3IOCA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.50 ang resolution in complex with 5'-deoxy-5'-(benzyldisulfanyl)-adenosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
273
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantothenate synthetase
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 86
structure length 273
sequence length 285
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iocA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iocA01
3CLRD 4DDHA 3QTTA 3X1KA 2E89A 1R6XA 4EG7A 1IH8A 2OV4A 2BYTA 2DLCX 4OJMX 1IQRA 1OD6A 5LM3A 2E0IA 3N9IA 3IVGA 4DDMA 2WQ6A 4KR7A 1QJCA 1H3FA 1K97A 4MLPA 4YMIA 5DB4A 4MUJA 1N2JA 1M8KA 1SURA 3ND7A 1J20A 1ULHA 2QTRA 4RUKA 1QU3A 2CSXA 3UY4A 3COYA 2PIDA 4ZCPA 5KHAA 1N3LA 1WKBA 4J75A 4MUGA 1XJQA 3G6KA 1P7PA 1FFYA 3MMXA 1N2IA 3KT0A 1NURA 4MUIA 1PFWA 4JXZA 1EFPA 3ZGZA 1G8FA 1MB2A 3FHJA 2D5BA 4YP7A 4EG6A 4KR6A 1YUNA 4MW0A 1WXEA 1JEDA 4EG4A 3BL5A 5HUJA 1MAWA 3FDXA 1S4MA 1KAMA 2HZ7A 4ZT4A 2C5SA 2VXOA 3ZXIA 2JA2A 4CQNA 4EGAA 2R5WA 4EG5A 4MW6A 3AL0C 4I6GA 4KPUA 3FY4A 4KR9A 2QTNA 2A86A 3AKZA 2HGZA 1KH3A 1FYDA 1J09A 4U8HA 1KP3A 4RPIA 1EUYA 3K9WA 4GRIA 4CDNA 3DPIA 2CYCA 3IDFA 3DLAA 1WJGA 2PZAA 3PNBA 1O95D 1V47A 1B6TA 3DV2A 4NX2A 4BWVA 2QJFA 3FI0A 1M1ZA 4F4HA 3CLRC 4MW5A 4PY2A 1TYAE 1T9GS 3Q4GA 1R6TA 4MAFA 3TQIA 1H1TA 1MOPA 2J4DA 1N2BA 4WSOA 3P0JA 1EUQA 4NAHA 4ZCRA 4JYZA 2JAXA 3ND5A 4Q16A 1XNHA 4PBSA 4P2BA 1KH1A 2CT8A 1ZJWA 1IRXA 3N2YA 1I6KA 3P0IA 4MWDA 3X1JA 4ZCSA 2CFOA 3CR8A 2DERA 4MVYA 4CT0A 4J76A 2BTEA 4QRDA 5FNZA 2D54A 2DPLA 2A1UB 4YP5A 3CLSD 2CV0A 5H7XA 2A7XA 1TEZA 1N2OA 4I6JA 3F3MA 3SZGA 1G59A 1KP2A 3ZJTA 1YI8A 5TEWA 2EJCA 3KT3A 2G36A 2RE8A 4DJAA 4MULA 1PG0A 1R6UA 5FO0A 2WSIA 3A2KA 3M5WA 1JZQA 4EG3A 2H29A 5JBNA 2IELA 1M8JA 4NDAA 1QNFA 2IP1A 1TYDE 2QJTA 3FG9A 4MWCA 1OBHA 4DDKA 5F23A 1H3NA 1NUPA 1WXHA 1JIKA 2J5BA 1WXGA 2QUIA 1O95C 3IOCA 1XNJA 1JHDA 2XRYA 3LE8A 3SYTA 3SEZA 1IVSA 1LI5A 3AFHA 1TYBE 3QTBA 1KORA 4QBTA 1WOYA 4XFJA 1G8GA 4ARCA 4AS1A 1MAUA 4ZCTA 1UFVA 2CV2A 1NI5A 4MW7A 2B7LA 3HZRA 1K4KA 1JZSA 3D6UA 4UZEA 3ISJA 3L93A 3GMIA 3ZJUA 4YP6A 5J5AA 1GAXA 3MLBA 2X3FA 1JGTA 1U7DA 4MVCA 4MUFA 2GKSA 4NZPA 2DETA 1GTSA 1QRSA 3UK2A 2ZUFA 2DEUA 3Q12A 1VBMA 1MJHA 4ZT7A 1KQNA 4MUEA 3CLSC 3KFLA 2J07A 3K32A 3A05A 4MW4A 1M8FA 3H9BA 1M8GA 3RHSA 4R0NA 1PFVA 4NATA 1TQ8A 4MW2A 3CLTD 1O0CA 3A04A 1OWPA 3SEQA 5TEVA 4MUKA 4WNYA 1F7VA 3IVXA 1U3CA 3ZUGA 3GUZA 1ZUNA 4GU5A 4Q93A 3IVCA 3ZJVA 2IJGX 1OWNA 4MW1A 3TQOA 1T6XA 4ZT3A 4FZJA 1VL2A 4ZT2A 1JMVA 2X0KA 3PNYA 2X1MA 4HJXA 1NUQA 1NUTA 4MVXA 3CVUA 2PZBA 3UMVA 1JIIA 1TYCA 3CVXA 1V8FA 1GN8A 2YWCA 3HFJA 3H9CA 1KQOA 1T9GR 1N78A 4E1AA 1IQUA 4UZFA 3H97A 3PXUA 4JFAA 3HL4A 2I1LA 2RD2A 2Z09A 4PBTA 3VRHA 1QRTA 5K0TA 3RBAA 1ZH6A 1EFVB 1EE1A 2A1UA 1G8HA 4H3SA 1D2RA 3NBKA 2CYAA 1J1UA 2JANA 1EJ2A 2Z08A 3Q10A 4MUNA 2NSYA 4ND6A 4OUDA 1GTRA 4HK4A 3IOEA 5HG0A 1JEEA 1I6LA 1O96A 4I6EA 1RQGA 3CLTC 1I2DA 2E21A 3IMCA 1U3DA 2WQ7A 4EFKA 5TGTA 1TFUA 3P0HA 3C8ZA 5J58A 1K92A 1OWMA 3QE4A 2DXIA 1O6BA 1YIAA 4K03A 1Q19A 4AQ7A 4U63A 3CA8A 3FETA 1T6ZA 2GOYA 3IMGA 1VLHA 1NZJA 1OWLA 5DASA 4DNXA 1QU2A 1XNGA 1WQ4A 2A88A 1N75A 3FWKA 1GZUA 1Q77A 1QQTA 4R2LA 3HMQA 3CVVA 4JZYA 3ZIUA 3TZLA 1ZH0A 1VBNA 1JILA 1N77A 2H2AA 5AHWA 1KAQA 3NV7A 2CV1A 2WB2A 2AKEA 4MWBA 2VTBB 1LI7A 2D13A 1J1ZA 4JXXA 2X1LA 1NSYA 1X6VA 1IFXA 3FNRA 1VBKA 5IHXA 1WZ2A 3E27A 4F3RA 2A1TS 4MWEA 1OWOA 1WXIA 2HMAA 3HGMA 4MQ6A 4L2IB 3A4IA 1JECA 1N2EA 3RK0A 5K0SA 1MB9A 5KCMA 3CLUD 4MVWA 2PXHA 4XFDA 4X0EA 3S3TA 4ARIA 3KT8A 1BS2A 1KQPA 3H99A 3P52A 2GM3A 1N1DA 1WXFA 3MXTA 1O97D 1MC1A 1A8HA 1X8XA 3IH5A 4K0RA 1GPMA 2YXNA 1KR2A 4MW9A 3UC5A 4ZT6A 1H3EA 2A84A 5KWVA 2QUHA 3MLAA 2NZ2A 2E18A 1O5TA 2QUKA 1JIJA 5LLTA 5LFAA 2V0CA 4HJRA 3ZXSA 4CDMA 1Y42X 1M83A 2QTMA 3FIUA 2QJOA 3FOCA 4MUHA 2OQ2A 5FO1A 2QUJA 1PFYA 1NUUA 1NP7A 1Q15A 3GLVA 4PBRA 1YIDA 1EXDA 1EFPB 3FH0A 3NBAA 2DUMA 3IUBA 3AG6A 3MUEA 1J21A 3RFFA 4ZT5A 3COWA 1J70A 3ND6A 2EL7A 1M8PA 4HPWA 2YWBA 1EFVA 3N05A 1OBCA 3G5AA 1PG2A 1GLNA 1O0BA 1NUSA 4EG1A 2ZUEA 1N2GA 3SZ3A 4KKVA 3CLUC 4KPUB 5H16A 1YUMA 2DR2A 1QTQA 3SP1A 2O8VA 4YBRA 3LCJA 4A91A 3L92A 4XSVA 3G59A 3X1MA 4DE5A 3AIIA 1COZA 4U7JA 2CUZA 1O97C 2YY5A 1O94D 3I05A 2V0GA 3IODA 4ZCQA 1MBZA 3INNA 1KKUA 3RJZA 3HV0A 1ILEA 1F7UA 4TS1A 1KH2A 1Q11A 5EKDA 1CT9A 1QRUA 4G5YA 2O5RA 5DEOA 5TS2A 2Z3VA 3SDBA 1U7XA 3N8HA 3TNJA 2J09A 3OP1A 1PFUA 2A4MA 3IOBA 5J59A 3D6VA 2PFSA 3U1VA 4EF6A 1F4LA 1N2HA 4R2MA 3VU8A 3COVA 3ILVA 2AG6A 3KT6A 1F9AA 2ZP1A 4EG8A 5HUHA 3TZEA 2VTBA 3VGJA 1I6MA 3COZA 5DK4A 1T6YA 3CVYA 1MRZA 2CYBA 3PNVA 3JXEA 4OUDB 1K4MA 3LOQA 5IJXA 1O96B 3OTWA 3IUEA 4L2IA 4S1OA 3IMEA 1YULA 2TS1A 1WQ3A 3ELBA 4G6ZA 1IQ0A 1NYLA 3RK1A 3AG5A 4NAUA 1DNPA 2A1TR 4DLPA 3CVWA 3UOWA 2AZXA 3TS1A 5BNZA 4ND7A 2XRZA 1LW7A 2J08A 3DO8A 4G5FA 3H05A 1IHOA 1WY5A 1U0BB 1O94C 2PG3A 4QREA 1HYBA 2PZ8A 3PRHA
chains in the Genus database with same CATH superfamily
4BX2A 1F14A 2B2NA 4GOOD 4NCAA 3MW8A 1GILA 3VR4D 4DT1A 4LK2A 4QOFA 3ZLBA 3EBOA 2EQAA 3K15A 4U6QA 4B3MB 1HOXA 1HZJA 2CJWA 3CPHA 4IDFA 2AFIA 2R4TA 1VL8A 2CXPA 3DLCA 3OKCA 1QG6A 3NDJA 4J16A 4XGIA 4CKBB 5KZMB 1RKBA 2LZ0A 3TDNA 4C87A 3V5NA 1E9BA 2I3GA 1NM5C 3H87A 1WKBA 4LDPA 3WYBA 5BR8B 1FFYA 3X2FA 4CBVA 1OI7A 3O03A 1SOUA 3LLSA 1ZHOA 1NKTA 2ZPTX 1PFWA 3D4IA 5CLHA 5CB4B 1D1TA 1H2AS 4Z9AA 2FR8C 3AERA 1E3WB 1FUUA 2BTQB 3W5IA 2F8LA 4M99A 2FSGA 2IPXA 4KR6A 3GFTA 2PJRA 1WF3A 3L8EA 1J49A 1ECCA 4PSVA 5K5EA 4EG4A 1BVUA 2ZRKA 2EFEB 4FB4A 1LSOA 1Z06A 1XPUA 4QHYA 5IRCD 4FZ5A 3QUCA 4TGLA 4W5WA 5EKTA 1PG5A 1Z88A 3ADOA 2VXOA 1BW9B 2JA2A 3EZFA 4N65A 2R5WA 4CM8A 4KR9A 1XDBA 2QTNA 5TPWA 2QLTA 1Y9AA 3N76A 4BNDA 3BD9A 2RCNA 4E2XA 4RPIA 3C3MA 1MB3A 3GG9A 1G2IA 1ZNYA 3JD0A 3W04A 3W79A 5IF9A 5JYBA 1XT6A 4MVJD 2BFPA 3AJRA 2CWDA 3B20A 4KQFA 4OFBA 4RHCA 2WIAA 3FDIA 1WAMA 1LK7A 1RWXA 5T67A 3U7QB 1CUIA 3DM9B 3E3OA 3JPWA 4HFRA 4FOLA 4AVYA 4GX5A 3PNBA 1KNQA 1WG8A 4NX2A 4N6NA 1V7ZA 3U4CA 2CL6X 2W4QA 2XE8A 3RRMA 3AXSA 1P75A 2A59A 1TCAA 2C83A 3AKCA 4U2BA 2XCOA 5B3AA 1F6WA 1M0TA 3RSSA 3V33A 1XXHA 1GPWB 2IYTA 4RHUA 4HNVA 4IIEA 4MAFA 3W77A 1H1TA 1TIPA 4JUIA 4YUYA 4GFDA 4CV0A 5UKDA 4ZO7A 2FSFA 1QGAA 4PW0A 2VJBA 4NYMQ 1MN6A 3QG1A 1QDLB 1XZQA 1KVTA 3O1HB 1DKQA 3FYUA 4WZBE 1FTYA 1EPUA 2FG6C 4MYCA 5F78A 5F9FA 1X87A 3LV8A 4IGKA 1RP7A 3NIDB 1ETUA 4KO8A 1C1YA 3W05A 4Z5XA 2GEJA 2XNDA 3B78A 4CI0B 3GAZA 4F60A 4AZWA 2VDQB 2WB4A 3SGLA 1NV8A 1Y37A 2RMKA 4JNCA 3LOUA 4Y2PA 2LNDA 5EL0A 3OIDA 2AMJA 1MV5A 1XQWA 2FUG1 3C6QA 3K70D 3DFIA 4AMBA 1TVEA 4RZSA 2XRFA 3VPAA 1RHMA 4A10A 1S2GA 1UWCA 1DBQA 3MJVA 4KRYA 3E3LA 4AZ3B 1KP2A 4RK5A 4TL8A 4V0MA 5LIPA 3PXGA 2FJ0A 2W6JD 5TEWA 4L6AA 3B3AA 1NI3A 3S2EA 5JMTA 3VNUA 2FDRA 4C20A 2C4MA 2A57A 4WNIA 3WL6A 3ZWPA 4JLNA 1LJUA 4RAOA 4DUYB 1A4IA 2JJQA 4AWAA 4ZEMA 1F8GA 1C2TA 1MRSA 2H29A 3R3ZA 3RANA 3UWOA 2VCEA 3Q98A 4DR5B 2R62A 1H3NA 3IUNA 3NC4A 1BDJA 4OJYA 3WYDA 3WL3A 4B80A 1NTRA 4QU0A 1F2TB 1T5HX 4BNTA 2HA6A 4BZPA 4JODA 5JDCC 3VZDA 3WLQA 3ZU3A 5CFOA 5J58A 3F1KA 1A4XA 3F2VA 3OQJA 3T5BA 3UBMA 2O2ZA 4J4BA 1Y5IA 1ISHA 3TUJC 4Y6RA 3AFHA 3FVWA 1WOYA 1QLJA 1XRNA 1EEHA 1DC6A 2PYDA 3UFXA 3ZX4A 3JQQA 4ARCA 2G3DA 3JD2A 3OT4A 1MAUA 1XZIA 4IDPA 1ZMTA 2HSZA 3PQEA 1C3XA 4KQJA 1UP7A 4NYMR 4HRXA 5EINA 2OPHA 4QJ5A 2VDWB 3ITKA 3PQ4A 2GD2A 3QU7A 3CX3A 1G20A 3ET5A 3TAUA 1ZH8A 1QNLA 4YTEA 5J3JA 2HLNA 2QVZX 3IHLA 3ISJA 1NW5A 1XN1A 2RI6A 3NXKA 4W1RA 4YFYA 5E4YA 5BMOA 4Q01A 4TV8B 3NGLA 1DKLA 1P4JA 1RYEA 4UBLA 2JL1A 2VQFB 5HRCA 2IBMA 1K3TA 3KETA 1HI9A 3ROQA 2GKSA 2Q1YA 3LPNA 4QJ3A 1TE2A 5COBA 3I8XA 5EJIA 4KU4A 1JA1A 3T6KA 4B3HA 1ZIOA 4BUZA 3EUAA 4WY2A 4LI0A 1EYZA 2I76A 2I99A 2P9FA 4MW4A 3AR9A 3NVDA 4Q4LA 1LDNA 2A5JA 1ZY2A 3GVPA 5E0KB 4EW6A 4YDQA 3KEOA 3TCKA 4A0QA 3QHQA 1P0IA 4TROA 2GRJA 4BMZA 5J40A 1YK0A 1L4YA 1TJPB 5TF0A 3ZLVA 4V02A 1U7OA 2HBQA 1JDBC 1GJRA 4J2OA 5CDFA 5ALVA 4POAA 3MG9A 3WMWA 5K51A 2FFRA 4HQKA 2IZ6A 4C9BA 5JNTA 4GU5A 3EZGA 3IVCA 1N6HA 2WJZB 3GPBA 2YIDA 2VRWA 4KQ6A 4N5DA 4KLNA 5DJ5A 2I9PA 3QIAA 3ZNPA 1AO3A 1VL2A 1YDHA 2VWPA 1BFKA 3EZ9A 1HKUA 1X7XB 1KEUA 1M1XB 2P2YA 4GECA 4HT3B 4OIFA 3MQ4A 5J2TA 4HNAA 4ISBA 4TUYB 4GQBA 4QNNA 2I65A 4C4SA 3MJHA 3GJ0A 3TZBA 4Y1FA 1VIMA 4G23A 3CLHA 2AF4C 3D3NA 1JIIA 1MTOA 2BM9A 3EAFA 4XJVA 4WASA 1HBJA 3EGIA 4MGEA 4F92B 4WCFC 5T6MA 5MFPA 1EWVA 5GPBA 1N78A 4CTKA 5K4GA 1WD5A 4UZFA 1SG0A 3VC1A 2I1LA 3I1YA 2O4UX 3OJWA 4RADA 3A28A 4OK5A 4XLLA 3VRHA 3BE8A 4Z9FA 4DHEA 2E4AA 2NUTA 3RVNA 2PBRA 5KJFA 1S1MA 5IP5A 1TTPB 2HI0A 2OTCA 4G8JA 1RC1A 4BDSA 4G5SA 1PK8A 3GAFA 4GR5A 4H7HA 4NAVA 4JGBA 1E8MA 3PCTA 1L5YA 1M74A 4MS4B 4ZVUA 3ZQ6A 3IV9A 4DIEA 3EY4A 2P2ZA 3FMVA 2CYAA 4XUCA 1UBKS 3SQNA 4A0SA 2RGEA 2NAFA 1XU7A 2I2DA 4TQUS 4XWYA 4EX7A 5SY6A 1EJ2A 2AI3A 5FUVA 1J23A 4BNXA 2XUJA 3EXHA 1VKZA 3MTDA 5CH8A 3ZGNA 4LQ4A 4CQJA 4HK4A 4W6ZA 4DCGA 4IH9A 2F8SA 2I6SA 2OHGA 3WLHA 3D3WA 4C0WA 3E2IA 1M2NA 1Z0IA 3D1LA 3H2KA 4PYQA 3M4ZA 4LX8A 1DAEA 4ER0A 2W43A 2IUUA 2V7PA 4Y6QA 1PNRA 5I7FA 3ZNQA 3FOFC 4ZTZB 4KFCA 4DV6B 1E1DA 5DLDA 5F33A 2TECE 3P0HA 5ITZA 5CB0A 5L3QB 3IL2A 5LJIA 1K92A 4QA9A 1WOMA 1AD2A 4JJZA 4GM0A 2AIRA 2ZRGA 4ZOEA 3MILA 3R3SA 4MMXB 2GW4A 3A1SA 2F7SA 1GTG1 4U63A 5CB6A 3O8CA 1WP4A 1BKSB 1YS4A 2V7GA 2ZUSA 3CA8A 1V71A 3QF7A 4FGSA 4TYMA 1Z6ZA 1JS1X 2AJLI 2ZJ3A 3OE7D 5F64A 4F8EA 4J2HA 3CNNA 4EO7A 3A25A 2JLUA 2QTAA 3AQ4A 3AF4A 3PRKE 3VR4H 3MT9A 4U7GA 1R5NA 4OL9A 5BP7A 1JFSA 4YS6A 1BH2A 4RPKA 8ATCA 2IDMA 4KMSA 4GVPA 4L0DA 5JD5A 3RVJA 3UK6A 2UUCB 1YAHA 4CMHA 3FVQA 1PDWA 1N77A 1RPAA 4X8LA 4Y6GB 3GFQA 3PUYA 1KI6B 3DS8A 4RVSA 5ER6A 3S8YA 1SEVA 2AKEA 2D13A 1IBSA 1STOA 4ZEXA 4CEIA 4N3BA 2IVFA 3EMDA 3I2KA 4B4UA 4CKEA 1JMKC 4TLAA 1SVNA 5KJCA 1BHJA 3LT1A 3GK3A 1C7FA 3MTGA 4ER7A 1Z6XA 2EP8A 4TMVA 5FTKA 3ASZA 4LJLA 5THXA 4F3RA 1WMSA 1ADBA 2H1LA 1KYIA 5A0VA 3HBJA 5A3RA 4I50A 3PQ7A 4NBNA 3HY4A 2FPGA 1NQAO 3CNHA 1T8YA 3ZU4A 4F1KA 1UBUS 2PT5A 4Q4CA 2I8LA 4J2TA 2I91A 1OT3A 2A30A 3CLKA 3EFEA 3QE2A 4ARIA 1WW8A 1SUWA 1GYQA 1TM5E 2LGJA 3HYLA 3ULKA 2X7HA 4BN4A 2CLLB 4FBGA 3SBXA 3NPAA 1PYOA 3TIVA 3U2QA 2WM8A 2QX8A 3B38A 3F8WA 2JASA 1EVEA 2PQ6A 1IPHA 3ZV6A 2EU8A 2W4MA 1OX5A 1RMQA 4REQB 5HYVA 1OYYA 2VBIA 1H3EA 4NE2A 5CDGA 1USGA 4LMAA 4IOJA 2OA0A 4ZQCB 4LYJA 1N5KA 2QUKA 4DT1B 2OZKA 1CP3A 2KX7A 2X42A 2QI9F 3CISA 3HJBA 5A4FS 3USES 3RAJA 1EUDA 1UPXA 4E1BA 4CL3A 4ZZIA 4Q9HA 2CJWB 2HN9A 3BTVA 2OESA 1K6MA 3I5UA 2AFIB 3EISA 4P58A 2IX3A 3CIOA 2GCOA 3C74A 3ZU6A 2W5UA 1GQRA 4QEZA 3M2TA 3BWVA 2OCPA 3IQFA 1PJAA 2G8LA 2VJKA 2GPWA 3MGAA 4R3WA 5FL7D 3IAS6 3TW0A 1GG8A 2VPZA 3GLVA 4Q1VA 1EBBA 3CBGA 2Z56A 2X2PA 1TKCA 4HLUA 3S1AA 4PTYA 1IOVA 2Z8YM 4N3NA 4ZYTA 1LTQA 4P84A 1QZTA 2P77A 3PP8A 3ZDFA 4DSNA 4F45A 2QTCA 4B46A 3M6XA 3AERB 4BMDA 3BWYA 1NI4A 3R40A 4MPDA 4MRMA 3UCXA 2CUNA 1JP7A 2EBHX 3M34A 3D8RA 1M8PA 3KYIB 4RZQA 1WDTA 3FZQA 1CVLA 4FBLA 4K9KA 4GLOA 1XQ1A 2J1LA 2PAFA 2JJYA 1EAYA 1GLNA 2EVWX 2VHEA 4KIFA 5AOBA 1RXCA 3V1MA 1VL0A 3OM8A 1JDNA 4EG1A 4V0RA 1DAIA 2E48A 3OZTA 2GRAA 4HFNA 1NP3A 2XE4A 3T4EA 4CM8B 1FU8A 5TPWB 4QTZA 5BR7A 2X76A 1Z0DA 2O8VA 3DEHA 4BNDB 1Y9JA 1YZFA 4GE3A 5MDHA 1PR3A 2A0XA 1DUIA 3G59A 5F3DA 4QODA 3KQTA 1NXOA 5E9JA 4EHFA 1RTKA 3P9RA 3PKZA 3ORQA 4KREA 3A4NA 5KX5A 3B3GA 3FNGA 3FNEA 4Y18A 3NMUF 2XKJE 2VBGA 4UHFA 2FX3A 2EAUA 5YASA 2QV7A 3ZBUA 4EVIA 3RABA 1ONOA 3RB8A 2C07A 3OM9A 3BF7A 1TAQA 2WWIA 5I9NA 3VOBA 2O59A 3F97A 3NTVA 1XXHB 2FQXA 1R0SA 4BNWA 5J2TF 3NHSA 2P9CA 5DGIA 1NF8A 2I6GA 3C1TA 1U04A 4GOMD 4QRIA 4X41A 1I3MA 1U0OC 2C2BA 2N1MA 3OQ1A 4WDRA 5IXJA 1TYZA 2X2FA 4BMSA 1JIVA 1IU9A 3KE8A 2G25A 2ANCA 1XCMA 4C01A 4CTMA 4TSFD 2PFSA 1KEWA 1KBZA 2WYWA 3FYUB 3IIKA 3R3UA 3R6GA 1SR8A 1F4LA 3REOA 4FFLA 4UOEA 2PFGA 3KOMA 3S8MA 4ZC8A 2ZP1A 1FFAA 2ZBUA 4JBYA 4LXUA 3A70A 4RF5A 2QIPA 1TGYA 3E22A 3GJTA 4CKXA 2JLQA 4BNLA 2Q8QA 4GNRA 3JQRA 3SHTA 1LC3A 1HT0A 1I1HA 3VTFA 4LF8B 4FZVA 5HIIA 1SJ9A 3BXXA 2G5GX 4GEGA 3G2JA 1P2DA 3KJZA 4MI1A 3R5KA 3CRMA 1YC2A 4PWZA 4X8MA 4DANA 1ICIA 4WCDA 4KYTA 4TT8A 1JMYA 3H5RA 3PUZA 1ZUD1 1R6AA 4L5CA 4L2IA 3UG6A 1NHWA 1TM2A 1VB3A 5D84A 4YGYA 1ZVVA 2PD3A 1M2GA 1A4RA 1RPJA 4R40A 4ROTA 3SFVA 3ZHBA 1ZNQO 4FCCA 1LQUA 4KQEA 4YQEA 3VH2A 3NZEA 2GPBA 4I4TA 3REFA 4C3OB 3KEQA 2PMCA 4OB7A 3ZWNA 3DZIA 4IH1A 5ALNA 3BXOA 4LFBB 4LAFA 2CHVA 3IUQA 2YV2A 3FOAA 5ALGA 2ZVJA 5JSUA 3OBBA 2A5GA 3ICVA 2BZSA 4JOBA 3D5TA 3L8CA 3INTA 3CFAL 2V0NA 3AUTA 1R88A 2VNHA 3M7IA 2Z2YA 3X1KA 2E89A 2WTXA 2FN9A 3G2MA 3ITNA 3DCJA 1C29B 2W4IA 4GKKB 3I4CA 3KZNA 4KR7A 1QJCA 4NSNA 3RRFA 2FMIA 1AZLA 3ANSA 1HK7A 3UFXB 3K0CC 1G5TA 1N0HA 1T6BY 5B7NA 1J20A 4KLZA 3QM1A 4PLVA 3SMQA 2H1VA 2I1WA 3COYA 3PWKA 1V1MA 1EVJA 4LYFA 2FWAA 2Q7XA 3RRNA 1Z38A 2HMSA 3DDHA 4KXUA 2YHBA 1EUCA 1ZN9A 5DYTA 1NURA 1U98A 4CM4A 4P22A 4JXZA 4PYRA 4U7TB 4WUTA 3D8UA 2REBA 3C6BA 3IEUA 4XW2A 3E5HA 1P77A 4Y9RA 1Z0AA 1ZESA 1A9QA 2K7ZA 3ANNA 4L9SA 1NC3A 3U13A 4G0VA 3DXFA 1W5BA 3FSJX 3H2ZA 3LAWA 1NDQA 3OOYA 3UF0A 5KKAA 4I50F 1Y89A 4JJGA 3GRKA 4NOLA 4O59O 4W5HA 2W90A 3QFRA 4E30A 4BVFA 1G66A 3PLNA 3K09C 2BIFA 1WDMA 2H51A 2Q2WA 5DNEA 1JJBA 2PUVA 3PXXA 2C2HA 3F96A 3PHIA 3TB4A 3M4JA 3M4YA 3ZD6A 3G5MA 4ZYZA 4GI1A 2BZGA 3MS4A 1CIPA 3EQZA 2CLOB 3IVRA 3HLYA 2AD1A 4AJEA 2QHXA 2LD4A 3L9WA 4ANFA 1V95A 3ZI7A 1SHTX 1Y0BA 3IAXA 3EA0A 4MYDA 4OU5A 1KIMA 2OBMA 3X3HA 5AR1A 3EIHA 1YH3A 5F1KA 4C4ZA 3J7TA 2Z6AA 1KJWA 3W7BA 1QUFA 4YH1A 4DSUA 1M1ZA 4ZMBA 1Z8DA 4MARA 4PY2A 2BSXA 2I3ZA 2W2QA 2GH1A 3MMNA 4KX5A 1S2DA 2XQIA 4AMGA 3E4CA 3O95A 3PR1A 2G8NA 4HN2A 5J2TB 1KRWA 1VCHA 2Y1DA 9LDBA 1OXSC 3S8EA 2DLDA 5IAOA 1GTL1 4AF8A 3HPRA 4GBGA 1SQFA 3HP7A 3K9NA 4XB6B 2Z2KA 4IWXA 1Q16A 4L8GA 5H82A 3VR3A 4Z4EA 2ZRBA 3GGGA 2L17A 4GMDA 2PUAA 4GOJA 2A67A 1FTNA 3N2YA 3F7NA 3S40A 4C7KA 4GGOA 4KXWA 4DPKA 3RS2A 3BA6A 4LWOA 4R6WA 4DMRA 1YDMA 1GD1O 4J1TC 5ULLA 2HSJA 4DJJA 1D8AA 3ZCVA 3LL4A 4PLHA 5JAUA 3VJRA 2NUTB 2VPXA 1PIWA 1JLRA 2D54A 3V9AA 2FY8A 4JHLA 1RAEA 1QGYA 2JCVA 2BY4A 3CYFA 3AHFA 5HE9A 2DM6A 3CLSD 1WEHA 2QD2A 2P1RA 2YUTA 5DMHA 3T5AA 2WAXA 1LWOA 3K73O 3W3ZB 2P0EA 3ZWKA 1UDCA 1VB5A 1YI8A 3HCPA 4D92A 1MPXA 1YASA 2WSIA 5H3HA 3AR2A 2YYZA 1JZQA 3OBIA 2OB2A 3D3WB 1IYZA 4QDJA 1WCIA 1Z7BA 3JQ9A 4D9GA 3O47A 3B9QA 3H7AA 2QJTA 3UXEA 3FCXA 3P2YA 1RDFA 1G2OA 5ITZB 5ESDA 2O8NA 4UNSA 1E6EA 1E32A 3EAQA 3RREA 1NYTA 1WXGA 2YN0A 4JUCA 1BNCA 3L1IA 4OATA 4E5DA 4JDUA 4P98A 1FFHA 1PK9A 4G1MB 4D5GA 5TV2A 4OUKX 2GERA 2RHBA 4A9AA 1Q1AA 4D9BA 5MN4A 2PZFA 4MP3A 4GSKA 4L3OA 4IGIA 3CJQA 4GXNA 3JTMA 4DQDA 4NZNA 4UU8A 5EP4A 3U4DA 1QQ7A 1HTTA 3VKGA 2R2AA 4K2HA 4M1TA 1VRCA 1TB4A 4R83A 5CW1A 3HEBA 3ICWA 4IGFA 1RAFA 2RCYA 3HRKA 3KVOA 1T2NA 2H0RA 4K9DA 4RKQA 4WI1A 4WLOA 1ZQ9A 2I8CA 4CKEB 2HA5A 3I5YA 3QJYA 1G0NA 3O82A 1LPBB 1DG9A 1P39A 1W4AA 1ZA1A 2C5LA 2IFTA 2ST1A 2Z2JA 5KVVA 2X3FA 3A06A 2X4IA 4MQEA 2C9DA 1KEVA 4OMUA 5CT4A 3GCGA 4MRRA 1SRRA 4IICA 4NDZA 5DX8A 4FQ8A 4YRJA 5AUOB 5B3LA 1YKGA 2GR7A 5AM4A 2FPGB 4LE0A 2AMFA 3IXMA 1KYQA 3JVIA 4Q9DA 1R8XA 4D4HA 1YJQA 2P27A 4JY7A 4E3WA 1CZRA 3K32A 2KSQA 4J7UA 3JR3A 4AG6A 5J2UA 4X66B 4B3FX 4EVSA 4RD6A 2GRUA 3NM4A 3IR7A 4Y2VA 1YRAA 2ZTHA 1JQLB 3M9WA 2VT7A 4I4CA 1YRYE 1A7KA 1L5GB 1GQYA 2FXIA 3CLTD 3O9MA 2M6KA 1TCUA 3CCBA 4HNTA 1RVV1 3PX2A 3L6OO 2C4VA 4GPZA 2PXAA 4IHJA 5IK2A 1NOJA 4OXXA 3VZRA 4C06A 1KZYC 4ZODA 4YIKA 4QGBA 3IBTA 5C34B 5DWVA 1L1RA 2HDWA 2QNRA 3GUZA 4HEA6 4AL4A 4RZUA 3KSAC 3A6GA 3QU9A 9LDTA 1O5OA 1ZJZA 3ICOA 2X13A 1G6KA 4ZO9A 3GNTA 4LDZA 3VHRA 3JVDA 5JCJA 1B1AA 1EUDB 4R1TA 2PUFA 1L5ZA 1CF2O 1E2NA 2Y67A 3ASVA 4WZ6A 2N75A 3W5SA 5F73A 4RTRA 5LQRA 4PR3A 2GCOB 1EVQA 1LNSA 1P1HA 3KVRA 3GEDA 4XGKA 5I5GA 3SKXA 3SZRA 3JRWA 5DSTA 1I13A 1RM0A 3PNLA 2Z1DA 2GZDA 1M72A 2YV4A 2IS2A 2P6RA 2FZVA 3Q40A 3S1AB 2FWMX 1PTJA 5DP1A 5DZSA 5AK5A 3KQHA 5EP2A 2W2LA 5FOXA 1XO1A 4B3SB 1V43A 2QORA 1GCIA 3I9FA 5JAOA 1NI4B 4MRMB 1F8YA 1NWCA 2QSYA 5EERA 4HWSA 4X1KA 1TAUA 3OTIA 2OV2A 3QTLA 4D45A 4ERXA 3FKSA 1MVNA 3DONA 4BQQA 5BUSA 2WD7A 2D4AA 4HRVA 1XVTA 1VLMA 4GBED 1HFKA 3H8SA 4YO8A 1P3DA 1ZVKA 4PZUA 3LZCA 2ONCA 3KOYA 3DWIA 2A5LA 4IF4A 4OQNA 4YRNA 2XX3A 3KR1A 3NBKA 3RM3A 5BXYA 5AW0A 1J1UA 5G0TA 3TTXA 1KXJA 1Z68A 1P8JA 3Q10A 1D0VA 3AVVA 2QYTA 4TLEA 1J39A 1DEOA 5AJYA 4D46A 5CPBA 1IN1A 1Q91A 4GQIA 1I6LA 1B26A 1E18A 3MJFA 4EKNB 1NAHA 3LYHA 3UUEA 4I8IA 2VHVA 1KYTA 3ROEA 5KX5B 4JVSB 2UZAA 4PLGA 5ALSA 5LVAA 1I4DD 2Q9AA 3CB4A 5C8YB 2PV7A 1YDEA 3MF4A 4LRTB 1QIGA 8ABPA 1AOXA 4DADA 4ENWA 3L7LA 3A9RA 3MCZA 4BWFB 4EFDA 1TTHA 4R1NA 4IO0A 3ZCQA 3NLLA 2XVXA 4EUNA 5B6PA 1Z75A 4OLBA 3ZEAA 4PZLA 5IMBA 1MO2A 1KNXA 3IUYA 1Z28A 1P19A 3NO4A 3IMGA 4OI4A 1ZJJA 3L3BA 2O48X 4JT2A 4Y1RA 1Z6GA 5U4QA 5U4XA 3AL3A 1WQ4A 4Q1DA 2XVAA 2ZJ1A 1S8AA 1L4HA 1M6EX 2OXIA 2HF9A 3G0BA 1O6GA 3L8HA 1G19A 4JJ4A 5E8RA 2FSIA 1HQKA 4OKNA 3PWZA 2QX6A 2XRMA 3QVOA 4R2LA 2OCLA 1AJEA 2GBFA 5A5GA 1I5RA 2RH4A 3RWBA 3Q9UA 3A27A 2C20A 4HXEB 1JWLA 3T7TA 3G5LA 3WGZA 2CV1A 3NWEA 3SAJA 3E22B 4WADA 4ZKDA 2OLEA 4CKZA 2PWAA 3STWA 4AG5A 1GZHB 3I6BA 1OR8A 5ERYA 3ZHRA 2PAAA 3A1UA 3OOSA 2H2FA 2HWKA 1P18A 4GOLD 1NGSA 3B9RA 3M70A 3GF4A 4IIYA 4YRGA 5IKXA 1WNTA 1RKUA 1W0KD 1ZI9A 2COUA 2R8BA 4PLZA 4UD2A 1MGPA 2Q4DA 4OYRA 5GAJA 3ROKA 4L2IB 3GRYA 2X86A 3IQEA 2A9OA 3R7NA 1I7PA 3RGGA 3F5MA 2JH9A 4N18A 2F6RA 5K0SA 4YDSA 4DILA 4S1WA 5DTIA 3FVRA 1ZUIA 2R4UA 4BP1A 3P9KA 1G8YA 1CUGA 1WUYA 3AUYA 4BNKA 1QMPA 3RUEA 2FPIA 4I4TB 5CHYA 2OV1A 2OV6A 2PZJA 4WLNA 4DWWA 4Q15A 2G82A 3B2EA 1E6UA 2NTVA 4IHKA 4ZA2A 2HCBA 4TS9A 3E23A 4BLQA 1MC1A 3CC8A 4CFYA 1JQKA 3LBFA 4RPCA 1A8HA 1X8XA 1JPNA 3CEAA 4HF7A 1KY5A 2GHQA 4MROA 1U94A 1JB9A 3P1JA 1R0KA 5G3YA 5LC1A 3QX7A 2YJGA 4LE1A 4NTZA 3E18A 3V4ZA 4ZGBA 2IZ5A 4B4VA 1XMXA 5DP2A 1UP4A 4OM8A 4I08A 4C14A 5LBTA 2RBKA 3X43A 3NANA 2D2VA 5LFAA 5LLTA 4TZKA 3L8MA 1T4CA 3SICE 2H1CA 3KJFA 2BSAA 3OEYA 4EHBA 2XMBA 1KY4A 2GTPA 4DV0B 2JLWA 2OY0A 3ESQA 2J3LA 1A96A 1OFGA 1CUFA 1PNTA 2G04A 3DW3X 1A1SA 2AG0A 5LLSA 2C7VA 3LUBA 4C3VA 5KWIA 5KTPA 1M73E 1SBQA 2F1JA 2N3ZA 3I9LA 3RROA 1PZGA 1DAGA 1YZVA 1V1MB 2ZXEA 3KE9A 1CHDA 2AI1A 1VMEA 2ZRQA 4G2TA 2EJVA 3DEKA 1P2UA 3R9XA 2M1ZA 1OC2A 1EUCB 3STXA 3C7AA 1UBGA 4CM4B 4D5EA 3UHAA 1W93A 2BCEA 5AXBA 3TGLA 2V6MA 1SXGA 1FSZA 3RFFA 5KCZA 4KQ2A 3AF6A 3PL5A 1J70A 1JN0A 3GPLA 1UDXA 1GIAA 2P41A 2EL7A 1Z4NA 4URYR 1SMKA 5K0EA 2RJNA 4YRZA 4KO3S 4HPWA 3ERCA 2IH2A 5FXMA 2YWBA 2UVDA 2P4UA 1XMVA 2H17A 4KPEC 4US2R 2DR0A 1DOAA 1Z4JA 4GP9A 4HNHA 4WLFA 3RG2A 5J2UF 3IA2A 4JXKA 1V96A 1L4EA 4ALJA 1OXKB 3GDOA 3ILXA 2FJUA 1XF9A 4RA6A 4URHA 3ZLJA 1RE0A 5DT9A 1DVRA 3SQOA 3WQHA 4I1IA 1ZD8A 3WYFA 3L92A 5EWMA 1ABFA 1HURA 1E7QA 1L8LA 1TXGA 5AT1A 1QUEA 5AVQA 1AF7A 4OQLA 5KTYA 2DULA 4IHJF 5AOVA 2CUZA 4AP9A 2P6UA 4BBAA 2GCGA 2VZ9A 1BEUB 2XTJA 3E1SA 1POXA 2FXVA 4ARVA 5BYJA 4R68A 4RDHA 2IPMA 4D43A 4KIGA 4DBLC 4R8VA 4EJFA 2LV8A 3HV0A 3VVMA 4DLYA 4WCVA 5K6TA 3M9XA 4TS1A 1QXSA 1GSOA 3MJ4A 4E5UA 5FA5A 4RKYA 2EW1A 3F8TA 1G17A 1CERA 3ZV3A 2V3CC 3A2MA 5C1BA 2Y05A 1RWQA 4W5TA 2FP3A 4PONA 3SDBA 5IYZA 4RELA 1TEVA 4MQLA 3ZQKA 1N5DA 2VQSA 2GD6A 3H1BA 2H2WA 4I4LA 4A82A 1AF4A 1YR8A 4FU0A 3PYLA 4I1RA 4G9EA 2CB9A 3OJXA 4HDKA 3BKWA 2X2OA 3LYAA 4I4IA 1GPLA 4L8YA 4PYMA 4XASA 5CVJA 2C3OA 3IT2A 4I4NA 4PFJA 5L7YA 2E1RA 2MSLA 4DLXA 4HOYA 1ZM7A 3HCFA 3TZEA 4ZI2A 4YUXA 1XZBA 4D1YA 4NESA 3TNLA 3T3EA 3HJFA 5DK4A 5L6MB 2VDRB 2OK8A 2MSEB 1TKAA 2HJRA 4A1FA 1CUHA 1PT7A 3L8ZA 1OC4A 2C4HA 3QYPA 5C31A 5K2OA 3D02A 4V38A 5DNDA 4WZBB 5JJ5A 5IJ0A 1BQEA 3PQDA 1K08A 2Q27A 4AKSA 4YUZA 4N4AA 1UBHS 3BSSA 2Q6TA 3VU1A 3MRSA 1ADGA 4BC1A 1DNPA 2VT3A 1RI4A 2QP9X 5ESXA 5B37A 3E5NA 4C04A 1NULA 2IZZA 5JPDA 1QANA 1G8PA 1SEPA 2YX1A 4XKJA 2XIJA 1WCIB 4GZ6A 1N1MA 4HZUB 1VDZA 2HC9A 1PX0A 2RB5A 4EKEA 3RTEA 1G5QA 3M49A 4JT8A 4R51A 4U2CA 5CBKA 4B81A 3IE0A 5BQ3A 1Z0ZA 1CDDA 2I54A 4FGZA 3F1LA 1USVA 4LPKA 2MIIA 4ZAXA 5GJWC 1CG6A 5GIPE 3TLBA 2ZM5A 4BLVA 2WU3A 1OH5A 1ID8A 2J41A 2Z04A 4PYIA 5EHGA 1CF9A 3ABSB 3FGPA 3IA7A 2QXUA 3IT0A 4JLJA 4NCIA 3O94A 2YNMC 4FOSA 3RSCA 3AM5A 3HRIA 1BDIA 4RTJA 1JU4A 2QY9A 1XNRB 4IXWA 3IVGA 3RYFB 2IYOA 1Q2UA 2G06A 1YHZA 2Q9UA 3HU3A 4PHGA 3GLSA 4MLPA 1ZC3A 1C7JA 2R87A 2DHDA 2VRCA 3HDYA 4HAOA 4K6OA 5DB4A 1B4DA 5B58T 5TS3A 5J4KA 4DKJA 2QTRA 3I0ZA 1IIRA 1Y3DE 4UE6A 2EL9A 3E05A 4WQMA 5AVKA 2B20A 3BCHA 4J3NA 4EECA 2HH9A 2WPDD 5KNBD 5TJHA 2NOAA 2B2CA 4UHCA 3U5ZB 1CQPA 1EB8A 1RJGA 1PUXA 4GMGA 4E51A 3KM0A 1CUUA 5TJ9A 1NC1A 2AUTA 3KAQA 5FAKA 1OKKA 4F4DA 5A5EA 3V1TC 4FDTA 1AB5A 3T4UA 2HR1A 1T8UA 1XTSA 2ZB2A 1QHIA 3CFYA 4MWZA 4ALKA 4PSCA 4RIIA 1XKXA 3HR7A 4Z1MD 5JADA 4NBKA 4V24A 4QSMA 3LDFA 4CLEA 5IANA 2QZ9A 1VG9B 3OICA 1E2UA 2XYGA 4FT2A 3R76A 3ZUPA 4CM6A 1LK0A 4AX4A 1GAEO 2HYIC 2AN3A 2PPVA 4M0FA 1X7HA 2VSFA 3BMQA 4A5SA 4ZI3A 2PL3A 1U2TA 1OVMA 6AT1A 2DP4E 3TOXA 5AYVA 3SI7A 1JL3A 1R5OA 1UXHA 1YB2A 3GGDA 4LHWA 3I6IA 4R5HA 1KH3A 3WB1A 2H63A 4CF7A 1NU6A 4IJ6A 3UT5A 5KBYA 2R60A 1SC9A 3KLPX 4AI6A 2GARA 2Q6LA 3QYAA 1RYMA 3PC8C 2ZI6A 3Q15C 2RAPA 2QQ5A 4IHJB 4OA5A 5EMHA 1TMGE 4BO7A 3SIPA 5A05A 1OTHA 3A58B 1KDPA 4UMDA 4AJLA 4F9FA 3U56A 3NHAA 3GI1A 2A0KA 2QW8A 2HPZA 2WNHA 3G1UA 4P4LA 4CEJA 1O03A 3ZDAA 1B6GA 3SJZA 3OX1A 5LBUA 3UHJA 2JFXA 5EYPB 3WMXA 1EJ6A 2EF1A 4QX6A 2ISSD 1FX0A 4FHDA 4RD3A 4QLBA 5LQCA 4ZVVA 1IWBB 5LA6B 1LF5A 2JAXA 1RLUA 2J5QA 1GG2A 1MZVA 2FWBA 2H6EA 2HYDA 2PUCA 2FOIA 3KL2A 1OLSA 4NCJA 5D00A 2O0MA 2AT1A 4OD0A 5DULA 4DLKA 5AVTA 1RP1A 3C70A 3ZVKA 5IXYA 3JV7A 1Q44A 4HQ6A 1A76A 2BF7A 4PSKA 3BULA 4NZYA 1E2KA 1AX9A 1N0IA 5ICGA 1GCUA 2A94A 3CR8A 3IAFA 3AF0A 2LKCA 4FGLA 4X1KB 1YZTA 2VHWA 1MVLA 4MVYA 2DQSA 3AEYA 4LVUA 4YT2A 2VC2B 2WD7B 4X7PA 1EVZA 4EK9A 4AJKA 5IEJA 4JUBA 1KO7A 3JWEA 5FI0B 5AW7A 3GARA 3G8YA 3MWGA 4IUCS 4M0CA 4OGFA 3EZNA 4DY6A 1FP2A 3KUUA 1TEZA 3U6BA 1JR3D 1HT3A 1ZXBA 3GH3A 2F3TA 1QBKC 1YXMA 3TGPA 1LS1A 3FKJA 3QLUA 3F6SA 5HOQA 1R5JA 4WESA 4UBJA 5AOCA 1PR1A 1IQPA 4UASA 3IB6A 3UCFA 1JHPA 1Y3IA 2Q6IA 2Z95A 4XZ3A 4BAUA 5HKKD 3M5WA 4X65B 2R86A 4E32A 1P1BA 2GCEA 1ZONA 2IELA 4O1MA 5GY7A 3UPTA 3UJDA 1QNFA 3UYKA 4CM7A 3ILSA 4H60A 3LM8A 3EWAA 5AM0A 4QJIA 5DYIA 4F46A 1P4GA 2WF9A 5LWQA 3G49A 3UFBA 4EY4A 3NRBA 1HV8A 1RBQA 4OVKA 4CLHA 2C2WA 2KQUA 4DEXA 5TLSA 3VTAA 2H2DA 2PHZA 1U63A 4UU7A 2X7XA 1CRLA 2PKRA 3HI4A 4IX1A 1IB6A 1DKNA 1TM7E 2W2XA 1VMKA 3ICCA 3OJLA 3DVRX 4F91B 3WAGA 4P1ZA 2ZJOA 3CY6A 1Z17A 1FDVA 4RW0A 4EGSA 1K7CA 1RZVA 5EIWA 2WT4A 2PNFA 3ZHOA 5KOYA 4R2JA 3IEIA 3WI7A 2D7JA 4DAOA 4YALA 3N8DA 3HN2A 2IOFK 3ZWVA 4F5ZA 2V6GA 3B7WA 1UFVA 2GYVA 5FWNA 4J94A 3HZRA 2GN2A 6ABPA 3ADCA 2Y2UA 2JIQA 4E09A 2PU7A 1SK9A 5ECGC 3PFHA 3NOQA 4KLRA 4OLFA 5CJPA 5I4BA 4H15A 3L93A 3EODA 2PQ0A 2H4HA 3N8NA 4LQLA 4PPGA 1GKYA 5FA8A 1GO2A 2I4TA 1CF4A 3KWLA 1PR2A 2GBLC 2XYPA 2NWQA 3UVEA 2X4DA 4YA6A 2QMQA 1D7AA 2X5OA 2DEUA 3BL6A 1P1CA 2XR1A 2D3TA 1XA4A 2ZOSA 4L4YA 2ONKA 2B21A 2O1SA 4AIIA 2ZBFA 3LKDA 1FQKA 2ZCUA 4AYXA 2OORA 1VLVA 10MHA 2FRXA 1OASA 4XQ9A 4CLXA 5I7SA 4O0LA 2FPIB 4XGRA 2LDBA 2P75A 4NATA 3KWMA 3KZOA 2W70A 2P2GA 2B5VA 5DHQA 4MW2A 4E5YA 2HOQA 2NNWB 3HBNA 4LJAA 3GEMA 3UIEA 3ZZ0A 4MCAA 4HEQA 4LHEA 4C0SA 1F7VA 4O8CA 5CNKA 4JJEA 4UKDA 1MA0A 1J00A 1ARZA 4O08A 1EU1A 1U3CA 4COKA 3HFGA 1M7GA 1GAWA 1XELA 4QIHA 5H5JA 3UC9A 1L7RA 3RVMA 1P72A 5I8ZA 1S6YA 3GLKA 1YL6A 5KVAA 1X0XA 3V1KA 5ENDA 4MIYA 1OFUX 1XTPA 4ZT3A 2R5NA 1L7QA 1UWVA 2W2KA 1T4CB 1E1QA 2XZDA 2XWQA 4RAQA 1VJ5A 1XVIA 3JYNA 3G2OA 1FRFS 2QP4A 1P6QA 3GDGA 3OY7A 1NE2A 3DAPA 1EP1B 3NHFA 2F67A 4MV3A 4MVXA 2O7QA 3FDJA 1NJSA 3I58A 2Q5LA 3OZRA 1EXVA 3GEGA 3SHVA 2BGGA 1P80A 4QXQA 3Q0IA 3Q1KA 1J22A 2G0AA 3ZI0A 1QAQA 4K3UA 4PIVA 2XNDD 3FR8A 5H3LA 3V34A 1IZ9A 2Q5HA 4ERNA 1DU4A 3E3NA 1LB1B 3AYXB 4H17A 3ABIA 2XWPA 4MWGA 1H66A 1LX6A 3MEQA 3TF5A 1ULTA 2EZ9A 2CBGA 4WXYB 3ZHTA 3LKVA 4L4ZA 2AXEA 5AKYA 2CNLA 1SXPA 1VXRA 1YDWA 1RWBA 2XUIA 4WFIA 2FZGA 1EIWA 1U31A 3IC5A 4QE3A 1GADO 3NWOA 3OEHD 4LXTA 2MSDB 4AZSA 2BEUA 1RYNA 1SZCA 1JDSA 1MJNA 2H3HA 4RVGA 1WTCA 1YE5A 4P5DA 2VG8A 1JHQA 4M8IA 4QVGA 4WECA 5EJGA 4RA6B 2C3PA 4MUNA 1A2BA 4EPVA 1SOAA 2FDCA 3H5LA 1Z73A 1NZDA 2E5WA 4QL3A 3NKFA 5EWMB 1L5FA 2PR2A 2Y1EA 4HB0A 3UTCA 2O2SA 1J7KA 3CRRA 1W2GA 1O4VA 3DWFA 2NO9A 3IMFA 4HEHA 3ZDZB 4NECA 2A9KA 1ZMRA 2C84A 2F2TA 3FPBA 4G0ZA 2F48A 2WJHA 1T36A 2FE1A 2GPTA 4GOXA 4F3TA 1ZXXA 2WYVA 3GIWA 3LNTA 3VKUA 4RJKA 1IXZA 2CXHA 3A4LA 1J8QA 1D5WA 2BFOA 2PGAA 3LGAA 4IG4A 5K3SA 4PIPA 4L72A 5AKKA 2OKGA 1UQUA 5FR2A 2O1EA 4CR7A 2EIHA 1E58A 4PGMA 1U8CB 2W98A 4RY9A 3VFDA 1II0A 5BN1A 4PZCA 5IYZB 1VOTA 4UTVA 3RC8A 1G6OA 4E13A 1U2SA 1OAOC 4DNXA 4YUVA 2OG2A 5KNCA 3LECA 3BWXA 2A88A 2OFPA 4PXSA 3VM6A 5CFQA 5JSZA 1M7BA 4NZZA 3JVVA 3I76A 4B31A 4OFXA 4FZ3A 4GMXA 3ES9A 4HDKB 3WG9A 2ORVA 1Z25A 2J9FA 2GCNA 4IIUA 1RXVA 4ZFNA 1PEKE 3JAWA 3PG5A 1C14A 5LYJA 1CJMA 2W00A 5FB3A 4HFJA 4FK8A 2FZKA 3TLEA 4PICA 1GOTA 2HF2A 4NCXA 1VYHA 3DUWA 2YW2A 2EGHA 3QRWA 4FSHA 2XDAA 1XHEA 5KNBH 2RHGB 2C9CA 1WZ2A 3VOTA 1QO0A 4Q7EA 3BJZA 1Z4QA 3I1FA 3VZSA 4ZJYA 4HQ0A 2OFWA 4O02B 5CK4A 5AHOA 3HGMA 4QYXA 2LKDA 5IJ0B 2MOKA 4HX5A 1JEAA 4KP7A 4Z86A 4Y7DA 1JRLA 2W6QA 3KJGA 2WT9A 3D7KA 4RDIA 4BGVA 2YZGA 3GA5A 2FCRA 2A7QA 2HMUA 1PLKA 1T9AA 1DC3A 3HNOA 1CVRA 1H6BA 3H99A 3L40A 1AUVA 1GDHA 3ZBTA 5HIJA 2GM3A 5J4HA 1GU1A 3K8OE 5LP6A 3TI9A 1ZICA 4AY5A 4OJQA 1J2EA 3U4GA 2ZRHA 1K98A 2WG0A 3GCDA 3PGVA 3NM6B 3M6LA 2R1TA 2YINC 2VDJA 1N7JA 2OGSA 1QR6A 1V11A 3L8FA 3HYCA 2QQFA 1RYBA 4YUWA 3U1BA 1JAZA 4B4KA 3PJGA 5T3UA 4LOHA 2A56A 3KQMA 4ZAWA 5B1YA 5JNSA 3AR8A 3DL4A 4G25A 1YA4A 1OLOA 3E53A 4LKOA 2I6XA 3ZXSA 4CMAA 3WC4A 1FSFA 2HMTA 3CMMA 1VPEA 3IUMA 4CDMA 5JFOA 1M83A 3F47A 3K2QA 4PVDA 5CVUA 2CBXA 4QEKA 5HF9A 4PX5A 2VSOA 1EB9A 3P96A 4K9PA 5THKA 1EI9A 2W37A 3VYWA 1I7SB 2QGNA 5AJUA 4TS4A 2IUTA 3CMCO 3R41A 4ZN6A 5FO1A 4LQDA 1P9WA 3V6MA 4W8OA 4PBRA 5CFRA 1XRLA 2YHIB 4QUHA 4NG4A 3U61B 5ILOA 1YIDA 1Q74A 1CY7A 1QHSA 4PPQA 3Q9NA 4M0LA 1PT6A 5EGSA 4P36A 3GDFA 1WKVA 3KQWA 4DNPA 3N0VA 3RU2A 5HUQA 3FH0A 1GPBA 4PX2A 3BCSA 1KEKA 1H93A 3M2PA 3O4GA 3OH8A 3ANMA 2WWXA 3E1GA 2AMYA 5CLIA 4J7AA 1YKSA 2YV3A 5JHHB 4BWYA 2WMNB 3JQFC 2P1ZA 4LSZA 4AUMA 4DWOA 1XD2A 2CKMA 3PTZA 1QCCA 3ND9A 3NTQA 4JWTA 2AEFA 4R8SA 4CCWA 3DEFA 2WNIA 1QH0A 4BEWA 1M76A 1KQFA 3B1FA 4HUJA 4I9UA 1E60A 2ZJBA 1AUOA 2ZRCA 1XDDA 2D5IA 2ZUDA 4DXDA 4QQ8A 1IM5A 1J25A 4RSGA 2WTUA 1VSQA 1YUMA 1CUWA 1QTQA 5HFJA 4L07A 4BDTA 3UT5B 2FWRA 3FGOA 4RVCA 1XZEA 2GZ1A 3WKCA 1TQ2A 4JQSA 2F8TA 4MLDA 1XRPA 1DWPA 4HNQA 1GNRA 5IDYA 2OYRA 1EWYA 4KDEA 4X71A 3TOSA 4F3CA 3D2CA 3O4JA 3DTTA 4IQFA 2OP1A 5I9LA 2EGGA 4MEAA 3EPKA 2BR4A 3P19A 3E7PA 4TMZA 1F4PA 1U0EA 3CVJA 4RNCA 3FCAA 4PG6A 5EIEA 3RJZA 4NEQA 1CZOA 4A8PA 5ALOA 1VGVA 2E82A 2JGAA 4LZAA 4JLAA 5JJBA 2OD7A 2Z9DA 4RYDA 4P4UA 4BVJA 4J3JA 1FX0B 1XMQB 4DMFA 1LWNA 4OA8A 3QLTA 2DX7A 2Z3VA 1K66A 1NUHA 4N6GA 4NH4A 4Z8XA 5DF1A 5ICEA 3E8XA 3MK31 1J6UA 3HFSA 5J1SB 3A6KA 2Q6VA 4IHAA 3IOBA 1OLSB 1QYIA 3M1IA 4TN1A 4XOIA 3O84A 3WHPA 2AKYA 3OZSA 4L8WB 1SHKA 3RFXA 4IQGA 3D8TA 1D4OA 5JAPA 2QVLA 3ZCPA 4OQMA 5FUQA 2SKCA 3KT6A 1W5EA 4XXHA 3EMKA 3SIRA 5BW5A 1U9ZA 2OR3A 4N0PA 4H7PA 4P7KA 4B7AA 4Q4HA 3WKEA 3O2SB 5AK6A 3ZYZA 1U8YA 2A5DA 3IDAA 2NZJA 2CD9A 1E92A 2AHOA 2YQZA 4GRAA 1BSVA 2AK3A 1YQTA 4Z2YA 1BVYF 3DDZX 3UAOA 2Q6OA 1QF6A 3E9EA 1Z74A 2WDZA 3GG2A 2O2EA 3Q8LA 4EGFA 3IDQA 1TA4A 4HD8A 3IUEA 3DKIA 4C4PA 5BVHA 3U19A 4B79A 2WUFA 4JH0A 3WLLA 3AO0B 1E59A 4G6ZA 3O4VA 2VPPA 4AO7A 3RHZA 4L8FA 3AG5A 4WESB 5FHRA 2WM2A 2ZYVX 4U2FA 1HDYA 4N9QA 4U8GA 2OZPA 5EUQB 3ZWOA 4PGGA 3BRWA 3TQHA 2WJPA 2WYUA 1R9JA 3DUFA 4LOAA 1IDOA 1SFRA 4N1AA 5C1IA 1YQEA 2AX3A 3LFTA 2FEAA 5FL3A 2AOWA 4OEHA 2J08A 4LBYA 1KZ4A 2HWUA 3MB5A 1W0JA 1R3UA 1UDBA 1WY5A 3RCBA 2QK4A 3KB8A 1AKUA 3QFCA 3QXJA 4GOND 4MKRA 4S35A 4X6UA 4G01B 5FH9A 3KQNA 3W2IA 1M5TA 3HJAA 5GM2A 3PRHA 3TDKA 2DCMA 3EEYA 3WIDA 4QZVA 2WWTA 4IINA 4KX3A 2IHBA 1PR0A 2WHYA 3K1AA 3BZBA 1QK3A 1VXOA 1XE3A 4TX1A 1QGZA 2RC5A 4Y8VA 2ICAA 1T1JA 2NO5A 1DC4A 1IEQA 1UBJS 2D1SA 2REXB 3URMA 4XR9A 2ZE5A 1T2UA 1X1QA 4JB0A 2QZPA 2QYOA 3WLNA 4JU8A 3N39C 5IJWA 1DQPA 1KI1A 1KQGA 2CSXA 3DAOA 3HDVA 2QXYA 1EX6A 2IPAB 3DFKA 1NVVQ 4R1QA 3NBUA 1DTEA 3MGCA 4QJ4A 5KYTA 1KVRA 1PNQA 4JI3B 5JEEA 5JNUA 1YHNA 3HYNA 1CLUA 3MMXA 5I9TA 3L8DA 3NAZA 4DJTA 3FHJA 1L5QA 5H1YA 2M32A 3RJ5A 2ZTVA 2V7WA 4EG6A 4D9MA 4QOHA 4RJTA 1X74A 4KN6A 1K5GA 1JHYA 4DCPA 4GW3A 5JQWA 3QSYA 3D6AA 3F4LA 3JAKA 3OTGA 4OBXA 2YWJA 2JZOA 3SNKA 4B71A 1OX6A 4P93A 4S2EA 2E6UX 4I19A 5CG1A 1U2PA 2H7YA 4L9AA 3V32A 3TZHA 4F8YA 4MUXA 1JHAA 3GEEA 4IGEA 4B1FA 4DIMA 2XIQA 1Z0JA 1BS1A 4FCWA 2FPUA 3MBKA 4XUGB 3H83A 3K5PA 1NBIA 3D9QX 3HA7A 5FNVA 1I7DA 1A8UA 1RPZA 3FFTA 3ESAA 3FTDA 3UJNA 1L8XA 1M0WA 2WWRA 3LHIA 3Q72A 1U28A 4TMFA 4ZD6A 5LP6F 2AG8A 5ER9A 1P62B 4YP0A 1DRWA 1NKSA 3SXPA 3EFOA 3CTPA 3ZGVA 3DLAA 1TJYA 3C15C 1RBZA 4S1NA 4TYPA 4DCSA 2WIBA 1NVEA 4J16C 1R8SA 2OEPA 4QHTA 1U2GA 4YEDA 2B30A 1NVFA 1H2FA 4M1WA 1JHUA 1RLMA 2EJBA 4UUAA 3OO1A 4BMOB 3WMEA 5EHZA 4CGZA 1E1CA 3C7DB 3F8SA 3PX7A 4Z7OB 3CURA 1F0KA 1BEEA 1L4KA 1NW8A 1G4UR 2VWGA 3BAFA 4TXNA 3SBDA 3VHXA 4DSAA 4JI2B 1IDN1 4DXHA 1X1CA 3L7OA 1DBRA 1AUPA 3P0JA 3CO5A 4PC3A 4X97A 3G0CA 3OLQA 4E15A 3HBFA 4V2IA 5IBPA 1R10A 5IDWA 3GH1A 3L05A 1DFHA 4C4OA 2ZYSA 3AC0A 4XVCA 4TMTA 1TLFA 5ARDA 4UBKA 3A2NA 2FWIA 2D1FA 1UPAA 2C5FA 3KZCA 1SXHA 3R3XA 1T24A 1UEJA 5JZSA 4F96A 4WRRA 4YYZA 5KDOA 1VL1A 2D1YA 4DRXA 3AM1A 1DBSA 1RC0A 5C7OO 1TMOA 4HSEA 5HHTA 2UXCB 2J6HA 1IXRC 3SXJA 3FJOA 3AU9A 3KQUA 1Z7GA 2BRUC 4OK6A 3LDHA 1ZCAA 1S7GA 3K6RA 1AGXA 3GT4A 2RHLA 1LH0A 2BEUB 3AR6A 2BOVA 3EDCA 4LS3A 5CEEA 1DXHA 4P54A 3FMFA 4FEAA 5FUWA 1E7MA 5JMPA 3NFRA 2O19A 3SQXA 3UB3A 4QYMA 2JHAA 3IRVA 1MAAA 1RRKA 4TVSA 1I9CA 2R7NA 2Z1MA 1NMSA 4LMRA 2RE8A 4IJUA 2ZS8A 2QROA 2YH2A 4DJAA 5AJWA 1Q7GA 5EUMA 2C3UA 3MFYA 1FVXA 3AX6A 4NARA 5FTMA 4EG3A 4NL4H 1FSGA 1NYQA 1WCV1 2H18A 3F5FA 4OBBA 4C6SA 4F56A 5JBNA 4WXPA 3R7SA 2AVNA 1CK4A 1KFKB 1MDFA 4ME6A 2IHUA 2NXEA 3L7KA 1L5RA 1T36B 1HG1A 2ON6A 4TRNA 1GXSA 4CMBA 1Z6PA 4X63A 3L02A 4HDAA 3FTCA 1UOEA 3KYDA 1N7IA 3THSA 1S3IA 4MX8A 1B6RA 1IY2A 2IHTA 3CNEA 1Z5NA 3C6XA 1FYVA 2XRYA 3SCZA 1TVKA 1E4EA 4C78A 2GO7A 3BCUA 4O4LF 4WOJA 3OF2A 1V8ZA 4CYMA 3DD5A 4LW8A 3DKKA 3A7DA 4JLUA 3T94A 5DYNA 5JHGB 3GRFA 3HS3A 4MCHA 1X7DA 4C0JA 1WB9A 5JNVA 1U3VA 4FNGA 3N0XA 2AXQA 2W58A 5JSZB 3J7AC 4AYWA 1QKIA 3GXBA 3JVUA 4JI1B 3WMFA 5G53C 4AS1A 1GFZA 2R8ZA 1LZLA 3TAXA 2J9FB 2LW7A 4ITUA 1DRUA 3NBXX 4L5BA 3Q87B 4MP8A 3TG2A 2F1IA 1DBPA 4Z9YA 5LYJB 1ZVJA 2IHJA 4NJMA 3QA9A 4R6XA 1NVMB 4XPZA 3UMCA 2WTAA 3VKHA 2BHNA 3WJAA 5KDLA 1T3HA 1DHTA 3N2IA 4EGQA 3ZY6A 3ENNA 2ZYHA 1GQFA 2I0FA 4F11A 2JLVA 4NMXB 1RRCA 1E64A 2DRIA 2OKCA 1U7DA 1F1JA 4MVCA 1FJGB 5TT0A 4RZHA 1H2HA 4Y6SA 4Y3UA 1FOEB 1N5MA 3CGWA 3WB0A 4DM7A 1GTSA 5DI9A 2GPAA 4A6XA 2OK7A 3B60A 4GSLA 4EFLA 2Q3HA 2JZCA 4FDMA 2WFAA 5FOVA 3QPDA 3NNDA 2JD0A 1C3EA 1I2CA 1ADFA 1G2QA 4IJMA 3CPJB 5H0IA 3OSZA 2GR8A 2EP5A 3ZH2A 5CRIA 2VDUE 1ORVA 1PHRA 3VSEA 2ORWA 5LP6B 2PA0A 4FX5A 4G1UC 5DXFA 2EQ5A 5FTJA 1QQ6A 1XJWA 1SKYE 2CF5A 2QM3A 1ISMA 2RBEA 2TMGA 2ZBGA 2QI9C 3HUDA 3I72A 4HB2A 4U1RA 5EAIA 3Q2IA 5SV2A 1W6RA 3ROXA 4BFYA 5IT4A 4Z4CA 1XVAA 1G4HA 2FW0A 3IPCA 1UEIA 1V11B 3N1UA 5AP9A 2FZ5A 2REOA 1ZO8A 2OV8A 1WDKA 3O31A 5KSPA 4AAYA 3THXA 1II9A 4FCVA 1J0DA 3WHKA 3L1HA 2BISA 4JT4A 5J63A 2YMQA 1DQYA 3PIIA 3DR3A 1EVLA 4B43A 5IBCA 3N3BC 1DIRA 2XYVA 3EXG1 3KKMA 5G1NA 3H1AA 3VR3D 3IQWA 5BOSA 3FLEA 4ZAYA 2CDAA 1L1FA 3CVXA 2CLFB 1DBVO 2FEWB 2G40A 3DBOB 3EF0A 1T9GR 2QZZA 3GBSA 1UAGA 3HADA 3B7GA 1WZEA 4JFAA 4V2UA 5HCIA 3W5CA 1HOTA 3RU3A 2PUBA 2QT0A 2K5UA 2PUGA 3M8KA 2X9QA 4BUCA 1XMPA 1AUQA 1WUJS 2XMQA 5EKUA 3EUWA 4FS3A 5F2OA 4HNUA 3SZUA 1YBMA 4H3VA 4UTRA 1WRBA 2GM4A 5FUMA 1CUJA 3GLHA 3BFXA 2IBTA 3ZBQA 5LD2B 5T6BA 1F0PA 2RHHA 2JLSA 4CMGA 1XZFA 2JD1A 3BORA 3GT0A 3LCMA 4IMJB 3TSOA 4KVAA 3WGOA 4UAVA 3FRHA 2GASA 2QTFA 5FNVF 4EHIA 1KZGB 3K1YA 1U1EA 3I9V1 2PYIA 5A4AA 2Q3DA 3HU2A 2XSZD 4GC9A 4OUDA 4FMCB 1OH8A 1D6NA 4CEHA 3OPMA 3OQ6A 2ZW9A 1NPTO 4IIDA 1YS1X 4I36A 4M9XA 2EFHB 3D6JA 3EMVA 5HOEA 1KKMA 1U2DC 1EQAA 1U3DA 1W36B 5PGMA 3ADKA 2C82A 3Q8MA 1NBAA 2HSEA 2V3VA 1YMUA 1QH1A 1QE5A 2I66A 4M7WA 4IM7A 4A0GA 1ODKA 1WR8A 4PO1A 3UANA 5D86A 4RA9A 2HHAA 1FTQA 5GZ6A 2XT0A 4KYIB 4I3FA 4YLGA 3FETA 5IDXA 5JCZA 5FP0A 2ZG6A 1D5CA 4Q3EA 4E2ZA 1GQ2A 3QFFA 2E4WA 3QVLA 3ZVLA 1N75A 1EWQA 1ZN8A 1E3DA 1GZUA 1HE2A 1RWOA 3WKBA 4FOPA 1GNPA 3UPDA 4YJ2A 2J9YB 3A9TA 4CT4B 2Z9CA 2I29A 2YWHA 1FFGA 3MJCA 1YR9A 3SXUA 4BNGA 2ZU6A 4K8OA 3EZXA 3OA0A 3TDMA 3ZQ4A 2WWVD 3DQZA 1UXJA 2R6AA 3UV6A 5DYWA 3K35A 2V6JA 4LOLA 4YIHA 4CM9A 4ALNA 1GGMA 2EARA 4QYSA 2FR8A 2BGKA 3M6AA 3MSCA 4AC9A 1QHHA 3EXHC 4U00A 1T4DA 1FS5A 2RIRA 4HVAA 4LGMA 4OMFG 4F86A 3I42A 2JD2A 3P0EA 4JOSA 1WW2A 2DFTA 4DIFA 5JZBA 5BVHB 3WP1B 2Z2ZA 1CZNA 3LRXA 5FOQA 1JECA 4PG5A 3QW4B 2DOKA 5HZMA 3V42A 1BCSA 1F4VA 4UEQA 2PZGA 1COWA 2LCQA 3OZIA 1XV5A 1UPUA 4PHFA 2H2IA 2B4YA 4QOIA 5KVSA 2VSNA 3DUFB 5KNDH 4L0MA 4JBXA 2LUOA 3TEFA 3TSYA 5ADHA 2ZAOA 1PSDA 5IK2D 3FNIA 2AUNA 2DHRA 4N9WA 3ONWA 1O97D 3WXBA 4HAIA 3EW9A 2H11A 4K0RA 5JS8A 5JY6A 3J81k 4EO9A 1TCVA 3DZFA 1QG0A 2J48A 3RGWS 3RYHA 2CVZA 2V97A 2HZBA 3UC5A 2V59A 1UFKA 3FLMA 3T0IA 4IZOA 4Z0HO 4B6QA 2Q4BA 1T2FA 1EVYA 2BGLA 2ZWMA 3I6YA 5DLEA 4A8JA 2NZ2A 2O20A 4H1VA 4I46A 3VXKA 5JCJD 3UV3A 5LZ4A 1JIJA 3DZDA 2VA8A 3K1AB 4LOKA 4XWGA 5CGZA 3OM0A 3PVCA 1FBTA 4WKGA 5GQSA 3TX2A 2KLBA 4KODA 3KZMA 4YRFA 1NONA 1WW3A 3KP1A 4DMHA 3PV0A 3K3PA 4ZVNA 2QJOA 4R71A 2HHCA 3R5XA 2FZCA 1JDVA 4EAAA 4IIGA 2ZZMA 1XBTA 4P32A 4R8MA 1W19A 1T4BA 2WMDA 4IBOA 4R4JA 1SUIA 2W2LD 3TOVA 1Y8RA 1A1VA 1X8LA 2GPYA 2WP8J 3VU0A 5AKHA 4WXRA 1SCUA 2RH5A 5BUQA 5EJ9A 5DM70 3VOAA 1E7SA 2ZAYA 3NBAA 2YOFA 3WIVA 4MV8A 4Y6OA 5FX2A 5AK0A 2C5HA 3FM9A 2L69A 3FKSD 2VBCA 5E4JA 5A06A 4KZPA 821PA 1HSOA 3ET4A 3JAKB 4IUYA 3UJCA 5ELXA 2WBLC 3DGEC 1Y1SA 3AM4A 4P83A 2GLTA 3NUQA 2Z8ZA 3FRJA 2WHQA 3E3MA 3KPWA 2H3EA 3Q8XB 5BSKA 4N0MA 4TKUA 2ODWA 4PYJA 3DHEA 5ALLA 4WGFA 3QFSA 2I2FA 1YCFA 3HGQA 1NUSA 4XD7D 3MPUA 3OZFA 4HV4A 2G0NA 2B3DA 4HI0E 3HVRA 2O8FA 1K3UB 3M1AA 2FETA 3GP8A 1GPUA 1NVTA 1H22A 4G5HA 5FKJA 3SP1A 1PJCA 2OGFA 1NY5A 2DR3A 3L7YA 4FQ7A 4GX0A 5HM6A 5LL6P 2BGRA 3ZY2A 4CIDA 4ENVA 1RKVA 2QY6A 1SUFA 1T15A 4G41A 4B4DA 4KWEA 4E5KA 221PA 3LCVB 4MVJI 2ZYRA 1VMDA 5HF6A 4C7OA 3LD9A 3N53A 2Y0PA 3NNNA 4Z8YA 3L6EA 5E2AA 3IJPA 3G2QA 4LKRA 5L4NA 2V0GA 2ZWVA 1J1IA 2IKQA 1L5HA 4INAA 3RVLA 3M6UA 3KTFA 1PO7A 1Q1QA 3ETGA 3DULA 3ZWMA 5JDCA 6PFKA 1E1CB 1ZD2P 3RASA 1PWYE 3G7SA 2V9PA 4JK3A 2DPXA 4PRLA 3DPUA 2L19A 3NC0C 3FROA 2HPVA 4HLUC 4TOIA 5DEOA 3VHXB 2B36A 4RLHA 3TTUA 2BGJA 4ZDIA 3KJEA 3ED1A 3TNJA 4JR2A 5I7EA 7REQB 2FHSA 1PGNA 2I2XB 2JAPA 3ML1A 1A9TA 3T15A 2ZUBA 3HDHA 4BZZA 4F84A 3AIKA 4BX8A 1BX1A 4QARA 5H83A 4F7WA 2WYIA 3AK4A 2CSUA 3DE2X 4R2MA 2C2MA 3IAUA 3ILVA 3O7MA 3UATA 4TWBA 3G82C 4DRXB 1Q2XA 1I2ZA 4BTEA 1LV8A 5EA2A 3T9EA 1DARA 2GK3A 1VLJA 4BU0A 1N6IA 3RHTA 3COZA 1NG9A 4B2PA 2I8AA 4GG1A 4JLOA 3U1TA 2XKKA 3BXGA 4DLVA 2FFBA 1KYZA 4C6HA 1SZJG 5ISMA 3HO1A 1JUDA 2WTMA 3DF7A 2EW2A 1QFYA 1I6WA 2VUIB 3Q7RA 4D4JA 4KK3A 4KK4A 1SCQA 1FP1D 3KLMX 4GVXA 5CBPA 2ODNA 1UFOA 1YU6A 5IF3A 2VP4A 2WHEA 1QR2A 1Z2OX 4JSYA 2J30A 4AUKA 1P3Y1 1U0LA 1OZFA 3DZ8A 3L6UA 2GNPA 2Q2NA 5ABPA 2VHTA 4GF5A 4DTIA 2XUQA 3RUDA 3P8ZA 4F1JA 3D1JA 1VYUA 2JJ8A 1P5ZB 2B8JA 1C3JA 1V3UA 5LR6A 2ZWAA 4GLLA 5TQ2A 1KJ9A 1FDUA 4P8RA 4D98A 1IVYA 3OECA 1NXPA 1O94C 1SCBA 3ROZA 1HRKA 2J3KA 5EIXA 5LOVA 4A26A 3KYDB 5FUYA 2EBWA 1B0PA 1SWWA 1UCFA 1PT9A 3QTTA 3QWBA 4N5IX 1TVKB 1E4EB 3RUCA 1IH8A 4PU0A 1FP4A 1VKRA 3L46A 3Q3VA 1YO6A 1G7TA 3QFTA 4CDRA 5FOSA 4P3XA 2NSHA 2OO5A 1G64A 2BR5A 2QIOA 1GR1A 3A32A 4MMYB 4IVNA 1MP0A 2CFSA 1SVMA 3NDIA 3HP4A 1ZKDA 4G4GA 1ULHA 5DCWA 4W5QA 4PAQA 2A9PA 2Q1XA 2HBYA 4J0CA 4QWMA 4YJ2F 4XCXA 2AJDA 1K8QA 1NSTA 2OO7A 4AY4A 1A04A 5KHAA 1F6DA 1GWNA 4EA8A 4Z4GA 3RRBA 3PPXA 4HGYA 1KMHA 2XCQA 1P0QA 5LPNA 3A7EA 1EFPA 3VUEA 4D74A 3ZGZA 4D9KA 4L7QA 1CR4A 2O8EA 3CF6R 5JAIA 3UXMA 1JNXX 1W4LA 2BMDA 3RG8A 4N7JA 3GQBA 4HADA 4B73A 3D64A 4LPSA 5IN5A 1H2WA 1DO8A 1QM5A 1I1NA 2VR1A 2JGEA 4FGKA 1Z2DA 3I4FA 1DIAA 1XLVA 3H2YA 2V9CA 3CQ9A 1CSEE 5I7OA 3CH4B 2C5SA 3D8BA 1F9EA 3HJCA 1SQGA 5BWBA 1C9DB 4EG5A 3DMHA 3ZTYA 4NPHA 1GA1A 2RC6A 4AULA 4GEKA 1C80A 2VDLB 5F7OA 3NHPA 6REQA 1Q20A 3S7ZA 3OESA 4IXDA 4YV7A 2OQRA 3KVYA 1ODSA 2JC3A 3UA4A 2G5PA 1BKDR 2M9MA 3CO0S 5BYBA 3CU5A 2PWBA 1KPHA 4N3CA 1WA5A 5I7RA 4N48A 1Z13A 1EP2B 2XKBA 3MZ0A 4HQOA 3PXBA 3SS7X 5CA1A 3T9FA 1KAOA 1WKCA 3QGMA 3FI0A 4XWAA 3VNAA 2RK4A 1H5UA 2DTXA 2E4XA 2G9VA 2Z5LA 3TQIA 4JYMA 3L0ZA 2QN1A 1J5EB 1ZAKA 3LK7A 2VXYA 3LXUX 1E20A 1Q14A 5JVDB 5IZ4A 3FOEC 4BOYA 4NAHA 4CM5A 4OGLA 2VT2A 4RTSA 5BOSB 2CXSA 1HL3A 1CX9B 2OUKA 1N9GA 1V7QA 5IAJA 1BH6A 1ZJWA 4H9GA 5AW2A 5DM4A 4DBZA 4E2FA 5HCUA 2P4QA 2R6R1 3ZLUA 3H1TA 4UMVA 3K0KA 3V8MA 5CDSA 1T9DA 4GLJA 1C4OA 3GX1A 3WLSA 2ZIXA 3QY0A 1M0EA 4P0PB 3INYA 3OU7A 4R0VA 1HM5A 3OUZA 3OETA 4HCJA 3EVNA 4TL9A 3IQDB 4ZTBA 3GLHB 3ZWWA 2HLHA 4W5NA 3JARA 3VPHA 5HJ7A 5FAXA 4Z3KA 1UJ5A 5G02A 1LLFA 3PGJA 4Q6WA 2NPOA 4DIUA 3PLAE 2OSVA 4EF5A 1TQHA 1YDFA 2KB0A 1JXAA 3F3MA 4IDDA 1AHNA 5ALZA 3RODA 4J43A 3HLKA 2CMGA 2VH2A 2ZRNA 3HO6A 4Y9DA 1E3EA 2REQA 5FBQB 3RNOA 1L5MA 1ZOSA 3V2GA 3G2PA 2HCFA 4ABYA 2BMVA 1E2LA 2IYQA 1TPZA 2C5GA 2WEKA 3F0TA 2Q1WA 3AKYA 3DVAB 1T5IA 2V6BA 3FTPA 3PNQA 4EM6A 1M8JA 4LYHA 4BFVA 3FXAA 3IQGX 3ODPA 5EE3A 5J9FA 4DM3A 5IULC 2WJVA 4Z49A 3K6SA 1GEGA 1JT2A 3L5KA 1K75A 1ZS9A 3BFKA 2HU5A 2NSDA 3BTUA 1B1CA 4DLBA 4KXMA 1NQOA 2JFUA 3K96A 2CCGA 5DT2A 1DZ3A 3EIXA 1OILA 3CJRA 2WICA 3F9CA 5KHOC 4RA9B 3WWEA 2Z8XA 3N0TA 1VG8A 2Q9BA 3IIMA 3OCXA 3NKVA 4N0DA 2VRCD 4Q19A 2QYSA 2Y8EA 2ZYTX 3C3KA 3KZKA 3OZWA 4N01A 3TPFA 3O38A 4EJMA 5JZMA 5A6SA 3EVBA 1HDZA 5F2EA 4ILEA 1K2VN 4X9XA 4OAQA 3TR5A 2P1DA 2YS7A 3LBYA 4K6KA 2X9NA 2QL5A 1P2BA 3HKCA 3SXUB 4EHDA 2GJKA 2I33A 5GM1A 2WSMA 4OHWA 4O8ZA 3T7SA 3PDCA 1KZ7B 3D7NA 3GHYA 4DS3A 2M6LA 3B8EA 3UJPA 2JGMA 3P0RA 4FGJA 4PQEA 5LMNB 4UCXA 4UHJA 4PG7A 5K99A 4JHXA 3A9SA 4CV2A 3DOUA 3U7HB 2J9ZB 1NJFA 2Y1XA 3L01A 3O3CA 4DCUA 1VKHA 2VK8A 2Q07A 3BREA 5KYWA 4FYYA 4ZQBA 1OF1A 1WM1A 1EX7A 2CEAA 4K05A 4BC0A 3JQ9C 4KMMA 3MT7A 1MZPA 4MA5A 3KU4A 4I9GA 2PIAA 1BCSB 2R68A 4WWHA 5H02A 4DBLE 2Y1CA 4EFNA 1YTUA 3DAGA 3EARA 4I81A 3SHOA 3H9BA 3ZE1B 1JI0A 4R0NA 3C97A 4M46A 1I2BA 4YRIA 2CNOA 4QT0A 5C5IA 1C9YA 2B98A 4D9EA 5EHQA 4AJ4A 1DADA 2PRZA 4JA2A 2HIHA 1YVUA 2GHIA 4Y2UA 3RVRA 1X1AA 1Y9EA 2QMOA 1GL9B 4DCVA 4E07A 3RI3A 2BF4A 2B6HA 2X2EA 3NWBA 4UHBA 4F2PA 3TKAA 6ADHA 2IYVA 1KAGA 4LHYA 3Q85A 3FZYA 3JWPA 3U3XA 1EWKA 4HAVA 3ZOZA 5LOVF 4DQLA 5E7QA 1L7VC 4A8JB 1BRTA 4KXNA 4RVDA 4BQPA 4DMGA 4ETNA 3ORRA 4ODIA 1U7TA 2H85A 4RK4A 5F1YA 1P0FA 2JIBA 2AOTB 2YJTD 5CTJA 3EDYA 5JZ9A 2QGZA 1ZLXA 3KK0A 4KXYA 3T0FA 1G3UA 2GBPA 3CE9A 4P7FA 2JGNA 2YVQA 3ETDA 4BZXA 4CM3A 5BWOA 4B74A 3CVUA 4HGNA 1KI3A 3V9PA 1C3VA 4CMEA 3MWKA 1DE0A 3IYLW 3UMVA 5I4KA 5FTWA 3O9VA 1Y8RB 3VX4A 5EJ8A 3GVIA 4NOKA 5T4FA 3UA0A 1R0YA 1QIDA 2GVZC 4MA4A 2UYQA 1SCUB 4Z9BA 1WNFA 2IEYA 3ZXYA 4I2VA 1IG3A 2G1PA 3BEOA 1X92A 1KJZA 3SOPA 2ZEJA 3LPLA 3LQFA 1NFRA 5A04A 3S70A 4XDHA 1ENOA 4V0QA 3H4MA 2PH3A 3CG4A 2FW1A 2PZEA 4KQHA 3TVDA 3X1XA 3V3TA 4EOGA 4WEQA 1U0JA 1SHZA 3KTDA 1RRVA 3LUFA 4KQ1A 2J5KA 2CFCA 1EE1A 5JH7A 2JVIA 4TKUB 5T4EA 4C08A 1RQRA 3JS5A 5HKBA 5EZ6B 4NH0A 4Y7CA 4RFSA 4TTTS 3HKBA 4FOTA 1MH1A 2XKAA 3CUSA 3IXLA 1MQ8B 3RU7A 3TLXA 2O8FB 4G5XA 4MUBA 1BA2A 3SDSA 4QFMA 2OBFA 2ZGVA 1GT91 4LF7B 3R3YA 1I3LA 3RAEC 3D6MA 4K6FA 4H4CA 1THGA 3GJRA 3IQZA 3NU1A 4RCZA 1J5XA 3TTVA 4D26A 3SF0A 3ZZMA 4ALMA 1XMOB 3P9SA 2HJSA 6YASA 5FYQA 4QVIA 4C7OB 1E0KA 2P62A 4JC8A 3E35A 4F2HA 2CLHB 4B33A 3K71B 2WUWE 1CDZA 1FNCA 1VA4A 4LZWA 1L5HB 1TFUA 1KE2A 3TIXB 5B5SA 5CA1F 1EK0A 3W5BA 1M2KA 2J9XB 4IIJA 3QWAA 3HB5X 4PE5B 2C99A 4R3NA 3BIFA 2DXIA 3DAFA 4P31A 2O7VA 4K03A 2YCLA 1HSZA 1Y80A 2Q1UA 3OOEA 3IQXA 4M7PA 1G42A 1KYVA 4Z9XA 5F7XA 5CH5A 2VSQA 4B83A 4AQ7A 4FDVA 4KQMA 4LC0A 1XZJA 3BE4A 5ILGA 2EC5A 3OTHA 1QOQB 5AMXA 3LX4A 3GDHA 4UDNA 3PEUA 2F62A 3K0CA 5DM0A 1T2EA 2CVPA 5JJIA 2EDAA 4QGGA 3GJ4A 2G5TA 1O2DA 2LE0A 3E5MA 3H0KA 1N6RA 4XUDA 3DDWA 2OCYC 1R1DA 1PJLA 3M0EA 4MV7A 4UTOA 3S2GA 4CODB 5F52A 1X2BA 1BEZA 1HG0A 1KAQA 3CKLA 4BFXA 4W8GA 5IKPA 4KFRA 3FKQA 4QHSA 1K8XB 5EOVA 4ZOQI 2GXUA 4AJHA 4BRSA 3T7KA 1L8OA 5SYAA 3RTAA 3GBVA 5DM60 5AQ1A 2ZE7A 3KKZA 3MWFA 4JIGA 4LGYA 1GGFA 3NHLA 5F21A 3U81A 4BGIA 4RTPA 4Z7NB 2ZSAA 2R1ZA 5C18A 4EFMA 1U7HA 2ZTLA 3H9QA 3H2SA 5CBPB 2D2EA 1WZIA 1YR3A 2WG2A 2BFEA 4G4SP 1NBHA 1JLKA 1Z4KA 2AQHA 4OJTA 3K09A 3S3TA 4LNUB 3OTOB 1A9XA 2JHPA 4KIUA 2M6RA 2OCDA 3P52A 1A5ZA 1E1KA 1VCNA 3AZQA 1T5BA 3DOHA 4G0QA 4IDNA 4IX9A 1Q0QA 4Q9LA 5DTEA 3V3KA 3W8DA 5AJZA 3PC2A 4M9ZA 1JDBB 5TQ2B 3ISVA 1UF9A 4UM5A 3MOIA 3QQPA 2RHTA 2X5JO 3NTLA 4FIDA 3TM4A 4G37A 4YXWD 5JO9A 4EJ2A 5LOVB 2G1UA 5CJ2A 4M21A 1OLUA 1XQYA