 3ZGZA 1I6KA 4KPUB 3IVCA 1J1ZA 4EG4A 3FI0A 4A91A 5DK4A 1M8FA 1WOYA 1OWLA 5J5AA
chains in the Genus database with same CATH superfamily
2RBKA 3MJ4A 1OB2A 4KJXA 1E2QA 2J0EA 2J48A 3TTSA 3DLHA 2R25B 1U94A 3QFHA 4TZ6A 1E2LA 2ECPA 3TPFA 1RRFA 3I9MA 2P3SA 2ZRFA 3E53A 1QDEA 2CJWB 4K1LA 1W0JA 5L7YA 4YNBA 4BX2A 1YWGO 1KC3A 4P92A 2ZRNA 3Q4GA 4LDZA 4FCVA 4YUWA 1JKXA 3ZQUA 2ECFA 4Q1EA 3A3KA 2FMKA 3TLAA 3F9IA 4LS3A 3PUYA 2EWMA 3SJBA 4BVLA 3H2ZA 5FJIA 2AN4A 2GEBA 3GFOA 4PRLA 1H4SA 3LOQA 3REFA 1KBQA 4WNIA 4B7CA 4NG4A 1XWFA 1RXEA 4MQFB 1C14A 3ZWYA 2ADFA 2YJ3A 4AN1A 4V39A 3GK3A 3IA2A 5EWLB 1QCYA 3RC7A 2HN9A 5JJCA 1DCTA 1CYDA 1Y3BE 3HFJA 3LUJA 4TWBA 1LNQA 1HXHA 2VPTA 2A59A 2OD2A 2ZPUA 3DDHA 1T4GA 3G79A 4PWYA 4A8JB 1BRMA 2PGOA 2ZUBA 3KB2A 4KXWA 5P8WA 3T4XA 1AKYA 3K4PA 1SCUB 3ZIAD 1JG6A 4CE6A 4EVQA 1Z8HA 3PNMA 1OXKB 3A1DA 1NNEA 1OKKD 1U9YA 4IF4A 3ZYZA 3I2FA 2YYYA 3AI1A 2Q5CA 1GGNA 2FVYA 4PYOA 1XCGB 1GTJ1 1BX3A 2Y66A 1KIMA 1PS9A 5FOTA 3OY7A 4B1FA 1G98A 4NEGA 4PCUA 5EMMA 3KLMX 2Q4RA 3WBJA 3QSGA 3T5DA 2QW1A 4QTXA 1UF9A 2PO7A 1F6BA 1I4LD 2QLBA 2QORA 1E8DA 5C35A 1PSZA 1Q1BA 5AMXA 2KYRA 3GL9A 2EEPA 5KTNA 4ZCRA 3PFFA 1X8JA 2Q1WA 3P27A 3SJCA 2P4EA 4BWGA 2YYAA 3E9ZA 3W5BA 2DBVO 2VNSA 3K5IA 1IAVA 4G89A 5AYVA 3FKJA 5CBPA 1O77A 2WE8A 4DJTA 2C9OA 3G8AA 2BFAA 4IXJA 1GNVA 4WOKA 4Y6OA 4ESEA 2AD1A 3OJWA 4B2IA 3RS0A 4F38A 1PT5A 3OOHA 2MOKA 2PA3A 4LYAA 2RGBA 3ZI7A 4F56A 4CR7A 3IQZA 3FGOA 4P86A 4FFOA 1YZQA 1L1EA 3CLTC 1QFZA 2O3SA 3HJFA 3ZNNA 3H2YA 4JOCA 4OHCA 1NLZA 2OXRA 4Z9AA 1RPZA 2NUPA 4RFSA 1IJKA 2Q0SA 4LPSA 4XXHA 2AFHB 2BF4A 4FBGA 3N2KA 1Q0QA 4Q3EA 3UT5A 1BW9B 4H1TA 4DZTA 2P8SA 4FMCB 1FNBA 1XD2B 2X0DA 5ERXA 1W6RA 3R3HA 2WJWA 1DAGA 1TVCA 3DB1A 5E4TA 3ER9A 1TF2A 1SIOA 1DCKA 4FE4A 3UENA 1QS0A 2BP7A 2I4OA 1LU9A 2Q5OA 1CUCA 2UZAA 1FJ2A 2R6CA 4GZ5A 3GLIA 3MTIA 4G1FA 4S2UA 2I9PA 1PLJA 4R7ZA 3GLQA 3PEEA 1DBPA 4JBWA 3HA7A 2PFKA 1EFVA 3GCWA 2HEGA 4O5AA 1ANKA 2FFBA 3OAAD 3PENA 1D2NA 1ADFA 3N2ZB 3DMDA 4IO1A 3E84A 5KVVA 3HUEA 4FFDA 1TL7C 1F8XA 2CN1A 2G28A 4M2LA 4ND8B 2C2ZA 1FYVA 4RE5A 4REQA 5COQA 8ATCA 3KC2A 2IODA 2GCGA 2MMGA 3ASVA 1Z5NA 5TQVA 3B7PA 4AG3A 1R64A 1I5RA 4E5YA 1KP9A 3S2UA 1YE3A 1VCNA 1YMVA 2R1UA 2GBLA 4YK7A 4P4SA 2HYDA 4A2QA 4BGEA 3THWB 5DBOA 2A7QA 4DLZA 2RGEA 2CKMA 4CLDA 4WPGA 1JFLA 5EQJB 3QFFA 4NNPA 3EMBA 1U7TA 4BIIA 1ORRA 4EELA 4BXOB 3QWBA 2YY7A 2AUTA 2WUWE 2Y0EA 1XB2A 3OUTA 4RCZA 4HO1X 4GKKB 3BMCB 1CW2B 2BFDB 4MV3A 2W6CX 4I5GA 3CNQS 5THQA 1I7QB 1S0UA 3OCCA 4WGFA 5FCDA 4MW4A 1FMTA 1SBCA 1GU0A 3HDQA 3AUJB 1IDN1 5K3FB 2H4XA 4UCQA 4ZQBA 4IOJA 5EQTA 4O8CA 1FY2A 4BQNA 1CV2A 3CZ4A 1NUPA 1RQRA 1WO8A 2D13A 4CLHA 3WDLA 4AF8A 1W5TA 4TVBA 5AJZA 1FRFS 2C07A 3P2IA 4MW0A 2E0IA 1X0VA 4G5SA 2GBIA 4U4AA 2A53A 2A5GA 5J4LA 4DCGA 4EMTA 1VLMA 5TEVA 3DOIA 2FMFA 2W8BB 2EFGA 3NT2A 2IU3A 4HJRA 5IF3A 5AW2A 2IZZA 4JI6B 2SBTA 4MKHA 4M9UA 2OK8A 5JQGF 2IH2A 4I1YA 1U5BB 5DF1A 4AXBA 1TRKA 1S8AA 2CSUA 1G20E 3CVJA 4KUHA 3EYWA 4M87A 3ZY4A 4GH5A 1AKEA 2NNWB 3QTBA 4UTXA 4JWKA 1C7FA 2BR5A 4N65A 5KNBD 1T34A 2H4FA 3PNPA 1T6XA 1RJ9B 2AJCA 1SOAA 2ZFUA 4R2WA 3M6WA 5A0FA 1ZBQA 5IYZF 5KBYA 3BVPA 4HCJA 1GEGA 4L5BA 2A0XA 3ND9A 5CLIA 3AX6A 1FFCA 5AVOA 1IHUA 3U62A 4BGDA 3E2MA 5IHPA 4XEHA 1QV6A 3G9ZA 3P71T 1LBEA 4Y1RB 1F8YA 2QQ0A 4DSUA 4E22A 4WESA 1UOOA 2IHUA 2BFOA 3SJZA 3TR5A 1YZGA 3BERA 4URWR 2FFJA 1TKCA 4UEQA 4ZA2A 4H7EA 5JEDA 1Q7CA 5CVCA 2WQ6A 2VN8A 4CM6A 4YUXA 3IH5A 3BL5A 1XN1A 1WR8A 2XX3A 2HJHA 1BJRE 1LBQA 1YASA 2J4DA 2Q8QA 3FZEA 3PDIB 4UAGA 1F4LA 2VHZA 5AHRA 5DI9A 3RNLA 3T3IA 4L1KA 2JFQA 5D1NA 3K0SA 2NZVG 3DDWA 4KXVA 3IQHX 1AV7A 4UZSA 5LVAA 2B1IA 1QNFA 2JGRA 4FP9A 4ZXFA 4OATA 4DRZA 1FRVA 4JGBA 5LJIA 1R6XA 4C01A 3IHLA 7GPBA 4XSHA 1C1XA 3RC1A 2EKLA 5LQRA 5BQ3A 1II9A 2TSYB 3MEQA 1ARZA 1NVDA 4GSYA 4PSVA 4B79A 1FFSA 1L5ZA 1XU9A 2FKNA 4TRMA 1ZM4A 3KLBA 4M1ZA 3HYNA 2G0TA 4A0QA 1G3QA 5DX1A 4RAQA 3FAZA 2NU6B 4C6HA 5IDWA 4OF4A 3PF8A 3LQRA 4AMYA 2Q0QA 1B3RA 2RHHA 4GHWA 1Y8CA 2WB2A 5G0UA 1Y6GA 1XL0A 5EIEA 4KR2A 5LM3A 4X44A 5EPOA 2ZW9A 2IYNA 3AJ8A 1ZJJA 3KM0A 5ILGA 3V80A 3H8SA 3AVVA 2QM7A 1GA4A 2DULA 4B3SB 4I4TA 4KKVA 2OY0A 4H0NA 1M6YA 4K9SA 1E9AA 3LLMA 5JH7A 3JQGB 4PZEA 1HR0B 3OFSA 4E14A 1OUMA 3DEAA 1L4UA 2WHPA 4J2TA 4Y2TA 5D51S 4EI9A 2LP4Y 1M6NA 1LSOA 1NSFA 4WXMA 5NULA 2IVFA 3U1TA 3STUA 4IEFB 4EIWA 2Y99A 2DECA 1X9IA 3QVMA 4TTVA 3WGLA 3FDFA 1HDOA 1ADBA 2OUIA 2RGXA 4N8EA 5F1PA 3MB8A 2UYCA 3PQ2A 4PHFA 2CXTA 1B0PA 2D1FA 2Q4EA 3GZ4A 3RUIA 4C6TB 5C5IA 4F91B 5J4YA 16PKA 1AV6A 1Z6TA 1SJ9A 2JFGA 3PX3A 4Q3DA 4K05A 4L9SA 3QE3A 3P0RA 5I8WA 3VR1A 2Q1YA 1EU1A 2VG8A 2VPQA 3V2HA 1Y6QA 1E3DA 4HDOB 4U0KA 5FR1A 1JHYA 3K6KA 3VH1A 1HSOA 2JVIA 2O1XA 4RH1A 3NOVA 4GZLA 2GDZA 4INZA 2O59A 2HMTA 1LWNA 1DEAA 3KQQA 4WCVA 1X7ZA 1L5VA 2X23A 1UDAA 2VCYA 3I5AA 4QGHA 5K0TA 3N3BC 1Y8RA 4EVRA 1WNFA 1RBQA 4K8OA 2FUG6 4BZXA 3USZA 4AQ7A 1B14A 1VJ5A 3GRCA 1KDVA 4YJKA 3EZ7A 2XWJI 1CE8A 1J8VA 2HUNA 3EZ6A 3JQAA 4L0DA 1QH1A 2OYSA 3EAGA 5CK5A 3QF7A 3WJ1A 2BMWA 4CMBA 3L4SO 1THGA 2XE4A 2W6ZA 4L08A 3SIXA 4LEIA 3S6JA 4TVSA 2VHQA 3L06A 4ITUA 3GR6A 2O2YA 4TRNA 2BFFB 1P91A 2GWRA 2VYVA 4WX2B 2AN1A 2E18A 2F1HA 2QNBA 3AEYA 3MTEA 3K16A 4I1OA 1C9NA 4U00A 3N59A 2EJVA 1E9DA 4AN0A 1UJ6A 3FCYA 3T94A 1ABFA 1RYNA 3GEPA 1YR2A 3G9QA 3RI3A 3CMCO 2WAMA 1MEJA 5FXMA 2QQ5A 3AY0A 5KOHA 3RVQA 1F8GA 1E2GA 2BUCA 2A1UA 1NX6A 1R1DA 2WIDA 2Y2VA 2X58A 3WBBA 3F4KA 1NLYA 2ZJ1A 1WMDA 3OLYA 1Y9EA 1EK2A 2GK3A 4MMXB 4PICA 4P98A 2WMOB 3A9TA 1L5YA 3DBIA 4G4IA 3PX2A 3DE4X 2PGLA 2J41A 1GXSB 3K32A 3WGIA 1FW8A 1SC6A 4YJ2A 1SK9A 2V7UA 5JY1A 2E4YA 5ITZB 1NF3A 1AD2A 3A3OA 3PB3A 4IIDA 3SS9X 4TMKA 2XCRB 1UMDA 1MAAA 1M0TA 2BEJA 3I34X 4QEDA 5FL7A 2IUUA 1KOJA 5JZ9A 2C9BA 4Q1BA 4GKBA 3PZRA 1JP7A 3RUFA 2OHHA 3O8LA 4JT2A 2IV2X 4JYBA 4R69A 1TT7A 4H60A 4C4XA 1WQ1R 3B2EA 4C0XA 3M3HA 1BDHA 4KR9A 5EIWA 1WZEA 1BEUB 2PZLA 2WLSA 3ND6A 2P9BA 1Z83A 4RY9A 4CV2A 2HXGA 5HBGA 1EDEA 3U13A 4TYNA 5ED0A 4ZT4A 3CF4G 3C7AA 4NONA 3B20A 5KTTA 3PVZA 3QQ5A 5EKXA 5B1EA 4NJMB 1T5HX 3PVSA 1ISRA 1BTOA 2IY8A 5KQMA 4FD2A 4V0QA 2FETA 3OZAA 3LCMA 5KDDA 4GLJA 1ODTC 4TMXA 4RIIA 3IXMA 4KWEA 4I9GA 3UGKA 1NF9A 4BC0A 3TDKA 4QUIA 2V5AA 5I7RA 2BGWA 3OKPA 4UDXX 4AZ3A 2QGZA 1GZ4A 1L8OA 1X2EA 2P67A 2PQ6A 4Y6LA 3L4BA 4CFZA 3R8CA 1EJ6A 5F2OA 5LZ8A 3EVEA 2WPNA 2AG5A 3AVYA 2EP5A 1DVRA 1GSHA 2Z30A 1UC8A 5B53A 2H59A 4YAKA 1G66A 1RHMA 3UHJA 3V6LA 1GT91 1R0XA 1NJ5A 1DINA 1RQLA 3W2TA 3IVRA 3ZY5A 2VOEA 1CUDA 5B4VA 5L4LA 1JFSA 2NP6A 4JYZA 3J7TA 2HSWA 1HDYA 3E2PA 1A8SA 3A04A 1YS9A 3D0RA 3DO8A 3MAGA 2XBLA 5JEEA 4QJIA 2VJOA 1Z4JA 1TZBA 3VISA 3QHAA 1AE1A 1J70A 1PK9A 2C2HA 3OTQA 5U4XA 4B6FA 5EESA 4AZVA 1CDOA 1SCBA 1DL5A 4MW1A 4X95A 4KXXA 2RBGA 3WNBA 1PP4A 4RKWA 3M6IA 1WZUA 5I3ZA 2QTNA 2W2PA 1CDZA 2P40A 1CP3A 3LX5A 5GJBA 1XLTA 3EEYA 1RPJA 4MYRA 4WQMA 1G0NA 2EW2A 5EXDA 5M29A 3MJTA 1NZDA 5GVRA 4YV7A 3I53A 1OV6A 3IT0A 4TUYA 1FU4A 3AFGA 5DMHA 3TGLA 4OHYA 1U1CA 3TSZA 1KOGA 1XO1A 4DOMA 5CB4F 1GRVA 2CT8A 2OXFA 4WZBA 3UC5A 4BLWA 1RYEA 4UREA 4MUFA 1DC8A 4MK4A 1TUIA 3B1FA 3BK2A 4WRRA 3YASA 2CZQA 3OECA 4TN1A 1WMAA 3DUFB 5DM2A 1GSOA 1X42A 4LDJA 4R8VA 3W6ZA 2QIPA 5KJ6A 4RZHA 3QPDA 4C30A 1UZNA 5K3SA 4K6HA 1FYEA 2R6GA 4M1MA 1FRQA 1Y34E 5EJIA 4UM5A 3ZHBA 3ZHCA 4BB5A 5FAXA 3DZDA 2XOEA 5AQEA 4GLFA 5AD1A 5F4ZA 2FWPA 1FFAA 2FPUA 2CXHA 1HFKA 1EVEA 4PPYA 2B5VA 2WUGA 4GXTA 3DR5A 4YJHA 4D9JA 2G04A 3SBEA 3E2IA 1YFKA 4ZDWA 1FXUA 5BSWA 5LWHA 3NHRA 1CEXA 3SHQA 1U7ZA 4KPUB 4UAJA 5L53A 1MCZA 2PQMA 1CUWA 3IT1A 2ILTA 5HZMA 4A91A 1AQYA 2FI1A 3BDIA 4CM8B 1PWZA 2DWCA 2GJSA 2HMVA 1XXHE 3H42B 4HYYA 2C5BA 3MRXA 5DK4A 2UVPA 4FT4A 4EQ6B 1RRMA 4U7FA 5D1HA 4IQ8A 5TEWA 4XCVA 1F9AA 1JPVA 4CNBA 4DZZA 2JZCA 2O0KA 2QI9F 2IU4A 4JUCA 2Y0CA 1FRZA 1QYXA 5ALYA 4BJ1A 4C3UA 1EG2A 3BD6A 2C4MA 2JG3A 5C37A 2G5GX 4ML3A 4XPIA 1NRWA 1O95D 5FDFA 4FDUA 3ABIA 4U8GA 5FPHA 4OH1A 4CMHA 2FTKE 4LQDA 1XTZA 5C32A 4W5OA 1QOPB 1UBOS 4O63O 3ZC3A 2JVKA 4UUMA 5KAPA 3W04A 1N8NA 4BLPA 3DZFA 4CT4B 2AQHA 1CY1A 4BRUA 4C7VA 1BHSA 1C3EA 4WEOA 4XQCA 3OJEA 3C3XA 4BWVA 2M1ZA 1U3WA 3M34A 1W0CA 2HU2A 4AJPA 2Q3FA 3I6YA 4FWIB 2HREA 2MYTA 2UYQA 3UPDA 1NYLA 4QU5A 2OB2A 4XWTA 2EKBA 5HF6A 1TEVA 2CJPA 1DBQA 2E87A 1MRZA 3OMLA 4I46A 1FSFA 3LHSA 4IILA 3X1YA 4C2UA 2L82A 1S96A 1QK3A 3EG9A 2I91A 2ZM5A 2G0AA 4FDMA 3ZGXA 3ROGA 1Z0IA 3VPSA 4JYAB 2IKQA 3ODGA 3KOOA 1DX9A 1NFFA 1LPAB 3V1YA 3WK8A 5C5CA 2JIQA 4B7AA 2G5TA 2CXOA 3FSGA 1ISMA 1JRLA 1U7WA 3LBNA 2P9EA 1RJWA 4KO1S 4M9QA 4W82A 4CF4A 4UTVA 1Y4AE 2WMDA 5FLKA 2X0KA 4F3CA 1G6OA 1XDGA 2NTYC 2LMEA 3BTVA 3ZWNA 4MRSA 4QDXA 1M1NA 4Z8XA 3PD7A 3PLNA 4EENA 5JQGB 1T2FA 2G25A 2Z3VA 4TTRA 1MO5A 5DBFA 2JGKA 5HIAA 2HCRA 4ITVA 4XAQA 1WM1A 2FR1A 1O0BA 4N54A 3PE4A 1K92A 4FSDA 5JE8A 3BHNA 1OC4A 2ZSIA 5JNWA 2BEUB 1AZSC 1PDOA 4AN4A 5ITSA 5B7PA 2A3NA 5IYZB 1EP1B 4BVGA 3HYSA 2Q6LA 3E48A 3U4HA 1PGPA 1M8PA 1K2WA 4XW2A 4CKCB 1FTSA 3DQZA 1XZEA 5F7JA 3HMQA 1JMKC 4UM7A 2ZT8A 3QG1A 1EMDA 4GZMA 3EX7C 1F14A 4IJUA 2QTGA 3ETHA 5IVKA 1T3GA 3MYRA 3L7LA 3O2JA 4MWZA 2Q1TA 2ZYRA 2VK2A 3BKXA 4DG9A 4PFSA 2XMBA 2XXJA 3DM5A 2JDIA 2VDMB 3KWFA 3N0VA 1VRWA 3SIWA 3HR7A 3CZMA 4GI2A 1RJDA 2JANA 3UHFA 6REQA 4BO6A 1N5DA 2QXTA 3RK1A 4YRJA 3SC2B 5JYEA 3UFXB 2ZRDA 4IICA 3KVNA 4NYJR 3BJMA 4O2BA 4CBVA 5LZ9A 1G8PA 3KLNA 4QGAA 2WUFA 3KOUA 4WIAA 1I7SB 2R1VA 5KDLA 1JMYA 5KINB 1T36B 1TECE 3TW4A 1A9XB 3WO1A 5HDQA 4LHZA 1FDVA 1G18A 4RCVA 5E7MA 1Y3AA 1N9GA 2VP0A 3EK2A 3ITEA 1CQWA 1TO2E 1A3CA 4P9NA 5EWMB 1Q1NA 5J1SB 4QLOA 3H1AA 3RS4A 1XL1A 4E6EA 3B3AA 1U4SA 2A4KA 5I5GA 4AO8A 4JOQA 1E3WB 2PUJA 4L7QA 4PLCA 1GKIA 2QUHA 3PBKA 1A50B 2H1SA 2BEVA 2JZOA 2WILA 5TJ9A 2GN8A 2GUGA 3MBOA 4GMHA 2OD9A 1XTJA 2ZU6A 5C7LO 2FSIA 4NS1A 1CZKA 3HCAA 1MHTA 3PNYA 1QGYA 1SUCA 1GUZA 2AA3A 4JN6B 1EQAA 1NQWA 1OAAA 2ZB8A 3KYCA 2FEPA 4XCQA 3SKYA 3ZWQA 4S05A 2RGGA 3Q3GE 5BW8A 1P6QA 1N8KA 1ZK4A 5LA6A 1Y42X 4PYKA 2V7QA 3I83A 2II6A 4TZTA 1V9LA 1IAQA 4PZLA 1YJ5A 1SD1A 4RFLA 2RI1A 1TM4E 3IBCA 4C04A 4JASB 4DG8A 1XWWA 1NBWB 2EZTA 5C7YA 4YCNA 3PC4A 2AX4A 3G89A 4TTIA 3WWOA 3C74A 3T5MA 3FPHA 2GN6A 2MWMA 3M3DA 2CV2A 1OWNA 3WWCA 1TUEA 1OH7A 2F00A 3SLGA 1H1DA 3A27A 4D6XA 4FU0A 1ZNQO 2BM0A 3MFYA 4Y9UA 1RZ3A 2CZGA 2Q49A 2IX9A 1CR4A 4KNYA 1S1MA 3F9CA 3KDSE 1E0JA 3BRQA 1DJOA 4Q7MB 4BGIA 4Q9AA 1KETA 5G1PA 3KSAC 1MEEA 2R751 5I9LA 5IKXA 2JARA 3HLYA 3IEIA 4FFPA 4GXRA 3CKLA 4ZJYA 4LF6B 3QZUA 4OUDB 3OMXA 3H9GA 5KYYB 2IBTA 2IDMA 5A7HA 3U4AA 3HY3A 3W2IA 3AT1A 3GPBA 1SEVA 3U3MA 1ZWKA 2QXYA 4GOKA 2IHVA 4MRMB 3MSXA 2GR7A 4JUDX 4G0WA 3ETCA 1GPMA 5GOZA 2G09A 2XI4A 3ZUPA 2KX7A 1V7CA 4JC5A 4B3MB 1NTRA 1MORA 2J85A 1N6KA 2C9DA 1RZVA 2O4CA 4H15A 4NL4H 3FPFA 1IXSB 1E18A 4Y2QA 2MR6A 3A11A 3A4MA 3QVUA 3UOWA 2ZTMA 1GTVA 5BMVF 3AH8A 3L8HA 5DNAA 4OU5A 1K89A 1CQPA 4W8HA 2FEAA 5EJ8A 2Z5GA 1ZBDA 2QX7A 2EBUA 1MB0A 2IPLA 2ZS9A 1Q3KA 1E63A 2O0MA 3AERB 3OLVA 4WKBA 1GUFA 1YFJA 4YUVA 1JG7A 2AZXA 3H11A 3IMFA 2Q2WA 3ZWKA 3BB1A 3OZBA 3F5FA 3KTAB 4YRNA 2AYYA 4TPKA 2JJMA 4FGJA 1SVOA 4RX1A 4F46A 2XCLA 4B2LA 1A0OA 4G24A 1DIRA 1Z2OX 3V7NA 3V1KA 4XM1A 3DWFA 4ZAGA 4YACA 2ZAMA 3LC0A 4ISBA 5KUTA 2FR0A 4TL9A 2VCEA 5B1DA 2O3UA 3A6PC 3OUZA 1QVWA 3SI7A 3H17A 5EHNA 4IUDS 5JVDF 3OIDA 4PO9A 3AF2A 1CKEA 3ZWCA 1U3FA 4AWBA 4X20B 3RNOA 4HBGA 5CFQA 1KFJB 1F5NA 3T3HA 2N3ZA 5FTMA 1S89A 1U0TA 3EGDA 2G7MC 4IDNA 3GUZA 4CIWA 1T9BA 4X3CA 1M0EA 5EJ7A 5KYWB 5AKJA 4LZLA 1U9CA 1NQXA 4N4AA 4LC0A 1W7AA 2BCGY 5K0EA 3UB3A 1VQ1A 1CRWG 3IQXA 2Y1FA 3U7QA 5T4FA 3R5FA 2GYYA 2Z8YM 3IFSA 3VH3A 3KYIB 4ANFA 3F6EX 1IY0A 1FXWA 3DHWC 1ML3A 3NP7A 1NNLA 1WB4A 1KQFA 5FP0A 5A3JA 1DOAA 2DPMA 4MV1A 3PC3A 5I9BA 1MZVA 4J6FA 5CW1A 3RVLA 3VDMA 3WB0A 3WVNA 4AKEA 1S9HA 5LOVA 4LSMA 1ZGAA 9GPBA 2JW5A 4B75A 4HTFB 5C4IA 1ACJA 2W2KA 3W5HA 3EC7A 1KSGA 5HRCA 3KPUA 3PEYA 5EQFA 1A8HA 1RRVA 2QVYX 2WYUA 4KU4A 3ZD8A 2A35A 3ZQ6A 1CVIA 3IOYA 1BX1A 5KJCA 3UAZA 2FP4A 3WQSB 4F45A 3K6SB 3JASB 2CHFA 1K7CA 1D8TA 3H2SA 3ZU4A 4Q7KA 2SECE 1ZM3A 3F2IA 3ZTYA 4K9KA 4WV3A 1IWBB 1P62B 1U0OC 1B3BA 1QGED 1QVZA 4KMOA 4A1OA 1AIPA 4IJWA 4IGEA 1DXQA 2EKPA 3H0KA 2YVKA 3P32A 5CNIA 5LZ4A 1HA3A 1I2BA 4HHEA 4QWMA 4KW7A 5H8WA 2BSQA 5A04A 2GAFA 3QLEA 4N8DA 3ENVA 5EZYA 4R84A 3BEOA 1SBQA 1EBBA 1ODJA 1U6IA 3C7CB 2ALJA 1TZKA 3QKUA 4OP3A 4J7UA 3ZXUB 2WUVA 3UKOA 1TC1A 3B78A 3U4CA 2Z8ZA 3PFCA 2O6HA 3BH7A 4H0FA 2A9OA 1NU6A 1KO1A 3WK4A 1NUUA 3P9ZA 3GQBA 1KJWA 3NOXA 2BFPA 3DR3A 4IOKA 1M8KA 1W4LA 3ZS8A 13PKA 1AK1A 3PL5A 2P27A 1NN0A 2DY0A 1OAKA 2REQA 3MOGA 1OOEA 2NO1A 3FLAA 1XU4A 4E7OA 2X8JB 3ND8A 3NALA 2OFFA 2BGNA 2J7PD 4UBNA 4ZMSA 2X9VA 1E4VA 3JW8A 3OEWA 1JKMA 2GAOA 2PX4A 5FADA 1CHNA 4MKRA 4Z2YA 4BBPA 4OSPA 5JNVA 4J0CA 2BGLA 1ESZA 2YS7A 2ES4A 4CMJA 1XZIA 3ICWA 5CB4B 4RHXA 1L1FA 5CLLA 3WWZA 1FFEA 3W3AA 1H2RS 4JR2A 5TDHA 1BVYF 5ECYA 2PT7A 2PUGA 2BGTA 1I4DD 5IVDA 3SQNA 5AUNB 2ZYGA 2ATXA 3ANNA 3PGVA 1MV8A 3QJYA 1OFGA 1L6IA 5AVTA 2EP8A 3Q15C 3BUSA 1TIPA 1N1DA 4BYMA 4FSHA 1ZK2A 3AETB 4GRIA 1T9ZA 4JGIA 2AKAB 1ZEJA 3MUNA 5FTKA 4AT1A 1PJQA 4I3HA 3WMRA 3MBIA 5GZ6A 1F9EA 2HHLA 2GO7A 1C4XA 4H59A 4HADA 5TF4A 3T0IA 4M86A 3LFTA 3ZOZA 2Z0MA 4ACBA 1JPUA 3JD1A 4RK1A 3TGPA 4MVYA 2FZVA 5DN9A 1HT3A 2Q5JA 2WT8A 2P90A 3HKBB 1VSVA 3P1JA 3FVVA 4NARA 1KK0A 2Q27A 1K8YB 3VKHA 1F6WA 2YJTD 3KZOA 4E4RA 2F3TA 3NONA 4LA4A 4R51A 1QRTA 1JH9A 4OA8A 2A1IA 4BEVA 5I7AA 2MSEB 4NBLA 4HAWA 4G9EA 1D0IA 3UAVA 5HKKA 4M0FA 4NABA 3VR5A 4B0PA 2PH3A 3MCZA 5K8UA 5I4BA 1SXJC 1JHMA 2IYWA 4R2XA 1B0ZA 1XTSA 2PT9A 5AI8A 1UMCB 3LX8A 1KI4A 5CT4A 1GKKA 3U5ZB 1JVSA 1J2YA 1Y7HA 1RKUA 3GLUA 2D62A 1H23A 1J0CA 4DAOA 3MB5A 4TXNA 1S8NA 2EF1A 4ZJZA 4K46A 1EFCA 3FROA 4BNFA 5KDOA 4A0FA 1XJQA 1OU4A 1J99A 2CFCA 1ORDA 5BUSA 4MV7A 5LSAA 3M82A 2NYRA 4TVOA 4WKGA 3T6KA 1AO3A 1NXXA 1N2HA 1WY7A 2WZBA 1ATIA 1AN0A 1QG4A 2YHIA 3MELA 2E4ZA 1YI1A 2IOFK 2XF8A 3O9ZA 4M8IA 2IS2A 1PR0A 4FWTA 1LW7A 1QFJA 2C8LA 3T4UA 4CKEB 1GNSA 2QX9A 1UIMA 1E4EB 1MLDA 2P9CA 1B0UA 1UAGA 3A1FA 3DBLB 4I50A 1EVIA 1ZUNA 4II3A 2XQGA 4UQOA 1NXTA 5GPBA 4HDNA 5BMOA 3PYXA 4Q7LA 3PWSA 4FBMA 4MITA 5LJLA 3FZNA 4GE0A 4GM1A 3I37X 1U80A 3RVPA 3WLLA 4N82A 4F5DA 3EXEA 2Z6QA 1N2CE 5AVZA 3DKIA 1AGRA 2OHOA 3IOEA 4H4DA 3OG9A 3ZI0A 5D84A 4DPKA 5JWOA 1RAEA 2HIAA 2VJCA 2O57A 3EC2A 3I73A 2A67A 2AFHE 2P65A 3ON5A 3HI6A 1HKHA 2G07A 4I5DA 4MR8A 4CIVA 3P4YA 2PS1A 3EZXA 3O8OA 2IH5A 4V38A 5CHYA 4BJ6A 5L9AA 1YONA 2BIFA 5AOBA 1AF7A 4CKBA 5E6UB 3S1SA 3KQPA 3AIKA 4HQOA 5ARCA 3FJ1A 4AMVA 4QECA 1MENA 4OAOA 3X1KA 4KCGA 2IPXA 5DM4A 4GECA 1U1IA 4FKZA 1SPXA 4HH3C 1E0KA 3U3XA 1FLNA 1P2BA 3EZGA 4WN3A 3WV4A 5B3JC 1OT5A 4CPDA 3AP3A 3IUNA 4X61A 5E6SB 1R3DA 1QIDA 3UMVA 5HW0A 3HC7A 3PQFA 1N5RA 5LQDA 1A27A 2Y6UA 3HJGA 3N2LA 1WSDA 1BVRA 1TVEA 3MPUA 3SZMA 4Q82A 4N48A 1XZ8A 5GOTA 1N2GA 3FN4A 4EUNA 3ELUA 3JSAA 4NENB 4YROA 4ENSA 3DCIA 4OOEA 3VR6H 2QRKA 2WD8A 4ZZIA 1REQB 3G7UA 5LNK6 1LNZA 4HN4B 1L7EA 4GLOA 4X1KA 1RWKA 3LGAA 4QE3A 4OM7A 3L0ZA 3TIVA 1LK5A 4NF2A 4J43A 4X1IB 4HMPA 1HOXA 1VA4A 4BZZA 4CDRA 5A6SA 1RE1A 4IGAA 2CB0A 3V9PA 2XLCA 1F51E 3ESDA 4EMUA 1R4MB 3UATA 4XVHA 1SXQA 1NZFA 2ZG6A 1R4NB 3ROPA 1XQXA 3BOSA 1ONSA 3UJHA 2I2XB 3IPYA 1PVOA 4MS3B 4MQ6A 4JOSA 3SMQA 1Z18A 3GCXA 4FI3F 3SBXA 4BP9A 4RIGA 3C48A 4K2HA 4LOIA 4BX0A 2HPVA 4HPXB 5C8YA 4TLBA 1FTNA 1M7BA 3IAEA 3JQQA 1J39A 3ONDA 4J1TC 4PYQA 3DA8A 4TGLA 1RW4A 4CEIA 1Z2CA 1CZRA 1Y7IA 1WAMA 4I9HA 5ECGC 4NU8X 2ZXEA 3EIXA 4RIEA 3VZSA 4DJDC 4UEWA 5GGXA 3ASYA 1IXRC 2EX0A 2R60A 1Z6QA 2FJ0A 4YMTA 2AOTB 3L7NA 1E5LA 5IT5A 3RV4A 4NX2A 3L7OA 4JLJA 2V8OA 3M33A 3ZE9A 1C9YA 4MO2A 2ZIWB 2OQRA 5CCXA 3WSWA 2ZTLA 1IN5A 1SC3A 1T3ZA 2N47A 3DWGA 4L75A 1H2AS 4JYCA 5DNVA 1EWRA 1GZ5A 4OJTA 3ZCQA 3LUDA 4Y9TA 3COPA 3PC2A 2ODPA 1TM3E 4KUEA 4Q3LA 1CU1A 5L6LB 3SHFA 2QROA 3H4TA 4WJKB 1I4WA 3IUYA 3Q8LA 4HSEA 2PUEA 1SUIA 2WU0A 2FN9A 3CZ9A 3GLFB 4XE5A 1RWNA 4B6OA 1IE3A 1NG1A 3MT7A 4IF6A 2Y9MB 1N92A 4UPDA 4V3BA 2XCIA 3THYB 3H9BA 1O03A 1BCSB 4UARA 1AQUA 4PQEA 4MLCA 2ZTUA 1V4NA 3HA5A 3IUMA 1X1QA 3AM1A 2HHCA 4B3BA 1J1IA 2YWXA 1Z4NA 1FB5A 1TAGA 3BWYA 5I7SA 2PSSA 4JQOA 5C9ZA 1PTJC 1SAYA 2F1KA 2FOIA 1U2QA 5J2TB 2X5KO 5CH3A 5CCEA 4BWFB 1JFVA 1QNLA 4MJ3A 2WIFA 3TR6A 2QDXA 5EPUA 1AQNA 2P2GA 2PMCA 4JJ4A 1NE2A 2IC5A 1KDYA 4BBAA 1OBVA 2WZQA 1KJ9A 4JCCA 4XH9B 4QZVA 1H9BA 1V8OA 3AQIA 4IDFA 4ZO6A 1X94A 1PJBA 1P0MA 4WOPA 5G41A 2PS0A 3FLEA 2WJJA 1JT9A 3OPVA 4QOGA 3OETA 2R8EA 2Y76A 3DMNA 4R98A 2WTXA 1OX6A 2QMHA 1WMSA 1S2MA 3IRUA 1CSEE 2NZUG 3D3JA 3QX8A 5JYDA 1LS1A 4I99A 2ZJOA 2PRKA 3EA5A 4QU8A 4DKJA 1NR1A 1NKTA 4WADA 4PY2A 4AUKA 4AX8A 3D8BA 4R3UC 4UM9D 3RHSA 1DXOA 3D5TA 4XX0A 3DXYA 3OQIB 1EEXB 1XCLA 1YB7A 2PS9A 2XOKD 4LDRA 3WYGA 3ZYCA 4FVTA 2WYIA 4IIFA 3UMGA 1FVFA 1P9OA 4KYIB 5ED4A 2Y1WA 3LDAA 1VJ1A 3STHA 1ZZGA 4PX3A 1DADA 1MC5A 2GLXA 1ENZA 4FYJA 4MARA 3GX1A 4D41A 2B98A 3TQOA 4TL7A 1R88A 3OOSA 3FBGA 4GPBA 1AX9A 3ETNA 3P2YA 3GXBA 4Z9YA 1XTBA 1U0GA 2O0JA 2ZIXA 2JIBA 2QNIA 4CT0A 1DHRA 3FD8A 2NSLA 2NVUB 4HZUB 4N0EA 2PANA 4QDUA 3TUJC 2G3DA 3H16A 1ZA1A 4GSLA 4N6NA 4RPIA 2A30A 3V4FA 5JVDB 3U1BA 5GVSA 2CLMB 4P4LA 2AF4C 2FZKA 5KREA 3H9JA 4QJ4A 4AM8A 3U7JA 1SKYB 2WAYA 2BH9A 3L6BA 4S1PA 1WL8A 2Z4SA 4JKYA 4NAUA 4I1RA 1XYGA 3GOQA 3QEKA 3WISA 4G0QA 2NVBA 2QX4A 1FX1A 5FPTA 5IW8A 1UBGA 4OI4A 4KAJA 1YBFA 4A2PA 1I80A 1X1DA 1L9KA 5B37A 3GLKA 3W9UA 3D8HA 2NSDA 1GGMA 4KZKA 1A95A 1VIYA 1Y4DE 1ZGZA 1JAXA 1UKEA 1DI0A 3NBMA 1E99A 4OHXA 1S7GA 3ZD9A 7REQA 5HQ3B 1Z4QA 2B30A 1PR5A 4CEJB 5CA1A 5D01A 1NY6A 2Q41A 5TPWB 2PHZA 4KBGA 4XGQA 4HVCA 1K6XA 3AP1A 3IKJA 4XGNA 1D0SA 3PQ7A 4YUAA 1V43A 2DHDA 4W5TA 4HRYA 3KYJB 2WU1A 1RIFA 4L8GA 3ER8A 4JSTA 3KYDB 3NORA 4ND4A 5TS2A 4J16C 3AGQA 4Q3KA 1CNMA 4H77A 3W1EA 3KQVA 3RFUA 2OSVA 5THKA 3VBEA 1BXGB 3WHPA 5DVZA 2C57A 3O21A 4RTSA 3D64A 3NKLA 3GUHA 3V8RA 5CT9A 1ESNA 2IU6A 2VP9A 3O9MA 4Y2XA 4ZPJA 1LRLA 3E70C 3GZTB 4IRMA 4JAVC 3CNEA 1SZCA 4KSCA 1JWLA 1C0KA 2O1SA 1F5SA 3I1JA 4KX5A 2RHCA 4N49A 4PPNA 5DBGA 2P2ZA 3X3HA 4AJ1A 1HDCA 4DA9A 2PFGA 2QLJA 5JCPA 4DCMA 3TD9A 2X3YA 3CRMA 5JY6A 4HUQA 4HNVA 3WIVA 1USGA 1JG3A 1KEWA 1W35A 2F8TA 3R6GA 4FC7A 1E1QD 2YBEA 1HDEA 2J5QA 3ANXA 1ZVKA 3DH0A 4HS9A 3AHGA 5D3QA 3ISVA 3BCSA 1CY7A 3ISTA 1RM3A 2R6HA 4FIZA 4DNOA 3HVHA 1L4HA 2EX1A 4LECA 3ZKWA 1NVEA 4DPMA 4QNRA 2DJ5A 1IWOA 2MSDB 2OAP1 4I5EA 4U2EA 1EJ2A 1WD5A 3ABSB 5F77A 2PSHA 2C4VA 2PD6A 4ZOBA 5D5PA 5FT9A 2YQZA 4BAUA 2HXSA 4RF2A 3WJ2A 5CGQB 2B8TA 1Q17A 2GRUA 3ZU2A 4B47A 3JQAD 4K6MA 2B6NA 3GAAA 2JBHA 3L9WA 1JJ7A 2PMDA 2XB9A 2Q8NA 3TVYA 3ZCSA 5F1KA 1IHPA 1U0FA 3ZDRA 3EPHA 5LLDA 2VYVD 1E60A 3I52A 4KK4A 3SR4A 1PWYE 4LBYA 3VHXB 1Y6FA 4NTZA 1IG0A 3MS7A 3OHMA 1QHHB 3DVLA 3G2PA 4XSVA 1C7JA 1E5VA 2Y92A 4NOLA 1SPBS 1XMJA 5DNDA 2HA0A 2GMWA 2IHYA 1JLRA 4G26A 3ZWVA 4OJYA 2Z8XA 3EMVA 2D7CA 4E31A 3UICA 1A5SB 4E5MA 1TLTA 3HKDB 4LXXA 1RXWA 5AW5A 1JIVA 1PL8A 3EDMA 2OFXA 1LVUA 3IEPA 4AY4A 1AHHA 1E3QA 4EBBA 2YMQA 2YZNA 4ZI7F 3A06A 1Z22A 2VT3A 2WFZA 2YASA 3NLLA 5FUYA 3T61A 2VPYA 1R16A 3T95A 4A8JA 3RLFA 3A9VA 5LBUA 2QP4A 2J1LA 5CJ2A 3UWMA 1QSGA 1Q20A 4DLXA 1PJ4A 2QSYA 1V71A 1NRXA 1N2ZA 5IH3A 1C9JA 3O2NA 1TB4A 4QYMA 4IRUB 3MT0A 5KCMA 3TW8B 1N7JA 3WLFA 2B20A 1Z29A 4A15A 1NLUA 1TYBE 1EHCA 1NVTA 1Z4MA 2AXNA 3M7IA 4INOA 4RJIA 3WLIA 4N01A 1BIFA 1GLVA 1LRJA 1O97D 3GCGA 3IDSA 2C61A 3NFYA 5MDHA 3VH2A 4MWDA 4RLFA 4LVOA 3IR6A 4LWOA 2IKSA 5IMSA 4NFYA 4EFKA 3EJ6A 2C96A 1LA2A 1JAHA 3U9TA 5C7OO 4GW3A 4Q4CA 5BURA 2H11A 1K66A 4HN2A 1FRNA 1UBKS 3DAFA 4HGNA 4QYTA 1COWA 1X7DA 2H1CA 4TS1A 1PDWA 3N6VA 2Q7DA 3R76A 3S7ZA 5I7HA 2GAAA 3OQPA 2C92A 3COZA 2I7CA 2P35A 2HRBA 2OZVA 3DDZX 1DAIA 5ALNA 2ZEJA 1PNQA 1LDMA 3AXTA 3DKRA 3JD2A 1E1YA 1UBJS 3BXXA 2N42A 1YS1X 4N1AA 4RA6B 3TX2A 4BMSA 4LFBB 5JAPA 3IE2A 5DM1A 2YIDA 1DBVO 2P3LA 1K7XB 5EXPA 1VE1A 1ZMXA 3B3FA 5JI3E 5F64A 4OQYA 1KRHA 5EFOA 4EG6A 2DH6A 3M4JA 5CFLA 1I7PA 1O4VA 2D1RA 4MW7A 2B36A 1GV0A 3FCCA 4NCIA 4M4SA 3REQB 1F12A 2PT6A 2K2QB 1O94C 5A5GA 5IBCA 3SHTA 3MRTA 4IOMA 4TLAA 4JZKA 3NDBB 1QQ6A 5HKBA 2EL9A 2R8RA 4QPCA 1P18A 2F9LA 4PO8A 5AKZA 1RYBA 1B00A 3RHTA 3MLBA 2GBPA 1BMDA 1YZHA 4PG6A 4QQ8A 5DHPA 4JROA 4R1OA 1YSCA 2C2GA 3RV3A 4D9EA 4WD3A 1X80A 3EEFA 2YFQA 4ZRMA 1OCEA 1R0WA 1H2ZA 1E9SA 4BHTA 2GRAA 5D7BA 4Q3NA 4EL0A 5E6RB 1GZ6A 4B5KA 4MR9A 3AVQA 4N3AA 4ARBA 3LWDA 5JPCA 4PLWA 5LD2C 1QZTA 2ZYVX 4HB4A 1USKA 4ESOA 1PZNA 5I4CA 1E69A 2A1TS 2GHTA 5JUWA 1SD2A 1Y89A 4KRYA 4MGZR 1AUVA 1GTL1 5CT6A 1R8YA 1DKRA 3AF6A 2WZCA 1CNFA 4QPPA 2Z6UA 3CG4A 3VXKA 4EHJA 1OYWA 3UWDA 3E3AA 3I2HA 1PUXA 3BORA 1SXIA 1DPGA 4FW8A 5AOCA 2YWGA 4N3BA 4OI0A 2X77A 1GGKA 1POXA 1QO9A 2HCBA 2P6PA 3LBAA 3BD9A 3LO5A 4LCJA 4QDJA 4LYGA 5L3ZA 5ERGB 1RXIA 2IYTA 1H1LA 4K9RA 1KQGA 1M10A 1GP2A 4YMWA 4BQQA 4FZJA 4E09A 5C1BA 1XJ5A 2WKPA 5CT5A 1YL7A 1JHPA 2O06A 2OZPA 2Q4BA 4G5QA 3V1UA 1LDYA 2C2MA 4XJTA 4J3NA 3SYRA 3L05A 4FE3A 1T2DA 1MAUA 2X1LA 3LLVA 1GARA 3BWMA 3RTCA 3ZGNA 2O6LA 1IHOA 4B4UA 4H6WA 2DHEA 3Q7EA 3ZE6A 3JPWA 5G4LA 3ROQA 4YT2A 1AGXA 1ZSVA 1QOZA 3O3MB 3FJYA 2PUBA 2HQRA 4EZEA 3L0YA 4B46A 5JLAA 2E48A 2XMPA 4DGQA 4BN5A 1T5SA 1PR9A 2HPHA 4PVCA 4IOLA 5H68A 1U0BB 3E6AA 3TJZA 2WRZA 4RHUA 2JD2A 1NBAA 1H6AA 3WK6A 5KYNA 4PLYA 4S35A 1V6CA 2EJBA 4WLVA 2IS1A 3KALA 1RLTA 2W8BA 4YRIA 4X8HA 4ZYUA 1KAOA 1YDGA 3M1YA 4CKZA 3OLQA 4QOSA 4XRRA 3K09C 3TKYA 3SEQA 5CXQA 5IT9A 5BOSA 4RGBA 1DC7A 1KL7A 1SB8A 1TNDA 4YBRA 4UDNA 1MBZA 1QMPA 4KX3A 2HQSA 4PSKA 4HAIA 5AKYA 3C7DB 1HDIA 4WHMA 3WADA 2V03A 3ZH2A 3LL7A 2COKA 2QM0A 1ZCZA 1G7CA 2PK3A 1E7RA 5IKOA 4IYRA 2OVFA 3IBYA 4M0UA 4BN4A 5EJ4A 1N2SA 1HQKA 4PHGA 4IMPA 4DDVA 1SC4A 1G3RA 2YNMC 3FI9A 2JA2A 1DAPA 2BI7A 1JFFA 1Y82A 2J3HA 4QYWA 3OZGA 2M6LA 2VP2A 1XQYA 1GNRA 3L9XA 2IL1A 2J5BA 2LWIA 2OE2A 2ZANA 1I1QB 1M2VA 3AEKB 3GCZA 5EXTA 5FBZA 2O2GA 3DOJA 4E2WA 3W1WA 2J7KA 1FJHA 2ETXA 2Y1KA 4G41A 4UM8B 4E5UA 3PDIA 4D3SA 2Y05A 1MW9X 4CKWB 3KFXA 3QP9A 4UEKA 1AF4A 1WP9A 1X15A 4N41A 2AYXA 3OJXA 2FB9A 1OI2A 4TXMA 2WJYA 2NU7B 4EUFA 3DZBA 1M66A 5BP7A 4R9UC 3EWSA 3A1WA 3L43A 2WW8A 1KJJA 4XJVA 1H2XA 2YINC 3K94A 4HQRA 3AGPA 2PD4A 3CWZA 3U4GA 3U16A 1ENYA 2IHKA 2VJMB 5EYPB 5A0TA 3R3YA 3FSGD 1GNTA 1UK9A 1E66A 2YZ7A 1X9GA 1AKMA 5LP6F 2JLXA 4Z8YA 3P2EA 4C3ZA 4Z53A 4KVFA 1QIFA 2Q4DA 3ETEA 3QXJA 4MJXA 4A6EA 1POWA 1OXXK 2YS6A 1D6NA 1DBRA 3B9RA 1X70A 3RF6A 3UIEA 3GVXA 3V3TA 5A03A 8GPBA 1W85A 5LP1A 4YDHB 2QYSA 2VUHB 3AFNA 4RD2A 3VR4A 2Y0BA 4LOAA 3DMPA 3D3WB 1UH5A 2G5ZA 2Q5HA 1E8MA 1ZN2A 3ET4A 3QIAA 4U63A 4L74A 4MO9A 4DADA 1PL7A 3HB1A 1JSLA 4E94A 4ER0A 2V74B 1YBMA 3LPAA 3ESXA 1P8JA 1ZINA 2GDJA 2FPKA 3IVXA 1W96A 2DB3A 1D2MA 4K9MA 1L7DA 4V3CA 3NWBA 2XB4A 4UJ5A 4XSGA 5INTA 3U2QA 3KKNA 3IL2A 4BX3A 2MTBA 3A9CA 5EUBA 2Y27A 3HHPA 4ND1A 1H2FA 1N57A 1TGVA 2R00C 4G4GA 5H3LA 3L7BA 2O2ZA 4JEHA 1X7YB 4L7VA 3SR3A 3VDNB 5A5VA 5IJZA 4Y2RA 4QNNA 3RRBA 4YMSA 4RJLA 2B8EA 5K03A 1OXVA 2HF2A 3HXTA 4L85A 2QMOA 3R7LA 1H4TA 2WKRA 4EHAA 3MK31 3DOFA 4KAFA 3TLCA 5IARA 1BROA 2D1YA 5A5EA 3N2NA 1R5NA 2C5FA 3H2BA 1QX4A 2UXCB 4R6WA 1VIDA 4MVXA 4Z86A 4QOHA 1Z74A 2R7MA 4YDSA 4ERXA 1MB4A 2XE6A 3QH4A 5HQTA 1Y1KE 4RU1A 2HTEA 1Q11A 2ZWIA 3WAKA 3OZIA 1GZ7A 1OMOA 2L2QA 2QN1A 4H3VA 4JXZA 1VECA 5CVTA 2O8BB 2PUFA 3VAZA 1HE2A 1PAUA 3OTWA 1GVNB 1EVKA 1NM5C 2XCQA 3GRAA 4RZXA 3NEJA 3OWOA 3TLBA 2A1TR 3UH0A 1C50A 2FG6C 2PUWA 3QFTA 4GR4A 4K03A 5T8KC 1URPA 5ALIA 5AI0A 3WZLA 5CXUA 1H9CA 4TXLA 1V6AA 1FJGB 2HWUA 3A70A 3KZVA 4K9LA 1VM6A 4HDCA 2ZJ8A 4NHEA 4CQMA 3FUTA 1V6SA 4UTNA 2CDRA 2H31A 2DBZA 4MCJA 4LK2A 1M74A 4F2GA 2C3MA 1F8UA 1ISGA 1U2ZA 2QRNA 2HLNA 2AOUA 1NKSA 4XYEA 2PM8A 2Z5VA 2QLNA 3DEZA 4LF7B 1Z9BA 4ID9A 2AFIB 1JIKA 3CLSD 1P6UA 2BFFA 3QPVA 2NYUA 2V7QD 4XB6B 3ZWBA 3CT4A 4I4CA 2VT2A 2OXTA 1YUBA 2VI5A 2Q5EA 4ZDJA 2JFYA 3D8UA 1JVNA 3STYA 4ESHA 3KSDO 1VC2A 4MRPA 1I2ZA 4P5EA 1A7AA 3ZQKA 1CRQA 1JLLB 2FPPA 2WVAA 3KJGA 1Z0ZA 1N5OX 4RSHA 4RV9A 4ZU6X 4DM4A 2LNDA 2GCOA 4PLVA 5CG2A 3AVTA 1JQ5A 4FZ5A 3UM9A 2EF0A 2WVGA 2FUG1 3T4PA 3DE2X 2GLUA 3Q1LA 4HXYA 1ZGHA 2OWDA 1U7HA 3DMGA 4JITA 4DIMA 1ISJA 3ZKAA 2VF2A 3D0QA 4O8ZA 1PZGA 4HNRA 4RC9A 4LHVA 2PUHA 4IXTA 5CXXA 1ZIOA 2HKIA 4MYSA 1ZKMA 2PUAA 1GXSA 3REOA 3L2OB 2NIPA 1CUIA 3AWDA 4WCFC 3HRHA 2DUUA 2AHOA 2LPMA 1AA6A 4DMCA 2BZSA 2OV8A 2YFHA 2ZUWA 1GGFA 2ONJA 5J2UF 3D1JA 2EBHX 3GH3A 4E4TA 3G0DA 4MZXA 3T1VA 4AFNA 1C1YA 4ZOLF 4DCJA 5EP2A 5LR6A 3O8QA 1SXJA 1VG1A 2OXEA 3ZHQA 3QLTA 4YY3B 4BO2A 1D9ZA 4XIJA 5SYMA 1QP4A 4ENRA 3OBBA 4XWWA 2J9YB 4NV0A 2WTNA 4U2DA 4DYDA 2X2FA 3PEUA 1L7PA 4GC9A 4GMGA 3IJPA 4MW6A 3THRA 3LXXA 2DPXA 3ZK9A 5AFSA 5IJWA 3AFMA 4FFBA 2WG1A 4QPNA 2FOXA 4B35A 4CMAA 2CZCA 3RUHA 4KQHA 2YUIA 3C1TA 4W5HA 1CR2A 1O1YA 2KS6A 4OJMX 4ZTBA 1G4UR 1ABEA 3WB2A 2V5VA 5BR1A 1XIVA 3NTQA 2OV2A 2ZM6B 4PN7A 3PYMA 4ZVRA 1XPOA 2V0CA 3G8CA 3ENZA 4QVGA 5CEJA 3SP1A 5LCXA 4BO7A 2Z4RA 2RCNA 4NBRA 2VR1A 5HTOA 2NVOA 1QFSA 4RVSA 3WY9A 4RWEA 4X92A 2HK7A 5HM6A 1KGSA 2H1FA 3TE6A 1NMXA 1PJ2A 1LK0A 3WL6A 3QPBA 1WLYA 1MX1A 2O07A 3LO8A 4ZI7B 4QBIA 5B2EA 4E4YA 2A52A 3D43A 9ATCA 3T15A 2ICAA 4JBYA 1T8RA 2X3FA 1IUNA 3ND7A 5L3SB 4FPXA 1MPTA 1T4CB 5B6JA 3UYKA 5CFZA 4UW9A 4AMUA 3SLKA 2QXUA 3A1VA 5EXEA 3R74A 1P1BA 8ADHA 4IZHA 3DTVA 4NCNA 4S1NA 4UU7A 2JFZA 2OBMA 3L07A 2DMRA 3AUFA 1A7KA 1W94A 3L8YA 4A5OA 5BMVA 1N8SA 4NJOA 1NW3A 4JP1A 1TA4A 4M55A 4HGZA 4XJSA 3IJRA 2FUEA 1P29A 5B3JA 5DBIA 3OZTA 4MYHA 4AD8A 1ZX1A 2QSUA 1ECCA 1QTIA 1DELA 1O9HA 3HR4A 1RAFA 2P2YA 3DMTC 1S2DA 3RYHB 5AIAA 4Q9NA 3T5CA 1KDOA 2XE8A 5BSRA 3AV0B 3WLHA 3H7IA 3MNFA 2DPHA 4HWKA 3S99A 3LPCA 4XLZA 1MP0A 1D09A 1XKLA 4MR7A 1L7QA 2VK4A 4WLNA 3TL2A 3UAYA 4O29A 3TOXA 4IVPA 3G13A 1O54A 4MWTA 4R9RA 1HT1E 3NWOA 4OFXA 2WOOA 4BNDA 3P0HA 2UV8A 3T3PB 4JLVA 5A3RA 3DUFA 5JXWA 2YVQA 3CLTD 4P7BA 1ZN9A 2QVXX 4OMFG 5AM1A 3SDZA 3BIOA 3RQSA 2VAMA 1GR0A 3EIWA 1A1SA 1H2HA 3TI9A 3RRMA 4ZCSA 2G40A 1GJRA 1JKJB 1PTKA 2XRMA 3P2KA 4Z4QA 3DHVA 3JWEA 3FFTA 3QA3E 3L5KA 2QD3A 1V5IA 2FMXA 2HXYA 1G5PA 3JTEA 3WYBA 4CM5A 4EHFA 4QICA 5CJJA 1IBKB 3D4LA 1ESMA 3BS4A 4O1IA 1TIKA 1DC5A 4J1TA 2GBFA 3KUCA 1TD1A 1XVUA 2SNIE 1T8PA 2B4YA 1RCFA 4F3NA 2NAPA 4UHFA 2QPOA 2OCIA 1UBLS 5CA0F 2OK7A 1TKAA 3GAMA 2O1WA 1Q7EA 4I2VA 2M32A 1SELA 2PA0A 2IEDA 2RH8A 4DNPA 4MS4B 3BE5A 1ZIDA 4IDGA 4EA7A 3AQ4A 1XZDA 3CLVA 3AM4A 4GWGA 1ZNZA 3MWFA 4G5XA 4XWAA 4C4TA 3GH1A 2WFLB 1QXSA 4L07A 1THZA 3HJNA 3NHZA 1QTRA 4HN9A 1A4UA 2DKNA 2Q6VA 2NN3C 4RQAA 2QTHA 3I9V6 2ZAOA 4Z9BA 3UOAB 3HHEA 4TMZA 3ESAA 2R7AA 3LY9A 2G67A 1XCPA 2J3JA 3GLHA 4W5QA 2XA9A 1YACA 3BJZA 3N0XA 3OHSX 4RZ3A 4BBZA 1Z39A 5HK9A 1ES9A 4C21A 4ABYA 3F3KA 4CFYA 1IK6A 5AUQA 1IH8A 1WEHA 1ZHHA 3KG2A 1OZ0A 3W3AD 4COKA 1L1RA 3UQYS 2K7ZA 4DJJA 3I0NA 3DUWA 1R9MA 3BSWA 1QQBA 5G0VA 4MDYA 1F3LA 5CXSA 5B64A 4X54A 2OZEA 3A6DA 1JFRA 3P9IA 1AUOA 3C7KA 2GAJA 2PCLA 1MG0A 2FGJA 1UP7A 5G4KB 2XCUA 2X41A 1UWVA 1TYZA 2B4TO 4CUKA 5CG1A 1PTJA 3SU8A 3I5UA 4UUQA 3EGVA 1U99A 1M3SA 3KSUA 3OFJA 3B6ZA 2GCEA 4QSHA 1G19A 2H1LA 3IDQA 3VH4A 4BFZA 1DEKA 3FYTA 4E32A 4EB3A 3NVMB 3PUZA 4Y0NA 2HA3A 4G0VA 2WMYA 3M9WA 3CC8A 1VE9A 3IP5A 3LOPA 1DIOB 2QJTA 3EFHA 4KR0A 3RF7A 2Z08A 4R9NA 3VGJA 2HNBA 2ZJ7A 1AS3A 4ZHSA 2NWQA 4W9MC 4NCHA 3WYAA 3TX6A 3VR5D 2DWOA 1YC2A 2W6QA 2R2AA 1JIJA 1T2NA 3B82A 3F4LA 3VOAA 2HD4A 3K1AA 5JRJA 1YRLA 5JOQA 1P0QA 1V3QE 2UUPA 3CF0A 2J6BA 4BEWA 4ZZ0A 2QGFA 3LLSA 1JDSA 1O8BA 2GK7A 4N5LA 4RORA 5HVNA 4R71A 3KL4A 3N0RA 3FXAA 3LZDA 2W4QA 2AE2A 4B8ZA 1J5XA 1O9GA 2FQXA 3NT4A 1E2EA 4BKOA 4JOBA 4L4SA 4HX2A 3ZHRA 1NJ8A 3CFHL 3RWBA 2OPHA 2FAXA 5BT9A 1EFRA 5LU8A 3EDCA 3L7IA 2O2IA 4LMPA 1SR8A 4KH1A 1YHYA 2Z43A 4LCEA 1RXCA 1JL3A 2KJQA 1X19A 4HDQB 3ZHVA 5HJ2A 1WXFA 2OCBA 4EMSA 5HJ5A 2IXGA 3HZRA 3USES 3VJMA 3DS8A 5F3RA 1A9ZA 5ALMA 1Q50A 2FE1A 1HY3A 1KC1A 4HGYA 3GJ6A 4W5NA 3K9LA 1NN3A 1SD5A 3DVRX 3TKAA 2CF6A 2XTMA 4L6CA 4LXQA 5CBKA 3UFXA 4HNQA 2EEZA 5KOJB 1KJYA 2I5PO 2OENG 2XUPA 1MDFA 3TEJA 1X7GA 2VP6A 4FXPA 2GJAA 1YVDA 2BVNA 2FKAA 1T36A 4EY5A 3QEOA 2WZDA 4DSAA 3GFRA 4WNAA 1KWKA 2OZLB 1DZ3A 3A10A 3ICVA 3IP8A 5LP6B 1MNAA 4QYSA 3SC3A 3Q9NA 2DHRA 1TVKA 2QD5A 2QTLA 1VGVA 3MERA 4NMWA 5ALKA 4ETWA 1E98A 1NJ1A 4E1VA 1QKIA 5JECA 4TWIA 3K0AA 1Z82A 1FP4A 1MR3F 4Z0PA 1NDUA 2CBZA 3TXAA 1BDIA 3K05A 2RAUA 1FJXA 3CPJB 5G1NA 1NKVA 5DM70 5ESRA 3DM9B 2O8CB 2RAVA 2QV0A 4J8PA 1EFTA 2QKYA 1M1ZA 1DXHA 1K0UA 1D3AA 3CUUA 2BE9A 1LV7A 2YIVX 5FNVF 4RMGA 4WKPA 5CEFA 3DHEA 3C43A 4J90A 1F60A 2L17A 3TAUA 2J3KA 3H4VA 1Y98A 1OYYA 2Q45A 1K98A 5BN5A 1DIGA 5F7XA 3BC1A 3W5JA 1LVHA 1Q15A 1TT5A 2DUWA 2GHRA 3DKKA 3WBKA 3WJ7A 4NH0A 3KFVA 3JZDA 2C0QA 4J16A 1TAQA 1RJFA 2BR3A 4GWLA 4YRPA 2P7HA 4AUEA 4LBVA 3NRJA 2WAOA 1BCRB 5H81A 1KAQA 3HWWA 3R2JA 3T8YA 3N0WA 4F4DA 5K0GA 4CEHB 3E18A 5DYNA 4E51A 1T6ZA 1QGUB 1GN9A 3OCXA 4G0XA 4HRAA 4KIJA 4QATA 3ZUGA 1NQOA 1K5HA 2J4CA 1I0ZA 1KH3A 2C1ZA 1T2EA 5KYUB 1TEXA 3DQPA 2NW6A 5FNZA 1UANA 2D59A 1AKVA 1YR8A 1NQAO 2G76A 3A2LA 4GOMD 4GT1A 2F43B 2NXJA 2YHUA 4BUZA 3T3NA 1PS8A 5FIUA 3R3XA 5HGXA 1Y33E 4N3CA 1VYHA 1DRKA 2QLTA 4WDRA 2WV9A 4I55A 4ZV9A 3C15C 1I9CA 2C3OA 3GLVA 4GZ3A 4QHTA 3E9NA 2EKQA 1YB2A 1QU3A 4XARA 4E5VA 4OB7A 4U0JA 5A2QA 2Q1SA 4CQJA 5FWXA 4U7DA 2JLUA 3I92A 4JMLA 5I7EA 1RI3A 5BNFA 1TFUA 2EL7A 1PR1A 4R40A 4C7OA 3WHLA 3ZGLA 4DJFC 2JFVA 1MJGA 3O92A 1RKBA 4NCXA 4FTWA 2W6JA 4GX2A 3I39X 4E0BA 3K70C 4INAA 1WTAA 1J49A 4XM2A 1QWOA 1HL3A 3WNCA 3JAWB 3QKRA 5DBHX 1AZWA 2R8YA 2FJPA 5T3YA 5FOVA 3AESA 4GPIB 4UDOA 1K75A 2GXUA 4M7OA 3GJSA 4ZVUA 3UAOA 1ZRNA 4Z9FA 4H1WA 3KE9A 3LQKA 1PR2A 1V5EA 1YV9A 3KV3O 5KMGB 2OC4A 1R0SA 2WPDA 4HPWA 2FFHA 5EJEA 1DQSA 2JAUA 1NBMA 3N8DA 1DLIA 1QVRA 2CNDA 4HAXA 1SB9A 5CITA 2CUTA 5C80A 3C2QA 2RHTA 3N8GA 1JQLB 2ROQA 1KKLA 3M5WA 1IYZA 1NE7A 2OD7A 2VPXA 5IT0A 2JGMA 4G36A 1J21A 2SKEA 1X9HA 4OQ4A 2ZJFA 1ZFNA 1MU0A 1DTWB 3A0UA 3U44B 1P74A 2AI1A 1QIIA 3CZCA 3ZWAA 4AP5A 3COVA 2JGFA 1KQNA 2IYFA 4Q47A 1G38A 4C4OA 5I7VA 4V1CI 4W7IA 5CPBA 4BO3A 2F55A 5L45A 2WF6A 4MQLA 5DKFA 5F4BA 1XMQB 4TMFA 1L8QA 1KMHA 3PQ6A 3SN6A 1GL9B 2JNWA 4FK8A 2OCXA 1B0AA 3CX7A 4IG4A 3VUEA 5J2UB 4GOND 4IKPA 3WRWA 4BV3A 3HLKA 2VJAA 3E23A 4MWOA 1N7HA 3EMOA 3WO0A 4E03A 2Q29A 3HBJA 4ZOLB 4UC0A 5JPDA 2IBSA 3IIJA 2EAUA 2IZ6A 3OQBA 3Q5DA 4P7JA 4M9CA 5DSZA 3IQWA 3T52A 4EFMA 1HKUA 3LI2A 2IIVA 1T9AA 3TGWA 4ITRC 4B32A 3LNCA 2VJYA 3ILYA 3FZGA 2PLAA 4RV5A 1ZD8A 3E22B 3O8BA 2ZATA 2F1JA 1VE6A 5CLHA 4DREA 4MDFA 1M8FA 5A3SA 1Z6AA 1DU4A 4EFNA 1R0RE 1SA0A 4CMKA 3FYHA 3T3OA 1AZTA 2IF2A 2YC2C 3R6DA 5KVCA 1YJQA 3CVYA 1GAQA 3DBOB 2X2EA 1MTZA 3K0FB 3EXFB 3Q2IA 4RZQA 5EUCA 4A2CA 3EMKA 3NGLA 1FFYA 4ID3A 3PR2B 1CR1A 1VPDA 4I4NA 2I66A 3WA6A 3V4VB 3I9FA 1J90A 1KNQA 4ENUA 3T5GA 1CZOA 5DI3B 4EUKA 1DJQA 1O94A 3LCUA 1EESA 1QHXA 3R5SA 4K6KA 3H6GA 2VH2A 3M6UA 4O0LA 5EHZA 4KPEC 3CZ5A 3LKVA 1DPFA 1MKYA 2AJDA 3ICQB 4K9OA 3FZQA 1QC5A 4AY6A 5KNBH 1FTGA 3DOCA 1KKUA 3DDSA 4H27A 1Z6PA 2R48A 2D06A 2ZAIA 4LKRA 2CVQA 1Z8DA 4CFSA 1HK7A 5AT1A 3HWSA 1EDDA 1CC1S 4GUDA 5BW0B 3RBZA 1NXOA 1RBZA 3KR2A 4KE8A 2J30A 3T4EA 4B5LA 2RK4A 5EMNA 3T5TA 2WKQA 3G2LA 2VAPA 3H5OA 1E92A 2I6UA 3BWVA 3RBXA 3WRXC 4QM6A 2GFIA 3MD0A 4CTOA 1SM4A 4BO9A 4KAXA 2D6FA 2V54A 3NT5A 3RVDA 2C29D 5SZIA 3KLOA 2H17A 1IB6A 1SK8A 4MLZA 4GYWA 1C9EA 5EVJA 5F33A 2OHJA 4ODIA 1DRUA 3TMAA 3AR2A 4HBZA 1CY0A 2Q3BA 4ND7A 4ZI3A 4DV2B 2G5PA 4UUPA 2R7KA 1DJNA 2PXAA 3NRBA 2PEZA 4FOLA 4YMUA 1EXVA 1BDMA 2ZBUA 3E61A 4D3XA 3UMCA 4YT5A 4BNNA 2W8ZA 3ETJA 5HIKA 5HG0A 5HFAA 3RSZA 4D3FA 2J0UA 1SOMA 2IUYA 4X85A 3VGPA 1K3FA 1KEUA 1S4QA 2ZUFA 3OD1A 3EW7A 5ALDA 5CEEA 3MJDA 2NQ2C 2GJ9A 2F4NA 3AETA 3ZU3A 1Z26A 4BEJA 1NULA 1E1MA 1NVGA 2YV4A 3D6NB 3QPCA 2P9YA 3CRW1 3T7CA 4PRKA 4NFLA 1Z56C 2NQTA 3EYAA 3IT2A 1Z88A 1Z16A 4DVGA 4L9RA 1CUUA 3FETA 5EHGA 3IAUA 3KB1A 2RONA 4P5DA 5EJ2A 3WB1A 5L7WA 1EYZA 4GMFA 3I6IA 5MGNA 4J6EA 1G60A 1ZW6A 4G0NA 1L4EA 3KJNA 2DWUA 5C51B 2GSWA 3E7DA 2OCPA 1PG2A 3CX3A 1GZ3A 1ZI6A 1YRQA 3PYLA 4JDPA 5I5EA 4TYQA 5TC4A 1DJLA 1YZNA 2GI4A 2HI0A 2OWEA 4TXJA 3N2IA 4C05A 1W52X 1QAOA 3W2GA 5CA0B 2ZRBA 4WXEA 4RS3A 5GJVC 1QCCA 2VHYA 4C3VA 2IOFA 3UB4A 2MSWA 4E08A 1J2RA 1EQUA 1G4AE 2AMJA 4CIXA 4HQLA 4EGJA 1NPTO 3NI2A 3IJEB 4YJ3F 3SYTA 2W42A 5J43A 1XZCA 3IXLA 5C31A 2WAXA 1IVSA 4O5OA 3WXMA 4AF7A 4DKXA 4EZBA 3PF9A 3LFUA 1BRTA 3CZPA 3FY4A 1KY2A 4BUJA 3D1VA 4B44A 3BD8A 3ETDA 5KHOC 4HDMB 2JHAA 1K4KA 2R97A 5KTRA 3MJEA 1UJ2A 3B3QA 2GCPA 1Q84A 2HW8A 1EVLA 3HUUA 5C8DA 4ZC8A 3LW7A 3KKOA 2ZWVA 5I4KA 1IQ0A 2YNMA 3GYBA 4HH0A 4K6FA 1XELA 5DGTA 4ENWA 1YE5A 5M2QA 2TMKA 3QYFA 4XIIA 4D9KA 3K9FC 1N6RA 1C7EA 1E32A 1L4MA 3EZFA 3DBLA 2C8VA 1S2IA 1M72A 1Y3FE 2FRDC 2Z04A 1Z45A 3DE5X 4YCJA 4DA0A 2XA1A 2UVDA 1K8QA 3G6KA 4Q37A 1KZ9A 1WUTA 3O8RA 1XN4A 2F48A 3GJTA 1CUSA 4HOYA 3AJEA 4K9PA 1N1MA 1YT5A 4UTPA 5IPFA 2IDJA 2OBNA 4ERNA 2D7JA 3HABA 3O94A 4UBLA 3F3SA 2ZCVA 1DOHA 4R41A 2QRVA 5G0WA 3W2HA 5ADWA 1ULAA 1VHWA 1G8HA 4RGYA 2G9VA 1OXBB 3LX6A 4Y1FA 5U9CA 4Q7EA 1RWQA 3RTBA 1K2VN 3CNNA 1YCFA 4G9GA 1E7SA 3I3OA 5EMJA 1KE2A 5B7QA 1GCOA 1C81A 4L6IA 2W6PA 3W9SA 1E64A 1V9SA 3GG2A 3URKA 5TR9A 4ZXPA 3PFWO 3L0DA 1ZM7A 2SICE 4LTMA 4JHLA 1B1AA 1EFDN 1JDJA 1G59A 2A0FA 2V7XA 3I6MA 1NVUQ 4MP3A 4K81B 4LXIA 4U2CA 4KI0A 1COWD 1ZD5A 2ZRPA 5CLQA 5T3UA 1CF9A 1RPAA 4M6WB 9LDTA 2OSBA 2W22A 5ALOA 2IYAA 4BQSA 1NBIA 1Y6JA 4ZAXA 4PTYA 2VAWA 4DR1B 2FXVA 2JVJA 3E27A 1O96B 4NCBA 1SMKA 1U31A 2RGNC 3IEMA 1XNGA 4M1KA 1PW5A 4RZUA 1REQA 4MGIR 1VHTA 1NVVQ 4V1CB 3QV2A 2R00A 2Q2NA 3TH5A 4HB0A 1B7GO 2C2BA 3LV8A 2X5OA 1T1JA 4X1IA 4R0MA 4YR9A 3WYEA 1RRKA 4KLCA 3TNJA 1ZXLA 3RAJA 1RLOA 3F7NA 2G17A 3T5BA 2ZJ6A 1FS5A 4R2LA 1U1DA 3TLYA 3E5NA 4BNHA 4MS3A 4IJ6A 1MGOA 1P8AA 2NO6A 2VNHA 5K1ZA 4HUJA 3WGUA 2YJ6A 4YWHA 3AC0A 3FMOB 1DAKA 4TL8A 1LEHA 3AWIA 2OB1A 2YHSA 5GGYA 3ZE8A 1YRBA 2O7RA 5FQOA 3TS1A 2J6HA 5K8CA 3QF4B 2J5RA 1I94B 1WB5A 1PK7A 2B7CA 3GNLA 4AXXA 5AVSA 5LNK1 3L4JA 2X1MA 5ALRA 1NM5A 3QMVA 3WGJA 5CDFA 2RGRA 4AZSA 2F6RA 4F7DA 1PX2A 3R09A 1VG9B 1LI5A 1WV0A 2PSFA 5IASA 5T8KA 4ZCPA 2P11A 1PYGA 1UM9A 5LKRA 3F6SA 3RVMA 3EBPA 1RHRA 4EPTA 1E7MA 3QU2A 4GKAA 2CV1A 3DF7A 3WMWA 4JLBA 2C4TA 1O3YA 3ZDEA 4Z0TA 1XD9A 1RM0A 5FNVB 4AKTA 2EKDA 1UJBA 1YHZA 4LBZA 4EJSC 3THXB 3T7EA 2FPWA 1XTKA 3EWAA 1MDBA 1KU6A 4JI8B 3TBKA 3VI3B 10MHA 1N2XA 1KY3A 4WVFA 4XZ3A 3I5YA 1KP2A 3EPKA 2P5YA 3K0CC 4PXAA 3DEJA 4UXJA 5EMLA 4CF6A 2DFDA 3THYA 3R9XA 4KPYA 5DLYA 3DP7A 4EABA 2VJPA 3DTNA 5AK5A 5DX0A 3H1FA 2AOWA 1TA9A 4OD0A 1MEOA 3TK1A 4BVBA 2DSTA 3D6HA 4K2AA 4X8LA 5DHQA 4C7XA 2AG0A 2F64A 2I2BA 3QX7A 4L27A 4O2AB 5DSTA 4DQKA 1O8CA 2WYVA 1JEYB 2VIIA 2VP5A 1ST2A 4Z7NB 1J8FA 1G21B 5ICEA 2ZR9A 4LC1A 2BFEB 5HF5A 1FZTA 4FGUA 1OX5A 1AGYA 2VTVA 1L4KA 3R1IA 4KE9A 3SF8A 1A76A 4PF1A 4Q4AB 3TZEA 3GEDA 4IG9A 1T8WA 2PEYA 2E37A 1X7WA 3B1XA 3DVAB 4PQRA 4WY2A 5DLEA 3D8RA 5H7XA 5A3QA 1RLUA 3RHFA 3UBMA 1R4ZA 2ZJBA 3TMKA 4ARAA 4ASUA 3FSEA 5ICFA 1JTEA 2BYTA 1MX3A 5IKPA 3KUXA 2CUKA 4WCFA 2I1LA 5AOVA 1Q0TA 1TLFA 1AB6A 4WFJA 5DYIA 3SZLA 3X2SA 4MXDA 4OXYA 4DAEA 4BPBA 1DS6A 4O02B 4Y6GB 2FN4A 4WKCA 2YJ5A 2J46A 5ALVA 3IR7A 1NTOA 2W71A 4GBMA 1LXCA 2I6XA 3H7AA 4QX6A 1ZXBA 2H06A 3NTVA 4N0MA 3K96A 2OPBA 2ZE7A 1N75A 1DJPA 2CNWA 1Y7TA 3ZJUA 3BGDA 3LUFA 1H8EA 2DQZA 1R2QA 2B4RO 1PEDA 3H75A 2ZBGA 3HL0A 3OC6A 3I6ZA 3X43A 5JCOC 1FMFA 1DT3A 4GQIA 4HS4A 5AHKA 1C7RA 3JAKB 2JGDA 4TYPA 2K2WA 3WX0A 4R1PA 2E82A 2UUCB 1JQBA 4DB4A 4NEQA 4GPTA 3KOYA 1FVOA 3IHKA 3I9OA 1FYFA 1KO8A 3JCZA 3KEQA 3LF4A 4D57A 3T1YB 2CW5A 3K53A 3CW9A 1P3DA 1XCMA 4UVEA 4MHTA 4Z49A 4DR4B 1NR5A 3V2UA 3CB4A 1OILA 1A04A 1LCIA 3PNOA 4LW8A 1KMQA 1ZIPA 1NT2A 3II6X 4K6GA 1HE8B 1G8MA 4L28A 2HMAA 4MQEB 1QG0A 3SD7A 4EHKA 4V0ME 1JB1A 1XQ1A 1OWMA 2P0YA 2O5CA 3I9JA 4B8YA 5A05A 3TXYA 1WZIA 4Z5XA 2VNIA 5KNDA 5IZCA 4NRDA 4M0CA 3UWOA 1VI6A 2JD1A 4M54A 3RSGA 3M49A 3WXBA 3L8DA 2ABWA 4H31A 5JVDA 4AKHA 2DQYA 2JZNA 4HGOA 1Y37A 2ASEA 5DIFA 2M1XA 3KQMA 2D0IA 1JA0A 2F7SA 3D4PA 3KXIA 3OFKA 3NIGB 1FFBA 3QVGA 4QUKA 4E5PA 4HR7A 5GINE 1RYDA 4L16A 2DFKB 2I62A 3CNBA 5F5NA 1NIPA 5BYAA 4WINA 1E2PA 1TQ2A 3LXUX 3PC6A 5F73A 1EM6A 1JH8A 4Q4HB 2Z95A 5CH8A 5IXYA 4JU8A 4ONEA 4AZ0A 4G0YA 2VFAA 2FPSA 2VPPA 4AX4A 1WHSA 4KPGA 3B7WA 3GPDG 2AXQA 3FOEC 1DMSA 3TIGA 5EZQA 4KDEA 1RACA 4RVNA