3IOCA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.50 ang resolution in complex with 5'-deoxy-5'-(benzyldisulfanyl)-adenosine
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
285
structure length
273
Chain Sequence
b'PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
total genus 86
structure length 273
sequence length 285
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iocA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iocA01
4MVXA 3A2KA 3RK0A 3CLSC 2HGZA 1N3LA 4ND7A 4Q16A 2WSIA 2Z3VA 2J09A 4HJRA 4R2MA 4ARCA 4U63A 3AIIA 3H05A 1V8FA 1TYBE 2ZUFA 1O0BA 1GZUA 4I6JA 1IQRA 4JYZA 1SURA 3L93A 2BYTA 4S1OA 1NP7A 2QJOA 3CA8A 2PXHA 1OBCA 1N2IA 4U7JA 4MWBA 4NATA 1KP2A 2DXIA 1EE1A 4JXZA 1B6TA 3ZJTA 2NSYA 3TZLA 1WJGA 2WQ6A 3CLRD 3DPIA 2YWBA 1WQ4A 1T6YA 2IELA 2AG6A 2A1TR 3COZA 5K0SA 4EG5A 1IRXA 4NZPA 3N8HA 1QNFA 1OWPA 3RHSA 3SEQA 1MC1A 1QJCA 2PZ8A 2PZAA 3ZUGA 3BL5A 1N2EA 3UMVA 1F7UA 4GRIA 4JFAA 3COYA 1JZSA 4F4HA 2QUJA 1BS2A 3LCJA 3VGJA 1WKBA 1U3DA 4YP6A 2QUHA 1G8GA 1YUNA 3L92A 1JIIA 1H3NA 4NX2A 3ZGZA 2D13A 1JILA 3TQIA 1Q11A 1T9GR 3MMXA 1MB9A 3MUEA 4MUKA 2Z09A 4MWCA 4OUDB 3X1JA 2EJCA 1YULA 5J58A 3IOEA 1IQUA 1P7PA 4R2LA 3HL4A 4EG1A 5LFAA 3DO8A 1U7XA 1GAXA 2G36A 3UOWA 5LLTA 2VTBB 3AFHA 3IVCA 5FO0A 3N9IA 1G8HA 1MBZA 1PG2A 4ZT4A 2JAXA 3CVVA 3FY4A 5TEVA 1Q19A 1RQGA 1QQTA 1TFUA 4ZT3A 5H16A 1GTRA 4K0RA 3IH5A 5J5AA 4NDAA 1I2DA 1WXGA 3C8ZA 3IODA 3PNBA 2JANA 4HPWA 2A86A 3X1KA 5KHAA 1M1ZA 3IMGA 1PG0A 4K03A 3N2YA 2CV2A 2A1UA 3JXEA 3CLTC 4X0EA 3MLAA 1MAWA 2D54A 5DASA 4WNYA 4ZCSA 4PBSA 4I6GA 2TS1A 1KR2A 4YP7A 2CT8A 2V0GA 2DPLA 1U3CA 1XNJA 4QREA 1NUQA 2AZXA 2ZUEA 1M8JA 5LM3A 1YUMA 2NZ2A 3K9WA 2QTMA 4KPUA 3SDBA 1M83A 3COVA 2I1LA 2ZP1A 1T6ZA 3FNRA 2BTEA 3NBAA 1MAUA 2JA2A 1K4KA 1Y42X 1QU2A 4MW1A 1FFYA 4YP5A 3H9CA 4KR9A 1R6TA 3P0IA 3DLAA 3FI0A 1GPMA 4DDKA 1VL2A 1ULHA 3ZJVA 3NV7A 1X8XA 5JBNA 4NAUA 2YWCA 1N75A 1OWLA 1ZUNA 3NBKA 3P52A 4MQ6A 5DEOA 5H7XA 2QTRA 4CDMA 3KFLA 3PNVA 3OTWA 5DB4A 1N77A 1O95C 2E89A 2PZBA 1X6VA 3CLSD 4MVCA 4HK4A 4E1AA 3X1MA 2H2AA 2WQ7A 3UK2A 3HZRA 3G5AA 3CVXA 1F7VA 1N2OA 1JIJA 1LW7A 3MXTA 1NUSA 1GN8A 3HGMA 1M8GA 2A1UB 1R6XA 1K92A 3UY4A 1NURA 2QUKA 4U8HA 1D2RA 2E0IA 3A05A 4TS1A 2A4MA 1TEZA 1NYLA 4ZT2A 1K4MA 1COZA 4DDHA 1DNPA 1XNGA 1NUUA 3FH0A 3GLVA 4CDNA 3VRHA 4J75A 4FZJA 4MWEA 1ZH6A 1Q77A 3ZXSA 2CSXA 1YI8A 3HFJA 3DV2A 3RFFA 1VLHA 4MW9A 3FDXA 2DEUA 4CT0A 2CUZA 3HMQA 1H1TA 1M8FA 1NZJA 3TS1A 3H9BA 1WXIA 4EG8A 1NUPA 3FETA 3VU8A 2VTBA 1QRTA 4AQ7A 3QE4A 3UC5A 4MW2A 3ZXIA 4WSOA 1CT9A 3FWKA 2A1TS 4ZCPA 1WQ3A 1N2HA 3Q10A 1O95D 1JMVA 1KQOA 2O5RA 1KAQA 4ZCTA 2V0CA 3ND6A 4ZT7A 4EG7A 1ILEA 3N05A 1KH3A 2RD2A 4EFKA 4MUHA 1Q15A 1O0CA 2CV1A 1VBMA 1IVSA 3QTTA 1TYCA 4YMIA 3AKZA 3G6KA 2J4DA 4EF6A 3D6VA 5AHWA 4UZFA 3CVWA 2OQ2A 3CLTD 3ND7A 2X3FA 2XRYA 3P0JA 4XFJA 1J1ZA 4J76A 1KQPA 1OD6A 4XFDA 3GMIA 1MRZA 2GKSA 3PXUA 3QTBA 1QRUA 3U1VA 3G59A 3COWA 5KCMA 1JGTA 4QBTA 2YXNA 1O97D 1JZQA 4KKVA 4EGAA 1OWMA 1ZH0A 3LOQA 2EL7A 5KWVA 3HV0A 4UZEA 3IOCA 1N2JA 1EFVB 5FNZA 5K0TA 1T9GS 1O94C 1O96A 3E27A 1KORA 1PFVA 1M8KA 3IVGA 3RJZA 2J07A 1JHDA 1J1UA 1WOYA 3AL0C 2CFOA 1FYDA 4MUFA 1YIAA 4AS1A 1EFPA 3SZGA 2E18A 1K97A 4ARIA 4XSVA 4DLPA 4R0NA 2HMAA 4OUDA 4ZT5A 5HUHA 1LI5A 2WB2A 1I6MA 3FHJA 4MULA 2X1MA 1PFYA 2GOYA 4F3RA 1U7DA 3RK1A 4RPIA 3I05A 1S4MA 3KT0A 1H3FA 2J08A 1KH1A 1O6BA 2H29A 3OP1A 3KT6A 3SP1A 2PG3A 1JEDA 1I6LA 4BWVA 3S3TA 4KR6A 1J09A 1J20A 1IH8A 1XNHA 4QRDA 2D5BA 5F23A 4MUGA 3Q12A 2A84A 3IVXA 1G8FA 4NAHA 3SYTA 1O97C 1F4LA 1NI5A 1WXHA 3CLRC 3GUZA 1IFXA 3RBAA 4MUJA 5FO1A 1EJ2A 3SEZA 4MW4A 3AG5A 3IOBA 3M5WA 2CYCA 2RE8A 1M8PA 4ND6A 1MOPA 2AKEA 4P2BA 2YY5A 4H3SA 1XJQA 4YBRA 3TNJA 3IDFA 1U0BB 4DDMA 4KR7A 2QJTA 4I6EA 1WY5A 4JXXA 3TZEA 1WXEA 3ELBA 3FOCA 4MWDA 4HJXA 2X1LA 1G59A 1N1DA 2QTNA 1N2BA 3INNA 1TQ8A 2J5BA 3CLUC 4MW0A 1GTSA 1UFVA 1JEEA 4EG4A 3ISJA 4RUKA 1YIDA 1KQNA 3FIUA 5HUJA 1VBNA 1WZ2A 1MB2A 4MVYA 3ILVA 2PFSA 5J59A 1TYDE 4DJAA 1O5TA 2CV0A 2HZ7A 2Z08A 1V47A 1HYBA 1VBKA 1TYAE 2VXOA 2IJGX 3KT3A 2B7LA 2X0KA 3CR8A 1QU3A 4PBTA 1KH2A 4MW6A 5EKDA 1JIKA 5TGTA 2GM3A 2O8VA 1J21A 3F3MA 3PNYA 5DK4A 4L2IA 4CQNA 5TEWA 4G6ZA 1OBHA 1QTQA 1IHOA 4OJMX 1EFVA 3IMCA 1MJHA 1J70A 1N2GA 4A91A 4EG6A 1JECA 4MUIA 4JZYA 4Q93A 4DNXA 5BNZA 1KP3A 1OWOA 4G5YA 2DUMA 2E21A 5IHXA 4MW5A 2DLCX 3K32A 4MUNA 3CLUD 1O94D 3A04A 4GU5A 4KPUB 5HG0A 4MUEA 3H99A 4PBRA 3FG9A 3LE8A 1IQ0A 3MLBA 1PFWA 3D6UA 1KKUA 5TS2A 1N78A 3IUEA 3Q4GA 4L2IB 1H3EA 2DERA 1GLNA 1WXFA 4PY2A 1OWNA 3ZJUA 1LI7A 1EFPB 4ZCRA 1ZJWA 4ZCQA 2QJFA 3P0HA 2CYBA 3IUBA 1F9AA 4G5FA 3H97A 1A8HA 1PFUA 1EXDA 2DR2A 3CVYA 2XRZA 2C5SA 1I6KA 4MLPA 3A4IA 2A7XA 1NSYA 4MVWA 1T6XA 2A88A 2QUIA 2CYAA 4MW7A 5IJXA 3SZ3A 2OV4A 1NUTA 2DETA 3AG6A 3PRHA 1EUQA 3TQOA 1QRSA 2PIDA 1KAMA 3CVUA 3ZIUA 4DE5A 1R6UA 4ZT6A 1O96B 3ND5A 2IP1A 1EUYA 4EG3A 3KT8A 2R5WA 3IMEA 4MAFA
chains in the Genus database with same CATH superfamily
2J0UB 4HUQB 3BHNA 2AMFA 3WGHA 1MP0A 3CNEA 4HZIA 1J23A 2VF8A 1R6DA 4ARCA 4IIHA 1RNLA 3A1VA 3W9YA 4ALKA 4BKOA 4EFNA 3KS9A 3CLVA 4BLOA 1O0BA 2R8OA 4S35A 3PQ3A 1EHYA 1HLFA 3U3DA 3RWBA 1NW5A 3D4LA 1G21B 4C6TB 1PWXA 3VZCA 5GVSA 4MDFA 3EZLA 4BLTA 1IZYA 5IDWA 4QDJA 3AHFA 4ZARA 4DR1B 3JQAB 5ADVA 3OURA 1P4SA 3QZUA 1RQRA 2W8BA 3ZX4A 5LR6A 3MTIA 3OOSA 5LA6A 3L0DA 1B6TA 4N6NA 1KBZA 3V1TC 4XZ3A 3BZUA 3M8KA 4BX0A 3GHHA 5T64A 4MYRA 3U4CA 3CX6A 1R8SA 3N7UA 4US0R 4X1IB 4WZBB 4YUXA 3TTUA 1DZ3A 2GCIA 3R9IA 1LKZA 5DM2A 1DLIA 2ZT5A 3CFIA 2W0SA 5FA6A 4PWYA 4JCOA 1KE2A 2YIMA 4UNIA 1JQLB 2PK3A 3N8HA 1FS6A 3EWIA 2G8NA 2GI4A 2CFSA 1YR8A 3IAS1 5GV7A 3WB1A 1R0RE 5AW9A 3SIXA 5IS2A 2JJ1A 1PJSA 3B2QA 1YBAA 5HWSA 5DZSA 3NWEA 3VR6D 1JZSA 2NO9A 3W5AA 1Y3HA 1BS2A 4XIFA 3R5JA 1PDVA 1EINA 1WKBA 2GXSA 4DW8A 2YNMC 1YUNA 1KAOA 4R9SA 2BP7B 4JQZA 1KP9A 1Z5WA 4JFRA 2XF8A 1BG6A 1N78A 4LE2A 3OWOA 5DN9A 3I9OA 4ZQEA 4GLLA 4K6KA 4KLAA 3DFKA 4G5XA 4N54A 4JKYA 1SHKA 2ZI5A 3VNRA 4D45A 1KFCB 1P5ZB 5DCLA 1KOJA 3HCEA 3A1UA 1D8TA 1E2KA 1E89A 4C7XA 4FN4A 4HGRA 5C7LO 1P4GA 1QKKA 1X1DA 1G7CA 2RGCA 3JQEA 5EZ6B 4R2LA 2GZDA 2YH2A 5IKEA 5I7HA 3TPZA 1L4EA 1Z0ZA 3GUHA 3R3UA 1MAAA 4WBSA 4D80A 1GZSA 3C6QA 4BJ6A 4NNOA 2ZTLA 4EGQA 2P4QA 2JHAA 3W2GA 1CLUA 3IVCA 1XZCA 1Z34A 2OE2A 3LXXA 4L1KA 3DOJA 3GJRA 1Q12A 2IOHA 4IF4A 4TL6A 3DPUA 1C7RA 1QZZA 3NLLA 4BJ1A 3ILYA 4OHYA 1G8HA 1GNTA 2W6QA 2YMPA 5JMOA 1VECA 2FMUA 5JYDA 2QBYB 4JJAA 2ZBUA 4MA0A 4WLNA 2PGLA 3OLQA 1NHGA 4YRSA 2DFVA 2PLNA 4JB2A 1WOMA 3ZW8A 1MMFB 2DECA 3DXFA 2GZAA 4YJKA 4ZOLA 5BOVA 1QX4A 5A5EA 3WOHA 4GRDA 4QPNA 2VUHB 3D6HA 3TUJC 2XUHA 1GAQA 1U80A 2XD4A 5JJCA 3CG4A 3X1KA 4IQGA 2BTOA 1NSFA 3TTSA 3A58B 5B4TA 3C74A 3N2YA 3O8OA 1ADYA 1PYDA 2A1UA 3EVAA 3JXEA 3CE6A 1V1MA 2W8ZA 5DLEA 3FUVA 5JS8A 4GF5A 4D26A 5JZMA 2EHJA 3I34X 1Q6YA 4KQ1A 3W8EA 1WWKA 5DBEX 2GFQA 3L5KA 1PD1A 4EOGA 2BFMA 1T1SA 2XCQA 3GCGA 2G28A 3ANTA 5KDDA 2IBTA 5FL3A 4I50A 4YP7A 3NHBA 4JC4A 4OLBA 3TSAA 4QREA 1GUFA 1HUQA 1YQUA 4EAQA 4UBNA 3UJ9A 4CUJA 4BLUA 4EYEA 5IJ0B 1U99A 2R3SA 4Y2SA 3QKUA 4YQZA 2BD0A 3U31A 5DVZA 3KLOA 2XPCA 4Q7JB 2ZP1A 1O58A 4X3CA 2HA3A 2FP4A 2Y1WA 4NIMA 3NBAA 5E95A 1JVSA 2B6NA 2BKLA 4XEUA 2O5CA 2X9LA 3PUZA 3LLUA 5JAHA 3SLKA 2E1RA 1DC7A 1Z5OA 4CKEB 4PYNA 3GT7A 3HJCA 3AB7A 3PFHA 5KOJA 2C0PA 1NR1A 3DLAA 2VXYA 1GPMA 3M6IA 1RQNA 1UINA 3P0IA 4JLPA 2I4LA 1H2AS 3I52A 4NCBA 2JFYA 1E98A 1X8XA 3UJBA 2HCRA 5H68A 1IHUA 5BV2P 6REQA 2P1DA 3ECCA 3P4XA 2I3GA 2A7QA 1XU7A 4I19A 2VUTA 4EHIA 1EYZA 4U2GA 4CMJA 1MABA 1E9VA 2AN1A 2P65A 2X22A 5AM4A 5DB4A 3R7AA 3KHTA 3TOVA 2E89A 1XLWA 2DY1A 4MVCA 4WEOA 2NVUB 1P1BA 1US8B 1QP4A 3R9KA 3X1MA 2GHRA 2WG1A 1RWXA 4C0BA 4YXFA 3C24A 5JH7F 5C8DA 1NSTA 5F51A 1F7VA 3BFJA 4DLRA 4ZYVA 1J42A 5DPMA 1DHTA 3M3PA 5GGYA 3MLEA 3GCDA 2VNHA 2FE1A 1R6XA 2NAFA 4UULA 4ZANA 3BRQA 3UA0A 4W1RA 1NJ8A 3WOVA 1H0HA 4N40A 3STHA 1X7GA 4NEHB 3A05A 5FWXB 3EMOA 2A3NA 1E3LA 1ETUA 2Y1DA 2VWGA 4B3BA 4CEJA 1QGAA 2XUFA 1YOVB 3U49A 1SUIA 5C8YF 3EZFA 1Z2CA 3K2IA 3GLHE 3Q7SA 3JTMA 1UFQA 5BN4A 5G0WA 1HK7A 4PRZA 1N8SA 2WM8A 4BQNA 1E3EA 2FU5C 1JEYB 2X9QA 1VLHA 2QZ4A 3O8LA 3FTFA 3ML1A 1KI6B 3O1LA 3KETA 1V96A 4D4LA 1FFXB 1K86A 4EZBA 3VSCA 4DT1A 4OYYA 3R0VA 1VG1A 3OM9A 4Q00A 1ZIPA 1NJFA 2GAJA 4BMVA 4MW2A 3VU9B 1PF7E 1S89A 4ZJPA 2YZGA 1N0IA 2F62A 3EF0A 2OORA 2GN2A 2W70A 2IXBA 3A3KA 3UTCA 1TGVA 2ZRHA 5CW2A 3UENA 5K0FA 1E2NA 4BVLA 1WPRA 3M6VA 4YMHA 4P81A 2IYYA 4AF7A 2ENWA 1QF9A 5IDYA 1ODCA 4L8GA 5C8XA 1TI7A 2AI3A 2V0CA 5LP6A 1AV7A 4YT5A 2WA2A 2PUEA 1GTG1 1KY2A 2IW3A 4RVUA 1G7TA 1XRQA 2A5JA 4IEFB 1O0CA 3OLYA 3JYLA 2VJLA 3RYFA 1RZ3A 1KS9A 2GPYA 1OIXA 4AJHA 2NO4A 3OZCA 4GMXA 4BUZA 1DWOA 1I5RA 1MO4A 3PXGA 1G9XA 2QVXX 2J4DA 3NBZC 4IVNA 4OY3A 4CQJA 2J5QA 4OK6A 5C35A 2O05A 4DG9A 4MQ5A 4PXYA 4U0KA 3DKKA 2GF9A 2NM0A 3PG5A 5CMLA 1P7YA 3EQ6A 4B83A 3OIDA 2JH3A 3HKDB 3OPVA 3U4IA 3TKAA 1MVNA 4KZPA 1JA0A 2VO1A 3KCQA 4R8RA 1KZ7B 4XCVA 2GEJA 5BYBA 5A9SA 2QPOA 4EABA 3O5AA 2CUTA 3Q8XB 1QPBA 3QX7A 1OD6A 1AGYA 2A5FA 5T6BA 3KR9A 4YPOA 1DARA 3JASB 1JG1A 1H5UA 1UFKA 3JVVA 3CMCO 3ZCRA 2AI1A 2IXFA 3KL4A 5FBLB 4AJ4A 2ZR7A 4ECEA 1PEAA 1R18A 1ZKDA 2FZEA 5DHFA 1QRUA 4C6TA 3TUIC 3RV3A 3IXMA 1GPNA 1U1IA 5JJLA 2DB3A 3HA2A 5CYOA 4C0LA 2IS1A 3F7NA 2VYVD 2PZFA 3LFTA 2O4CA 4ZA2A 5K0CA 3RAFC 2QBYA 1C7JA 3NGLA 4RETA 1WAMA 4EPTA 2OVBA 2YASA 1ISGA 3D43A 5C7IO 1ZH0A 2X9GA 4GAEA 2BEWB 3UYKA 3GEBA 4OLAA 3QXHA 4DG8A 5F9FA 2N46A 5C5CA 1L5SA 1W59A 2GYWA 2C31A 4QEKA 2DHDA 1HE4A 2C0CA 2QSYA 1QV9A 2R6DA 2UZ1B 1T5DX 3N75A 3UATA 2LKCA 4UAJA 3UOGA 4EYQA 1QS0B 1USKA 2EERA 1S5PA 3FUTA 5HNKA 1EPUA 2H2GA 2GZ1A 4MUFA 3BX1A 3OEED 4LQ4A 2HB6A 4C1BA 2B4QA 3KEQA 4FFSA 4HX5A 3I6QA 3I8SA 3Q3JB 1VB5A 1LI5A 2FRXA 3M4YA 5T4FA 2J85A 1DXQA 1EUCA 1D1TA 1M2EA 2UVQA 5J9FA 4X7BA 5LBUA 2H4WA 1PZMA 2FZ4A 2HLDD 3VZPA 4H7JA 1L8XA 4NMXB 2BP7A 2OXEA 4H2DA 1BDIA 3IUPA 4HRAA 1KH1A 5I3ZA 1ZK4A 4MS3B 4LFAB 2X40A 3HCRA 1CF2O 1VCIA 1WZCA 4MWSA 2X1VA 3RSLA 4JOSA 3G0OA 3WJAA 4X1KA 1D5CA 3N1UA 2QAGC 4YJ3A 4AL4A 2NU6B 4A26A 5AUQA 2QSUA 3MGGA 5FLKA 4D4GA 3RJTA 4ZO6A 4ZEMA 5HTOA 2VQFB 1ISSA 3E0XA 2YHSA 5AM3A 5LZ4A 2D5BA 1XVLA 5LWQA 3TBFA 3IP8A 2H7YA 2HV8A 4HTFB 4DABA 1RZUA 3NB0A 5T67A 5L6MB 1DXHA 2HC9A 4LHZA 1R4MB 5TPZD 5U4XA 4TQAA 1IPFA 1HG0A 3HVHA 3MYRA 2ZZMA 1PR2A 3SC6A 3A1WA 3E1SA 4UBJA 1Y6QA 1LXCA 4WADA 1VCNA 1B8PA 4JZKA 5LA6B 1LX6A 1AZTA 1JA1A 1KJQA 3PA6A 3RSGA 3V1LA 1XJQA 1WNTA 3A31A 2JAOA 1ATIA 2CN1A 3AHCA 3H84A 4LHVA 4TTIA 2FI1A 3UIEA 2WJYA 1X14A 3SOZA 4CIBA 4PZ9A 3ZLVA 2CFCA 2R1TB 1VPEA 4P4TA 2XGSA 1U9JA 4JXXA 1XF1A 1ZH2A 4KGZA 1JE0A 5FJIA 5THKA 3ZU4A 3E22A 4KWTA 1DO8A 3DMGA 2OG2A 2AJLI 2EZTA 1RLJA 2F1RA 3DR3A 4YMSA 5I7WA 2YNMD 3AOEC 2O52A 2I52A 1R0YA 3NUGA 3MJCA 3VHLB 2DHCA 1XZEA 3E1GA 4LJSA 5HJEA 3TAUA 3V34A 5B3LA 5U1PA 3UBMA 1LB1B 2Q1UA 3DC7A 3MAAC 1ORTA 3I73A 4FJ0A 2ONYA 4A0GA 4IICA 3VBEA 2HLHA 4FZ3A 5LYJF 4YJ2A 3P2YA 1G5PA 4WBNF 2ZFUA 3KOOA 3K0SA 4CUZA 3WKAA 4BGUA 1XZDA 1SULA 2DOKA 3DLCA 2DTDA 4Q7EA 2WSYB 2JAHA 4S1TA 1IJFA 2LR0A 3KXIA 4U02A 2W2NA 3T5DA 4BX3A 1GNRA 2C1XA 3HP4A 3LC0A 3ME5A 1PK7A 2Z57A 2HIHA 3KT3A 3OPQA 3GZNB 1D7OA 2DSNA 4J0IA 5TPWA 4G1BA 3VYVA 1ZJJA 2FG5A 2RKWA 2R65A 4FFWA 3TQQA 3P2EA 2PS3A 4HGZA 5JQGF 1EFCA 2GLUA 1SCUA 2C84A 3EISA 1WCXA 5DK4A 2DFNA 1DPFA 4M9XA 3NW9A 3NHMA 4F7DA 5EJIA 1NVUQ 5M29A 2CVQA 2E7ZA 2QMEA 2RGDA 3DAOA 4J9VA 5J2UF 1Q3TA 4BNFA 4HV4A 1DS6A 1KYYA 1J2TA 1HKUA 4OMFG 1VJCA 2V1XA 4DUZB 2BFBB 4YMTA 2WT9A 4ICIA 3WHIA 1CXZA 4FS3A 4ASUA 4NDZA 3WWPA 4F97A 4QX6A 4JZYA 3A1FA 2X0DA 1JHXA 1LDYA 2HRQA 1HWYA 1JKXA 4NU8X 3A9RA 3E0QA 3O21A 3PC3A 4IHJF 4F92B 4HY3A 3K09C 3TJZA 4EKNB 1I3CA 4MUNA 4UE2A 4D82A 3KJHA 3B38A 1JFRA 2FVYA 2XDYA 2XQVA 3FPAA 3GK3A 1XYYA 3PUWA 4DIDA 2IUSA 4ZHQF 1UMCA 5MGBA 3LE8A 2FN3A 1QV6A 2F43A 2RAUA 3AEKB 4S2EA 5DLYA 3WMRA 4AZ0A 1H2XA 3G8CA 2VHUA 1VHTA 3CJQA 3BFVA 5AJXA 3JW8A 3K0BA 2GR9A 4I46A 5TS2A 1G19A 1BJKA 2YFHA 3SM3A 5H83A 4C04A 2W2LD 4PRYA 2WOJA 2ZUCA 2ZDHA 5AVYA 1TDJA 2IZOA 4MUMA 4JEIA 1EUDA 1UDAA 3RG2A 1LLDA 1TZ2A 3PDIA 2M2IA 3HKCB 3FUCA 1GZHB 3HDQA 3JZDA 1K6MA 4J0CA 4RFLA 3EF3A 3ZDQA 3PUYA 4NRDA 1NF9A 2R86A 4WFKA 4CIXA 1TMGE 5E9QA 2BY4A 2QL9A 2VTVA 3CVYA 3I62A 4OI2A 4BO8A 1Z5VA 4UVDA 4FCCA 5CX4A 2XA2A 3L8EA 4IRMA 4RHEA 4NULA 5L3VA 3W8RA 3L7DA 5DBIA 2Y92A 3IALA 4MRNA 4O29A 1E20A 2BC9A 3A3OA 3HI4A 1QVRA 4E6EA 2UUAB 3ZCSA 1WA5A 1SOVA 3EIFA 3R7WA 3SC2A 1BXGA 2NP6A 2IWHA 1C9EA 3NKFA 2DUUA 2VHTA 1BJRE 3P9ZA 2QX6A 4BUJA 1VJGA 3OIFA 1NV9A 2J3MA 2NPIA 3HO6A 3OCJA 1Z62A 1IXZA 2IZ7A 2ST1A 5AR1A 4DE5A 4DAOA 3R24A 1I94B 1FFEA 1WL8A 1JHZA 5IMSA 4W82A 1RWPA 4ZVVA 1JU9A 1E2DA 1GPYA 2OAP1 3D3WA 1HE3A 1SCJA 2A9JA 4L9SA 1BE8A 4FCVA 4MKFA 4P0PB 3DTNA 2OENG 4PZEA 1YRLA 2IU3A 3MC1A 1VG8A 4RHXA 1XD9A 4LBZA 1B3BA 3F7MA 1LRLA 1ISHA 821PA 4PG5A 2J09A 3GIWA 3B6MA 4PTZA 1N6HA 2NNWB 2OP1A 2XTJA 4JT4A 4N82A 1V8FA 4TMXA 4MJLA 2SKEA 1HQCA 1ZQ9A 4NECA 4E46A 4JYZA 1CYEA 3VR4D 4C0SA 1VXRA 1YB5A 5GMOA 2O8BA 1ZCAA 3JWPA 5DXFA 3CRZA 1BX0A 1K3TA 4S1OA 3UTDA 3WWEA 2PXHA 4CKYA 5BSKA 5BV7A 3RUDA 1R6BX 1JLKA 4U1RA 3R40A 5EPOA 1L5HA 2XQFA 2JHPA 3OMWA 1WP9A 5IAKA 6PFKA 4TYPA 5HGJA 1EE1A 5BUZA 4H59A 3BWEA 3K8YA 4G0QA 1AKMA 2WZBA 4LVOA 4P6VF 1K1EA 2R6ZA 3RAJA 2JBWA 4QOFA 3WLAA 2QZPA 3DPIA 4US2R 2F9MA 1HSZA 3ZY6A 1CF4A 5TMPA 3CWCA 5B6PA 3QIVA 4QOHA 1RXVA 1B74A 1NOJA 4YRFA 1TX4B 2RHGB 3OLZA 3ISVA 3OTIA 4AS3A 4BO1A 1RVV1 2P9JA 5DSTA 5AVOA 3WC4A 5KSYA 4EJMA 1QNFA 3R77A 2QV7A 2R2AA 4MAMA 1JSRA 1W5AA 3T9DA 3EYAA 1T9DA 1ITZA 2PZAA 1VFPA 5DBHX 3V8QA 4GL2A 3UMVA 3FKJA 2W6PA 3V33A 3BKWA 2QP3A 1NMZA 2OV3A 1U0OC 1A7JA 4JSRA 4U6NA 1YQTA 4E4YA 4N3AA 2A5LA 2C42A 3DB1A 4WHMA 1M0TA 2QPLA 1PJAA 2QWXA 2IHZA 3RSHA 3GLHA 4OP3A 5FLXA 2ZBFA 2UUCB 1C4WA 1UK7A 1F2UA 1UC8A 1EFDN 4HS9A 1EVZA 4NX2A 3ZS9A 3SNKA 1VC2A 2R2GA 3V3TA 5BSFA 3DP9A 3HYCA 5KYVA 1V8ZA 3AGQA 1YTUA 2VTDA 3DH0A 3ZW9A 5CLJA 3KB1A 4DB2A 3BEOA 2CFIA 4D0RA 3TGLA 5JCJA 2FNAA 5DV9A 1NM5A 1KZGB 2YWFA 1M2KA 3B36A 2LCIA 1BZYA 1Y1TA 2BRUA 2GNOA 2OFWA 3JPYA 4LXXA 4V02A 4WKNA 1AS3A 1I2AA 4A8JB 3AI1A 3OZFA 4NG5A 3K15A 2L2QA 2F9FA 2NZYA 3HBLA 1WV1A 3ND9A 1WPGA 4XJSA 5SYAA 2AW5A 4ZJUA 3CV3A 2IX3A 3HZHA 3LBYA 1TOAA 3WMEA 5D5PA 2VRNA 4BVAA 5AM5A 4KSYA 4X91A 1E8MA 4V0NA 1DQSA 3Q0IA 4FMCB 2GQ0A 4Y18A 4X60A 1QQTA 5BPHA 1D7AA 2RHMA 4KDEA 4TLMB 5LU9A 2XGGA 3DT8A 4MLCA 2ORWA 4BP1A 4C4ZA 1GTRA 2BELA 2ZIWB 3IH5A 3IAUA 2DFDA 4HTAA 3EEQA 1Z6TA 5LA6F 3CG0A 3H1AA 4FD2A 4X66B 2W00A 4UASA 3MWLA 1Y34E 1H9CA 2EU8A 1YJQA 1JG7A 2IYQA 3IR6A 3N8KA 4C4YA 4AWAA 4CG0A 2OD9A 3DJFA 1I3LA 1Z25A 1NW6A 2P3LA 1W5EA 2VDWB 4JLWA 3KAPA 4KXUA 4DV7B 2HBZA 5IN4A 5JR3A 5CVDA 2V4UA 4UARA 2WIKA 4DUPA 3EXIA 4LOLA 3MWEB 5CVCA 2DPGA 3KVYA 5D3MB 5CDYA 3L4BC 3DZCA 1KR2A 2EV9A 1ESCA 1I3KA 3KR1A 4JL8A 1B0ZA 3TOSA 2DPLA 3O0TA 3QVKA 5KQLA 4DBLC 3ZWKA 2WICA 3ITKA 1MJGA 3AUUA 3JZMA 3N8GA 5HCNA 4TLCA 3ZE1B 4IIDA 3R0IA 1YF3A 1KWGA 4PPGA 1GZDA 1MNQA 2BONA 3FGNA 4JQYA 4QFCA 3W6ZA 2FDRA 3CBQA 4JLKA 2ZB2A 1EJ6A 3ZWVA 3HVRA 3ILXA 3DM9B 2WIFA 4NC9A 3WBJA 3F5MA 4IUDS 3H1FA 4AFNA 4RIEA 3IKJA 2FFHA 1HTWA 3B2EA 1ES9A 1S01A 4D3ZA 5HKKA 4N39A 1SOWA 2UYOA 4R1LA 1QONA 4UE6A 1QS0A 3E7DA 3IEUA 4WESA 2WVHA 5IH3A 2NSLA 4RQAA 2P6RA 2PL3A 4KR9A 1X7WA 2FMIA 3ASYA 3P5SA 4EB0A 3O8CA 2VJOA 3D1VA 5EZYA 4J1TA 1FBTA 2M6SA 1E2JA 3PPVA 3U7IA 4RY0A 5JEEA 1LZLA 1X38A 3HH8A 1YDGA 5BQ3A 3ESYA 2BE9A 3OF3A 3UCXA 2QQFA 1XVUA 3K7EA 3JAKA 1TW3A 3BFPA 4IH9A 1KYZA 5KS2A 2CUKA 3HB0A 1MDBA 4DM3A 4HDKB 5LJIA 4IIJB 1YC5A 2YVKA 3NWBA 3JCZA 1HEIA 1TD9A 4P84A 5EKXA 3BE8A 4DJJA 2IGTA 1TQ6A 2VNJA 2GHQA 4E1AA 3VO9A 4NENB 4BMXA 5ALOA 2GA9A 3KHUA 2ZBQA 4OPMA 3HA7A 5DNUA 1L7RA 1N8TA 1G5HA 1XP5A 2IVZA 2CLHB 2IP4A 1T25A 1JIJA 1GCOA 4IMJB 3AMVA 4Y7DA 4RTPA 1NUSA 5HE8A 2CW5A 2HMTA 5CB4B 3STYA 1AQLA 4EHNA 1GL6A 2PRSA 4HQKA 4Q19A 4CDRA 1XB2A 3MPUA 4YYEA 1WABA 3HG7A 1XRSB 4RKYA 5DYGA 4Q66C 2JGAA 1OBVA 1SRQA 2Y1EA 3B2NA 2P9CA 4ZT2A 3IT1A 3A3YA 4I1VA 5LLSA 1IHPA 1X15A 2Z8YM 2QYSA 1XNGA 4HDCA 1NUUA 2ID9A 2PH1A 3BDIA 4MQMA 2B0CA 4DLUA 3CSSA 5DJ5A 3RCBA 3OCYA 3VSDA 1ICIA 1Z2PX 4REMA 2FPPA 3FCUB 4ID9A 2HU2A 1EP1B 1AKVA 4GXRA 4LZZA 4IDOA 4ZAFA 1YZHA 5FPTA 1DIRA 3T4XA 2O0MA 2O0KA 2VHQA 2AX3A 3HMQA 4DWVA 5A3QA 4KHPB 2RG7A 3NOXA 2B61A 5EZ5A 4EG8A 2QVGA 4CIDA 5AVSA 4G0PA 4GI5A 3GFOA 1P4JA 4HEA1 4PR0A 2UKDA 5LQJA 3PUVA 1KVUA 4GQAA 4PF1A 1CJKC 4AUEA 1BX1A 2R6AA 2C7GA 3O92A 1D6SA 1L7BA 2IIQA 3MCTA 1RJGA 3OT5A 3NT5A 3O8RA 2CFTA 2IL1A 2GCNA 3IHTA 3LUBA 5IK2A 2AFIE 2GFHA 3ND8A 1X74A 1XCLA 1DKPA 4RK1A 2OM6A 2HW8A 3K31A 2DWUA 4HWRA 4E31A 4QGBA 5EEHA 1ID1A 1ADJA 1E58A 1GPJA 4EUHA 2ZWOA 1E1DA 2QP4A 1YDEA 4ZTUB 3FM9A 2WD8A 1U0TA 3T52A 1I7DA 1JFFA 3WIUA 5FWYA 1DG9A 1Z39A 2G5TA 4KLNA 2ECOA 2P6PA 3A3NA 2Q5LA 3D6VA 2BCGY 3G9XA 4OFWA 4UEOA 5AHWA 4ZRMA 3PYMA 5LQAA 4RTRA 3B6JA 1GHTA 4LX0A 4WZAE 1ZCZA 3H7AA 3HGQA 2NTEA 3P0RA 5J2TB 5THXA 3TO5A 1TUGA 4NFHA 1SCUB 2Q3JA 2ZKIA 4AECA 2P78A 4P92A 1W4RA 2UYQA 3D7NA 3HP1A 2ASEA 1LLQA 2JA1A 4H15A 4WH0A 1BHSA 1GZ5A 1TQ4A 1ST2A 2I6TA 2X8WA 1G4UR 5G3ZA 1UBRS 3VXKA 4KNWA 3B60A 3WQQA 3FMVA 5CIQA 4CV2A 4F2HA 2NWQA 4BRWA 1IPHA 1GQ2A 2QS9A 3S8YA 5JT1A 3L8GA 1Y6RA 1KGSA 5FPHA 4RPHA 1AGRA 1PQ4A 5AJWA 5K0LA 2H59A 1DL5A 4U2DA 4DJEC 1VYUA 2MR6A 1SCDA 2JASA 2PQ2A 4LDAA 2YNMA 5AHKA 3ST7A 4ZYYA 2O8EB 5J2TF 3AESA 4BIMA 2QTVB 5JJIA 2CBXA 1HDRA 5BPFA 2VDUE 1D03A 3C6BA 3NUZA 3Q6NA 1E3WA 3GA5A 3NAQA 4TZ6A 5EIAA 1Q5PA 2XCUA 1CPYA 1LPBB 4PO1A 5F4ZA 4EGAA 2ZJ8A 3LOQA 1AH2A 3NBQA 1KS2A 3C3CA 3NRJA 3DZDA 1N8KA 3Q9LA 1JDTA 1VJDA 1XZFA 3BPSA 1IL0A 3MGBA 3DW1X 5CLIA 4RW0A 5FTJA 1I14A 1E2GA 1S2DA 2NU7A 2W9XA 2XA9A 2VWQA 5IAEA 3L1HA 4V1CA 3S81A 4F3TA 4EG0A 4LV6A 1I36A 1AC5A 3LBNA 3OC6A 2EWMA 2EW1A 2F67A 1UBSB 4W7IA 3FROA 4EGCB 4FHDA 3FVTA 5ALUA 4CKZA 1SIUA 1LUAA 2ON6A 2BKXA 1GNPA 1FNSA 2DBYA 3KD2A 4IHAA 3R75A 1FDOA 4PPYA 4QECA 5JQGA 1IBMB 1H2HA 2FW6A 2HTEA 2VDRB 2WM2A 3PI7A 4ZEOA 1K3FA 4CU5A 5IARA 4R0NA 1N25A 4Y7CA 4KDRA 2D0DA 5T3YA 3BGWA 3DBVO 3SJZA 4KXYA 1JDSA 2J3HA 4I1SA 2FMFA 4QYXA 5BURA 2QI9C 1P2BA 1DJNA 4FDLA 5BSRA 1AB5A 1NJ5A 2ICAA 4GFDA 1YRYE 1OI2A 4R8KA 1J90A 2PG3A 3WLFA 4ALNA 4W5NA 2G71A 1WSBA 2R6FA 5EE0A 4W1SA 2W93A 3KV1A 1G20E 2O5EA 1GPKA 4E3ZA 3K4QA 1DRKA 5ALZA 5LVAA 2BV3A 4Z2AA 1IZ0A 1NVMB 2GPWA 2HD4A 4P86A 3LPLA 2PKWA 4Z9BA 3FZNA 5I4BA 2I2AA 3B1XA 3FBTA 4HUTA 1ID8A 2N1BA 1VCHA 3NHFA 4DPMA 1M2VB 4EO9A 1NI5A 4ZHQA 2XITA 3CLRC 3GUZA 4H1UA 1RKUA 2AFHE 1RWBA 5CK5A 3M1AA 4O4IA 1UPAA 4CQLB 1SPBS 4MJXA 5J4HA 1KJ8A 3TTYA 3N74A 3R6GA 1I10A 1G8AA 1I7SB 1S02A 3D0QA 2PFGA 3THWB 1L7QA 1SUWA 1BEEA 3LG2A 4XDHA 5FRDA 2Q6TA 4BIIA 4H3SA 2XOKA 3IQHX 4YBRA 1TAHA 4DV3B 3AF0A 4BVJA 3QPAA 4L7QA 1KY3A 3QJGA 3AOGA 4D9CA 1XQVA 4OD0A 2BGRA 3QU7A 5BNTA 3G02A 3RREA 1ML4A 2BGLA 1W0JA 4UNQA 3FPCA 4EMTA 3QYPA 1GPLA 1E92A 4Q3AA 4MI9A 2UVDA 2Q9CA 3NYRA 2ANCA 2VTKA 3TTVA 3AEYA 2X4DA 3L82B 1F20A 3IAM1 4EG4A 3ISJA 5BVGA 4A2WA 4CLOB 1VL1A 1HGXA 4EMUA 4DR6B 2H3HA 1HDGO 5DCUA 4XFKA 3AFMA 4AUMA 3C8DA 2WSBA 4U6QA 1FFWA 1CHNA 2IYZA 5A7GA 1PZEA 3GJ8A 4Q18A 4W9MC 1UC4B 2HCTA 1Z17A 3EBLA 2WYWA 4XAQA 2NVOA 2Y99A 4XVRA 2IFTA 5CJPA 4RCZA 3KC2A 3R6DA 5LKRA 2A9QA 2O48X 4BECA 1DQRA 1VGRA 2Y77A 5CFRA 1QU3A 1RWWA 1WZUA 2QENA 3PFNA 3PX2A 4Y1EA 4I9UA 1KH2A 5BSTA 3GRPA 1DRWA 1JIKA 3T5CA 4D56A 1I1OA 2RK4A 1NN0A 2PJRA 2CMFA 4PU0A 3F3MA 4J0FA 4WDRA 5KQMA 3EA5A 3WWOA 4HS4A 3OX1A 1WMSA 1AVTA 3KKOA 1ZPDA 4FC7A 5B7PA 1WDLA 5JYBA 1CB0A 2TMYA 3EA4A 4MV7A 4V38A 3RVMA 5ALRA 3I9NA 1MABB 5PGMA 4HH0A 3UGQA 3AQ4A 5K0BA 1XRLA 2YJ3A 4H27A 3NC4A 3SQMA 1RLMA 4N6OA 3AYZB 1Y5LA 3F9RA 4B71A 3GPBA 2P4SA 3PRJA 3LGSA 4GGPA 4RWEA 1FYXA 3TLZA 4KFCA 2Z3ZA 1WB4A 1R50A 1RHKA 2HF2A 3C14C 1SUSA 4OHFA 4MW5A 5A4IS 5CH5A 5L3RA 3QX3A 4P8RA 3EAFA 3D6AA 1ZD1A 3AJEA 3LRXA 4GEKA 2H1RA 3S1SA 3JWJA 5A7HA 5IJ0A 5HM8A 1PJLA 2KS6A 5K8TA 2FPKA 3G1UA 3EXFA 9LDBA 1QX3A 4PW0A 2GD6A 3LZCA 3OIWA 4BKRA 1ZOOA 4KAFA 1KKUA 3CYFA 5EJEA 2HPVA 2HJHA 3NP9A 1WV0A 3G9UA 3Q4GA 3DFUA 1X7XA 1UOOA 1FB5A 1U1FA 2IXAA 3AI7A 3DMTC 3KBOA 1VE5A 4G5OA 4PAGA 1BYUA 3PFBA 4PY2A 1SVKA 4X44A 1E6UA 1EZZA 1HT3A 1VE9A 3CNLA 3DCNA 4GBMA 4MUBA 3UN1A 3DQZA 3NHAA 3RUIA 4BLPA 3C41J 2GJ9A 1UKZA 1E0AA 1EX7A 1W85B 2OM2A 5BWBA 4G5FA 2XNDA 2PO5A 2J6BA 2O7SA 3N2KA 1SBCA 2QTCA 3OX3A 4ZZ3A 2QIPA 1A77A 4INOA 3GFPA 1LLCA 3AHHA 2BEVA 4HWOA 3ANLA 3GFTA 3IAEA 1BN7A 1SVNA 5BRJA 4BU1A 4M0LA 3SZ3A 4HN2A 1MFPA 3IESA 1O9BA 1Q57A 2A52A 4ZVLA 4B76A 4ENRA 3F97A 4O4IF 1FFDA 1DAFA 2N1MA 3W05A 4YCAA 3ZDXB 4ENPA 1Q17A 1R3DA 5AUOB 3DBOB 2NUBA 4IXTA 3K70C 3EDCA 3OBBA 1FU7A 1X94A 1G2PA 4I9GA 5IZCA 1KAMA 4B32A 1A7KA 2VDNB 2G07A 4AXXA 3IO3A 5ICMA 4UEJA 2GVDC 3KJEA 4X7MA 4RSMA 1EU1A 2IEBA 4B7CA 3NXSA 4GC9A 1J33A 3HJNA 5KDOA 4V03A 4G67A 4MAFA 2AJBA 3GW8A 4MVXA 3IUNA 4OA8A 4BO4A 2D1TA 4ZVRA 4IIVA 4FMCF 1GEGA 1XZNA 1ST3A 2D0PB 2YMQA 3FRHA 4MS1B 1AF7A 1GZUA 2M32A 1DQNA 1RKVA 2ETXA 2GNAA 3L9WA 4NF2A 3RU7A 3QNWA 4DV0B 1H2YA 1FTYA 1M2OB 2ZI9A 3RS5A 5KTNA 1EQ2A 1XDBA 1GVNB 3DOCA 3OX2A 4I4NA 5ICFA 4CIVA 1TIBA 4J4BA 1Z7EA 2WILA 1M6HA 1OREA 2NPOA 2P27A 4OSEA 5F33A 5LSAA 5LOVB 2XT9A 3D1LA 3OQ1A 5BNIA 3DVAA 5FOQA 3QBJA 4X6YA 2A9FA 4L6AA 3QG5A 4J1SA 4JSYA 4K6CA 3VM6A 1IEWA 4FFPA 1JFFB 4L08A 2DPYA 5ECGC 2AG0A 1ZONA 1XVIA 1LEHA 3R76A 3T0IA 3W9SA 1KVRA 2GK6A 2AUNA 2GKOA 3ZU3A 4KMOA 1D0SA 4DF3A 3JD0A 1R27A 4BKPA 2X76A 4IHQA 3ZUGA 5JEDA 1GU0A 2ONKA 4BYGA 4LDJA 4RTNA 4LTNA 1CUGA 1TM7E 4GRIA 1FSZA 3NH6A 4RK0A 5ALYA 3SIPA 4F5ZA 3CFFL 5AKXA 2ZATA 1FUYB 4RKFA 4Q9JA 3T1NA 3JVUA 1GQYA 1RJEA 3FKQA 2F3SA 3GGJA 3HBAA 5DMHA 3RT1A 4E22A 2WU0A 3IDQA 1T0JB 5ULLA 3MZ0A 1VIMA 2ACWA 3GJ4A 3WQRA 4DG5A 5A7FA 1YK1A 5B36A 2WAAA 1T9GR 2GA8A 4DWOA 4TZKA 3S8MA 3DT6A 2UVPA 3G79A 3MTJA 2O2CA 4E3WA 2JJ2A 3PKZA 1B6SA 4ZI3A 3N59A 4HVTA 4ARBA 3QWIA 5TIIA 2WWVD 2DHQA 4L0MA 2JLUA 4GI3A 1C30A 1ZN8A 2NO1A 1CUXA 5AVVA 1P3DA 3HEBA 4JI0B 1L0BA 1FJHA 2C9BA 2DH5A 3DLIA 5EQJB 2D7JA 2AC2A 5EGSA 5AQ1A 3P9IA 4KRFA 2G36A 3P9RA 5TJHA 5GONB 2HU5A 4KLRA 1PW7A 1L5WA 4CXMA 1QGOA 1QSGA 4O4JA 1Z8DA 3BWCA 3N9IA 1E3IA 1PG2A 1U5AA 1AZWA 1E79A 1FDTA 1CUCA 1KSJA 1X1RA 3H04A 5KSZA 4XE5A 4GPTA 3MTAA 4D81A 4AWXA 3SXUB 4FDUA 4YJHB 4N18A 3CFYA 3UWDA 4JI8B 2Z1NA 2Y76A 2VT6A 3CCCA 3Q3CA 3RTEA 3AESB 4IVPA 4PC3A 5IULC 1SCAA 3V80A 3FF1A 4HNGA 4Q37A 4O0LA 1ZM7A 2GWHA 1CHDA 1RWNA 1YRBA 4JDPA 5HTKA 4TX1A 2W37A 2XUPA 1P80A 4LYAA 4DSTA 4R7GA 2DCUA 2C4UA 1U7WA 1KKMA 4Z0NA 3SX2A 2AOXA 2BN4A 4QYMA 4WFJA 3VHQA 3FOFC 3VPGA 2IUFA 4FNGA 4X8LA 4IIEA 5C80A 4WNYA 3WVNA 4BX9A 5AM2A 4FNAA 3BRCA 4KI0A 2FCRA 1ZVJA 2GHIA 3IIMA 3ZWNA 1PSWA 2AYZA 2QTMA 2QRHA 3SM9A 1TW2A 1X7XB 3HUUA 3H5TA 2QN3A 4IWYA 2O8DA 5JASA 4BO6A 1NZFA 1YQQA 2RB5A 5ANRB 2WMOB 3EEFA 4X92A 2PUWA 3WS7A 2BTEA 3A6DA 3I9LA 5FL7A 1AUQA 2RGRA 4RTSA 1UCFA 1EHCA 2HM7A 2I34A 5JG7A 4HQFA 4YGYA 4J94A 2AVDA 2HA7A 4OQXA 1C8LA 5CT9A 2WQZA 2E82A 1DX9A 4PQFA 3DFFA 1MO6A 1DBIA 4WXPA 4BDTA 4LF6B 1ADCA 3HYRA 1DEAA 1ZU4A 4R0VA 4EQ6A 4EJSC 4RJIA 4FFRA 4R1TA 3T9FA 5L53A 5FPPA 5LQKA 1WW3A 5REQA 1N75A 4JNKA 1JKJB 5HQ3A 4GWKA 1UJ2A 3HWSA 4RV9A 4FLEA 5G1NA 3V46A 2WZDA 3K0CA 4LVUA 4XGIA 2FZWA 1QZXA 3WBBA 5FA8A 2UUPA 4EGJA 1O95C 1P7WA 1Z8FA 4L72A 4I3GA 1GXSB 4L9WA 3I3SR 1V8DA 3GJ7A 4RD6A 2PD4A 4DC1A 3HVJA 3N7AA 4JHXA 5KTOA 3HZRA 3LCMA 4ER7A 2XCSB 2DE0X 4O2BA 3RANA 1AGXA 2JD0A 3LCVB 4MGIR 4AVYA 1WUJS 4BNZA 4YAJA 1XVVA 3V42A 1KEWA 5C1DA 2BI4A 5ED0A 1A8UA 1RHRA 1OYWA 4K9RA 2HJWA 4PYRA 4UXIA 2V59A 4UUPA 4Q9IA 4X97A 4XX0A 5BSWA 2ZJ7A 3HDGA 3ZHUA 3WIDA 1BE1A 2QTWB 2J9GA 1EMDA 3VAAA 4KQHA 1P2VA 3R3WA 1MD9A 5AJZA 4C2TA 1QGZA 3N0WA 4L0DA 2X3YA 1V26A 1COZA 1FMFA 1YT5A 2OYCA 2OO7A 3O74A 1KBQA 1GU1A 4KP7A 1Z38A 4K26A 2JLWA 1P6UA 3P27A 1A7UA 5IANA 1UDRA 1YI8A 1XAIA 1E4EA 2ZCUA 3OX4A 5EI5A 4FU0A 4Y2HA 1FFCA 2QRVA 3SXJA 2CUZA 3JQDA 3RT7A 3TVYA 2V58A 4M9QA 5HBGA 2EIHA 1V4NA 1H2FA 1DAKA 1QHHB 2B8EA 3C43A 4LY3A 4MCJA 1V3TA 3PXDA 5KAPA 1QRTA 2F1OA 4L07A 3W3AD 2QVLA 2DYKA 2FDXA 4CF6A 2YY7A 3IVRA 1X7YA 3E8MA 4JUBA 5DMXA 2OXCA 3CH6A 3DZGA 4IDFA 4J9UE 4OFZA 3CX7A 4E13A 2IZ0A 4L8YA 1MO2A 2RJ3A 2RJOA 4X8HA 1FU4A 4ER3A 2C3PA 4EKYA 4ZCTA 3J7AC 3WL8A 4DHEA 3DVLA 2BFWA 4Z49A 1G9TA 3PWTA 4X62B 1KFJB 2PUHA 4HH4A 1BU8A 1CCWA 1XIVA 4DIFA 1T1GA 2JJQA 4YLGA 5TB5A 4PG6A 1YA4A 3ZHCA 4CNBA 3QTTA 5DOZA 3ZJYA 2HXYA 1PEYA 4RHTA 4AMBA 1PGQA 3LMKA 2NUPA 5ERXA 4WUVA 3I5XA 1QIJA 1BC5A 5CFLA 1PR0A 4D44A 1VZ3A 4BFWA 3CLTD 3U62A 4AM8A 2X3FA 2VJYA 2I22A 2BWJA 2DWCA 3FNQA 1WBBA 1BS1A 1RRMA 3SQNA 4KBGA 3ZK7A 4DT1B 1QIKA 4RZ2A 3MVEA 5GJCA 3T1VA 5J3JA 4HLDA 4IF6A 4LFBB 2DUJA 1DBSA 3DEKA 3AP2A 5DWVA 3RTCA 1VOTA 2CXQA 1LRKA 1Y9EA 2PGDA 4GQIA 4B3XA 1HFJA 3VKGA 1RIFA 2C3YA 2P2GA 4RZIA 1YZLA 1SMKA 2X8BA 4JL5A 4K6OA 4NQRA 5JU6A 3DF9A 4M8IA 5BN5B 3AUFA 3I6ZA 4QYWA 3FFAA 2EGUA 1LBSA 3MBKA 2B98A 2BI8A 3HHPA 3P9SA 4JJ8A 4YT2A 5AKEA 1EWKA 1PJ4A 2CVHA 3L3BA 2H52A 1XRNA 3PSHA 3L6CA 2HDHA 2VAVA 2PMDA 2GXQA 4G8DA 1C9NA 3HKEA 1SJ9A 5JI3E 3W06A 4LZAA 3QPUA 3VNAA 1J00A 1OFGA 5DHPA 5LC1A 1N3BA 3W5JA 3EGIA 1ULUA 4YC7A 5DISB 5B7GA 3PJDA 4DDUA 1KMHB 3MUNA 5I51A 5SY6A 1M8KA 3S1AA 3FYHA 1ABFA 1CJCA 1JJVA 5EEGA 3U3RA 3U44A 1FYDA 2K7ZA 1DO0A 1T91A 3LY5A 1DBWA 2ZJ5A 4GH5A 4FYXA 4MZDA 1JHQA 2WHPA 4D0NA 3BWVA 1JG2A 1AS2A 2BSAA 1PFYA 3QI7A 3FR7A 3H7IA 2GUGA 3NEPX 3TWOA 4LRUA 3BF8A 3ASUA 3L06A 5HEKA 2J08A 1D1PA 2MSDB 3UEOA 3H5RA 4C7MA 4XB6B 1CYDA 3KUDA 1KI2A 3TR6A 2BIFA 2ZYGA 4QGAA 2G3YA 1I6LA 5LWHA 1OYOA 2Z2ZA 3D3KA 3CGGA 3JZAA 1YR2A 2AJDA 4LDZA 1DIBA 4RA9A 4ZDJA 2FUNB 3R3XA 2ZBEA 1JI3A 5EZYF 2P7IA 3B1YA 2JVIA 4K9MA 2QDXA 4MMZB 4DVJA 2HWXA 2H2HA 3OQBA 1M2OA 4YRLA 3E18A 1XZAA 2RAVA 4KQMA 4F06A 4P4UA 2BKVA 5IF9A 1Y5NA 2ZVQX 1V7QA 3IBCA 3RBAA 1RADA 1VCOA 4ZZ1A 4RTOA 2J3JA 2DM6A 3KQPA 4TM7A 1IN7A 1TUBA 4ZD6A 1CJSA 3UV7A 4EY3A 2C7RA 3D4PA 1SD1A 4QOGA 5MDHA 5IT0A 1C7IA 1JF8A 1WUHS 3OLWA 4UOEA 3I9FA 4D74A 1WZNA 3VGPA 4X9XA 4W4TA 4G1MB 4C78A 4KR7A 2HNAA 1SA0A 1NIJA 3OM0A 4IINA 3PJEA 1PR6A 4EVRA 1UMBA 3FOCA 1IN1A 3M6UA 1OXKB 5LQCA 4BC0A 1QYDA 4G5RA 2ACKA 1L1FA 2A67A 1R88A 4BQRA 3CKMA 3QXXA 5J43A 5KINB 1E3SA 1MNAA 3ZDDA 5BWCA 2OY0A 1TQHA 2EL9A 4C07A 4D3DA 1GGJA 5B12A 4A8JA 1D1SA 4DJ5X 5J1SB 1FP6A 4UNRA 4Q7KA 3WG9A 4WXYB 5ER9A 3VSEA 3WLIA 3WK5A 2X5JO 5HZMA 2D1RA 5JAPA 1WZ2A 1U7PA 1WLSA 1RP1A 3IJRA 1KDTA 3HK2A 4I5FA 5AIAA 1FVHA 1YZVA 3TZQA 1JQ3A 4DC9A 5CAEA 4PRLA 2ECFA 1MOSA 3UMBA 4B1FA 1DKQA 2HPAA 5HRAA 2VHVA 4HQRA 3RAGA 4JQOA 2PJDA 1F8YA 2C97A 1AY0A 4FZ5A 3OHPA 3HJUA 5CX1A 4H1WA 3QW2A 5IZCC 3ODGA 3TB6A 4GX5A 2VNAA 3INTA 2DQKA 1J9ZA 1ODKA 4PZYA 1XZGA 2P62A 4DWWA 4DMRA 4FOLA 1I0ZA 3OE7D 4O2RA 5LP1A 4EJSB 3LP8A 2YV5A 2ZUDA 4N0EA 4W9RA 3N2GA 3STTA 5AJVB 2VPIA 3EXG1 1LK0A 3PD1A 4G5SA 2IDMA 5ALEA 1C81A 4JJIA 4WZAA 1DX6A 8GPBA 4OHOA 4PCAA 3F7OA 3OJEA 2FK8A 3E7XA 4ROSA 4MHSA 1L4FA 4J03A 4R3UC 1PUJA 1BSVA 1UDWA 3IMCA 2R1UA 3SQDA 2PA0A 1VGQA 3LX4A 1N7HA 1GUBA 1EUZA 1PR3A 3W3AA 2QTLA 1GAEO 1UBEA 1JECA 1FTNA 3VSBA 3OSUA 2A92A 3Q5GA 3WFJA 3RAPR 4B5LA 2FW9A 2EG5A 3ER8A 3TLJA 1OZGA 4UTVA 1T24A 4FGKA 3UK7A 1GN9A 3A37A 1I3NA 3LLVA 4IUYA 4R9NA 4WVLA 4C3VA 3JTEA 4HLUC 4LBYA 4AZ3B 5JXWA 4JBXA 1SU6A 5EIBD 4OUKX 1U94A 1XWIA 2IIPA 1J39A 1HBJA 2H0RA 4XUEA 4PBRA 2JG3A 3EDYA 2ZK7A 2OXFA 1BCSA 3LQYA 3N3BC 4HFRA 4CM8A 3L6BA 1DADA 1HL7A 4O3FA 2OD2A 3HVKA 4M0DA 4BB0A 3WK7A 3Q3GE 1FX1A 2QRGA 3NIWA 3IUEA 3PPXA 2C2WA 4RZ3A 4RXMA 2QMOA 1W36D 4UDYX 4J6EA 4L5IA 1AXRA 4F6RB 4AZWA 1JJFA 3JALB 1D2EA 5LUBA 1XQ1A 1RYFA 3NGXA 3ZBTA 2CL7X 1N2SA 1ZCJA 4IUBS 2B69A 2WTMA 4RJKA 4CIWA 3C1AA 2R62A 1NM5C 3H19A 4FFMA 5FBRB 5JSUA 3UC9A 2DR2A 3GJXC 3DE4X 4MNTA 2C5SA 2HX1A 4XD2A 5JSQA 4R84A 1QMPA 1P1CA 1QMGA 1ZZEA 2PVPA 4MW7A 4X1YB 1RZRD 3TIXB 4MB0A 1JH8A 5IC6A 3V7FA 3A14A 4QAJA 2H08A 2IY9A 4AYXA 1U2DC 4JXKA 4BQSA 3ROTA 2YJTD 4YH1A 1M76A 1NDHA 3PRHA 4JITA 1R1DA 2FFRA 3KQOA 1LWNA 4GE0A 2NU9B 1PNRA 3IDOA 1EXMA 1N92A 1QWOA 2FPMA 1QYWA 1FP1D 2GT1A 3E81A 3LUCA 1F1BA 3IDSA 2VAMA 3HSSA 4UCFA 1UDCA 3AEQA 5GAJA 2B7CA 5B6IA 3PPYA 1TO6A 2P11A 4N41A 1O96B 4H7IA 5CB4A 2A8YA 3Q8WA 1OE0A 4P83A 3RGGA 5EE9A 4OU4A 3NEYA 4GWGA 3JU3A 3UJNA 1T9BA 2IV7A 3CPHA 1FUUA 1KO8A 2XNHA 4NS1A 3REFA 3UT5B 3ZCXA 4IZIA 4IG9A 4DQVA 3LYAA 1Y1QA 4GVLA 4D4JA 3MJSA 1Y8RB 4R3NA 2ZUFA 3A0RB 4R1OA 1SU7A 3CB4A 4LMRA 5JSFA 1KEZA 1Z4PX 1TJPB 2I5PO 3PFKA 3T5MA 3V48A 3AEZA 3GAFA 3HSKA 1SUBA 1U63A 3NT2A 4LXHA 3AF5A 1QHYA 2BHNA 4G81A 4MVJG 4OHPA 5DX0A 1QH1B 3AJRA 2XQIA 1E9DA 3NHWA 3M2PA 1RW4A 1LBEA 1A88A 4POAA 5CYGA 3GJQA 4O4HA 2FG7C 2R8YA 2EKBA 4JHLA 5I7OA 3W1WA 1LC0A 1Q0PA 4AJ9A 4KRYA 3BSYA 2EFJA 3PNQA 4IKPA 2ZEJA 2JEOA 3LHKA 4FQ7A 4OGWA 2WQ6A 4AJIA 3Q2KA 2BMEA 3HDJA 1QP8A 1I4TD 4BV2A 3PB3A 5HIJA 3WGLA 3WNQA 3GJTA 1P44A 2GPJA 1B6GA 2F1IA 5E38A 5K0SA 3KXLA 4G63A 1S8FA 2OK8A 4L8WB 4YX9A 3OAAD 2BMJA 2QI9F 2OSBA 4DV6B 3AZPA 4Y2PA 2DBVO 4M0KA 2QRVB 3PUKA 3B89A 2FW1A 3L8ZA 1FS5A 1ZH4A 3A1CA 3ZBPA 3C70A 3A7DA 1XRJA 1YQDA 4QVGA 3EGWA 4N0PA 1KRXA 2KLBA 1DCKA 1U11A 2JI8A 2JZCA 2XCOA 4F4HA 5KHOC 1CDEA 3D8TA 1E79D 1E1CA 3WQBA 1QYVA 3IHWA 3GX1A 1N5MA 2X6RA 3L92A 1U6IA 4J3NA 3F6SA 1O6GA 4QLBA 4AAYA 4G2NA 4I1UA 2PWPA 5AVZA 4REOA 3EXHB 2Q9BA 1RPJA 3OVMA 3BREA 5C4MA 4E5PA 3MMXA 2O7QA 1FF9A 4Y30A 1YO6A 4KVFA 1FYEA 1RJWA 4DCCA 4HEJA 1EGHA 1KI6A 1B0AA 5C1IA 2CLCX 1IIRA 5GGXA 1N9GB 2VKTA 2A94A 1XBTA 2XTMA 1W1UA 1Y6JA 1RWMA 4B84A 3EJ6A 1XPJA 2H1OA 2EKQA 1NQOA 2I4OA 2VRWA 3ZDFA 3ZCVA 1J1IA 3MB5A 4J29A 4X3OA 1WTAA 3HACA 4YBZA 5IVPA 3AWDA 3FWNA 2Z58A 1PQPA 3WLQA 3RRJA 4YXWA 5C46F 4I5GA 4D41A 2C96A 2ESRA 2GDZA 1J8DA 3V4OA 4WECA 3O2QB 1NN1A 5SZJA 1Z5PA 3ZVRA 1GCAA 3OOWA 3L0CA 4LYYA 2AZTA 1GR1A 5IYZB 5MFPA 4DMHA 2PKRA 3THYA 4OKSA 2RHHA 3GLGE 1EESA 2KX7A 1BWPA 3QVMA 2W6CX 2PZKA 5JAIA 3W2FA 1UWCA 3LTEA 3G1WA 1P5JA 4L0CA 4QYTA 4YCDA 2FQWA 1XK6A 1KI3A 4QLOA 2ZJBA 4EF5A 3GIDA 4Q82A 4F4IA 1MLDA 1F38A 2GYYA 3HKDA 5CNJA 1A8QA 3OQIB 1K27A 3IYLW 1E96A 2Z2KA 4RACA 4FEAA 3RYCA 1AK2A 1X7ZB 1PWHA 4IOMA 1Y3IA 2HXSA 2FEOA 5ARDA 1SZPA 1DIHA 2E37A 1TEHA 2ZSDA 1LK7A 4NH4A 4M53A 3QEJA 3QEOA 1K4YA 5CD1A 4QSHA 1EDEA 4KV7A 2JGKA 2SKDA 4S24A 3ZHOA 4CI0B 3OQ6A 3ADCA 5HMLA 1YUMA 3BILA 4PAQA 4LRSB 2GD0A 2V3WA 3NKLA 2RHCA 2DBZA 2HGSA 1UPBA 2WD9A 3G2MA 3GJYA 3KOZA 5H82A 5HILA 1HL3A 4MYCA 3LQFA 3T7RA 3UF0A 4HB2A 4KAJA 1QF6A 5DT2A 4FINA 1UOPA 2J6HA 4MV8A 2J4CA 3C39A 5KOHA 1E5LA 2DZDA 1W0JD 4CR7A 4FIZA 3H2KA 4DSZA 3BIOA 4F5EA 4X65B 3LU1A 1BEUB 1GRVA 1HNNA 2V96A 3C87A 2ACVA 1P5FA 3I4CA 4O4LA 5T4EA 3K3PA 4CV3A 3ZJVA 3GLFB 4CL8A 2NAPA 3NAMA 1VPDA 3QF4A 2AUMA 5A4JA 4KGVA 3P52A 3BC1A 1N5DA 4FFNA 3I5YA 4TYNA 4N8SA 3CKLA 4WCFC 2ZJ1A 5JATA 2L82A 5ERYA 1Y6GA 4FB4A 3WHKA 5JSZB 5GOZA 5BNFA 5EGNA 1M6EX 3DEHA 4B8YA 2CXNA 4AULA 5CIYA 4YHHB 3L1KA 2CFRA 3GGPA 2EWWA 1SBHA 1Z0SA 2C1ZA 4URZR 1AQJA 3L7JA 2CDNA 1UC9A 1DKOA 1UXIA 1YBFA 1UBTS 3LPNA 4HG2A 1E2HA 3R8FA 3ECAA 1XJCA 2JFVA 2FEXA 2MIIA 2VP4A 3I64A 4IJ6A 1VZ2A 3ZX5A 2WBLC 4TXMA 4KH1A 4CMEC 2IBSA 3FB4A 3N8DA 3WKEA 4H4CA 1AUXA 2C7PA 3FSRA 1CQPA 3W8DA 5IM4A 1KXZA 3QFFA 4XB1A 5HOQA 1OAOA 3CO5A 3DG9A 1NQVA 2ZIXA 3AM3A 1KK3A 1KVSA 1NURA 3I0NA 1LDNA 4HDAA 1QTRA 1U1EA 4ECAA 1XKLA 3ZBUA 1R5NA 4DC0A 2MMGA 2QZZA 5D2CA 5H81A 5BXQC 2CHFA 1S2GA 4ISBA 3ZY5A 5LU8A 4RIHA 3K1AA 2WJAA 2X4LA 3TLEA 5IX8A 3QKRA 3DBRB 1GNQA 2YJGA 3R6WA 1QH0A 2FN9A 1UZNA 1FUEA 3SHVA 3RVKA 4TROA 4BPBA 3VR3A 2WSSA 4N03A 3UUEA 1FOEB 2GN4A 2HK7A 3FDXA 1X80B 1L5LA 3W3AH 5FV4A 2JLXA 3KUKA 4KJZA 1QZ3A 4MV4A 3WGMA 4EMBA 1Z73A 1I9GA 5FI3A 1SKAA 3N28A 1JHRA 5EG5A 3ZH9B 1NG9A 4FBGA 4FYHA 4UHFA 5F77A 1RE0A 4E94A 3RAEC 4O8CA 1W88A 2CVZA 3QE4A 4ZMSA 5FOXA 3R4CA 3LYHA 4LNAA 3CF2A 4QODA 2JLQA 3RHTA 3U4MA 1OXUA 2TYSB 3WRXA 1L7DA 2QPAA 4Z4GA 1WDTA 4Q4AB 1R9JA 5TQJA 1V1RB 3SHFA 3VKWA 1YJXA 2YXLA 3IEVA 3TLCA 1OV6A 4OFXA 2FV8A 3H16A 4EB6A 2QT9A 4FT2A 4Y2YA 4ZO4A 5CXSA 1Q6ZA 3M1LA 3EK2A 4GMHA 4IIYA 1R0CA 1P0IA 3CSDA 3F4BA 5HYVA 4REQB 2AF3C 5ALWA 1E0KA 4NP6A 3DE2X 3ITNA 3BXGA 3AP3A 3VTZA 2PSEA 1GQOA 3PL5A 4DR2B 1RYEA 2EYUA 4RDCA 4A0HA 3RS9A 3U48A 5IRCD 1N0WA 3VV2A 3DR5A 1A1VA 2HSZA 2PJZA 1DAOA 4UM8B 2YV1A 4L5AA 4FXPA 1KQPA 4K05A 2Q4TA 2E5WA 3NBFA 1RD4A 3H4VA 4HN4B 2ZSIA 3E9RA 4KQFA 3KELA 4XDZA 4AB1A 3KQKA 3R5TA 4PCUA 3IP7A 3OJFA 5JJBA 5JQGB 1ZU5A 4DVGA 3JQ9C 3KYBA 4X85A 3FLEA 4Z9FA 4LF7B 2J3DA 3I2JA 3ZIAD 1GARA 3AX6A 4JR2A 4J0GA 1HNXB 2HRCA 3KOYA 1F3OA 3CZMA 3VPFA 4DADA 1Z5GA 4B3DA 4YUWA 2GN9A 2PAFA 1KDPA 1LU9A 4ML3A 4NBTA 3C2QA 4QNNA 5LN1A 3FBWA 1JZQA 3D2LA 1MV5A 3MRTA 3DAGA 4FE7A 2YRWA 4NEQA 4UFOA 3H13A 1IMJA 3LLCA 3CWZA 5TX7A 4ZOCA 2JCVA 3CFAL 3TEMA 2JVKA 3U80A 3W34A 4D9IA 4Q12A 2OP0A 3JD2A 1XNRB 1XDWA 3LT1A 1A76A 2QM3A 1KI9A 2NO6A 3P7MA 1P3JA 4FD3A 2BKEA 2QE7D 4KK3A 5COQA 5C1OA 3CNBA 5J23A 2HA6A 2PV0A 2XY4A 1VKZA 2IYRA 2YFKA 1RPNA 3UYLA 1A5ZA 1VKOA 1LWOA 3G2PA 3TCXB 3MFQA 2G1JA 3V4ZA 4MS4B 4F6RA 3N2GB 4YMVA 3UWOA 2PUCA 2QN9A 1WEKA 5DM4A 3BL6A 4LSZA 2OYSA 3ELYA 3LGAA 1OF1A 3LT2A 4LEIA 1WHTB 5BN1A 3FHJA 4IVRA 4QUBA 3LZ6A 5G1PA 1U7DA 1IJKA 2XUQA 3F71A 3LS2A 3RLFA 4B3MB 3F96A 4CM3A 4YLYA 2D4HA 2EBHX 3WIOA 4CLEA 4YAFA 1B16A 2G5CA 2H29A 4XI9A 4LS3A 3GLFE 3CI0K 4A16A 2H7CA 2GJ4A 2NZXA 2PMCA 3AU9A 2R5FA 3DMRA 3QHQA 4WOKA 3SHOA 1M74A 2XSZD 3EAGA 1SXJB 3Q7RA 1IH8A 4ENSA 3OQIA 2AW3A 4N9WA 4UU8A 4S3MA 1SU4A 2Q3MA 2QF7A 2A84A 3G6WA 3IUMA 4HHEA 3UXEA 3AETB 3EPLA 5JOQA 3ZZ0A 3UJ7A 5I9BA 3TLXA 2FQ1A 2GARA 2BEUA 4RV5A 4MPPA 5EUMA 4NS4A 4LG1A 5K4GA 3MOSA 1YFKA 2Z1DA 5K3SA 1P75A 4CF5A 1G16A 4ZZIA 2WVGA 4J7XA 2BFPA 3AP1A 2CJWA 3NHSA 4B4KA 1HTBA 1J4AA 1PWYE 1S3IA 5AKJA 1V43A 2PLFA 3PWKA 3M4ZA 3LC1O 1SY7A 4RJJA 3IOYA 3W6OA 2ZKLA 1KY4A 4CMKA 4TTAA 4HAUA 2VDMB 2W8BB 2AHOA 3AHIA 3KXDA 4QQFA 4I6EA 4YUAA 4QUGA 3PNMA 4GP9A 3ELBA 3LFHA 4IGIA 5B3JA 521PA 1GLVA 3FGPA 4HLNA 1Z4KA 1U3VA 2MT9A 1TTTA 1CNFA 4PYJA 2ZIVB 3Q5EA 1C9MA 2G5ZA 2Q8NA 3Q6MA 1RAFA 2GJSA 1C0EA 3H1GA 1OLSB 5B2ZA 5LYYA 3PHJA 4D4KA 5IABA 4MYSA 4BX2A 5JARA 1Z26A 1S2OA 2J5BA 3D7SA 5BXYA 4AN4A 3N6RA 3I9KA 3NPAA 2PZJA 4HFNA 4AJEA 4K40A 4DHWA 5LP6C 2IYFA 2QN7A 2C9OA 2FX2A 1KQNA 4YCCA 5HUJA 1F5SA 1VBNA 2ZQYA 4HYQA 3AFOA 3AKDA 4OXNA 5F7JA 5C3MA 4MINA 3BD7A 3MRSA 4HFJA 4EP1A 3HFSA 1QH9A 4RD0A 4UUQA 2R9VA 4FWBA 5LXTF 1B1CA 3AUAA 4X20A 4UBKA 1GQFA 1IM8A 3WGIA 1GL3A 4U6SA 5AVRA 2PUTA 2O23A 3V7UA 4IXDA 1TIPA 3HKCA 4EHDA 2EVWX 2YWHA 3G68A 1XA4A 1BXRB 2GM3A 1LPNA 4FTWA 5H80A 3AONB 3HXTA 4A1OA 3DAPA 4EELA 2C2MA 1BGWA 2UUBB 3PIDA 3U44B 2GR7A 1M2JA 1GYRA 2IHKA 3JATB 4J8PA 4RPCA 3LDAA 1ZGGA 3GT4A 2PGJA 2RKOA 2ZVDA 2BBOA 1EVLA 1RHUA 4N5NA 4WOBA 1G2IA 2OQIA 1Q3KA 3VH4A 2ZBVA 3OJCA 4JS0A 3AJ9A 3U7EB 4WASA 2IEIA 1ZUNB 3NNDA 3QVUA 1H0KA 4RLFA 5I5EA 3SVLA 4TRRA 5K0TA 2V97A 4UNPA 4JASB 5CJJA 1S8NA 4DNXA 1A82A 4LJ6A 5BVHB 3LWDA 3VVBA 3PGLA 4Y6GB 2XWPA 1AHHA 3JWHA 3VYRB 1A5BB 1BWSA 3DKPA 4RSHA 1HLDA 2VP2A 1GO2A 2LDXA 3LIPA 2J9YB 4I1YA 4X00A 4X24A 4NYJQ 3RVDA 3SIRA 4ZGBA 1JWAB 2Q1YA 2VSYA 5JD6A 3RK4A 2ID8A 4HX2A 1PFWA 2OFPA 3D6UA 4XWGA 2CNLA 1E6EA 2H17A 3IPLA 4OATA 4ER0A 1P9RA 4JYCA 1E0DA 2VDLB 4KWEA 1PK9A 1K75A 4J16C 3LQ1A 1N1EA 4MQFB 4KPEC 4WZBE 1L5QA 1GFSA 3U7QB 4N49A 3H9UA 1K2VN 2FHSA 1UFRA 1E59A 2QUBA 4FUTA 4UNNA 2QRQA 2C2OA 1O6CA 5JS6A 2R87A 2FVXA 4GZ6A 4XYGA 3ZHXA 1TC2A 3H3JA 2Q7OE 1YS1X 3CUVA 1LDGA 2P4HX 3CU5A 2AKYA 2RGNA 3H5VA 1Q0ZA 2PH5A 4HEQA 3KXKA 4IHJA 4MVWA 2KB0A 3FPLA 1TJ5A 1UKVY 2CYAA 3O8NA 1SOMA 3BCHA 4UC0A 5E2BA 1ZGCA 5FX2A 2ZYUX 4Y6RA 2VP6A 5KPJA 2R96A 4PQYA 5LYJA 1NW3A 1NVWQ 3U81A 2HSWA 3NVDA 1OFIA 4DCSA 3TSZA 1L7VC 3G9QA 3TQOA 1IDOA 4BOYA 2CF6A 3EC2A 1BOFA 1SVMA 1Z5ZA 4Q7MB 2XX3A 5DKFA 1G21A 5CK4A 3ICEA 1OUMA 3OPMA 3IQFA 1RBZA 1EFRD 1T2AA 3UHPA 4DBVO 4V39A 1U1GA 2ZSKA 4FLMA 4BZWA 1GT6A 3TI9A 1AN0A 1ODLA 4G0NA 3CKKA 5C9ZA 1KEKA 2HL6A 3CZ9A 3KT8A 1OV4A 2OCKA 2Y0DA 4HD8A 2APJA 4WAUA 4CM1A 4ZYTA 1XFDA 5KNLA 3CLHA 4YLEA 4LK2A 3UG7A 5AW4A 1XA3A 2COKA 3SBEA 2Q8QA 2JC3A 3LHIA 1NI4A 3E58A 1UBOS 3R6TA 4HDNB 2QVZX 3ETGA 2HHCA 3T3OA 3UJPA 3HUFA 1JLHA 2WSSD 4FONA 3VMFA 3G8BA 4YRNA 1CULC 2ZI4A 3IIIA 1X70A 1U04A 3V4LA 1T8WA 4KN5A 4B9EA 1CETA 2OTCA 4KOAA 3LCCA 4YDHB 3TLGB 1JS1X 5LQRA 2DUNA 5AW3A 1N2IA 2VJMA 3A4TA 5CYFA 3SJCA 3L7KA 1X86B 1U9IA 4NATA 3DLHA 3UAYA 2ZUSA 1B2LA 1UQRA 2EZ8A 3BAFA 4YREA 2V6MA 3LUFA 2HJRA 3DC2A 3PEEA 2X5OA 3IUJA 4JKIA 5FPSA 4GW3A 3P9XA 2FR8C 4FR5A 4ZGWA 4A5OA 5K3EA 4F9EA 3KKPA 3KUCA 2AG6A 2C2BA 2GPBA 3HDYA 3ZGYA 4CV1A 2GD1O 3MM4A 4PE5B 3WTCA 3ZYZA 3RRMA 1NN5A 4MDHA 3R5HA 3DNFA 1S6YA 2JJMA 1OWPA 3LDHA 5A4DA 3C5WP 1GL7A 1Y6ZA 3BD8A 1X19A 2VHEA 2XLBA 1B76A 4G9GA 2AL7A 3GQVA 4DJTA 3ODPA 4NZ9A 1E32A 4UMFA 4AJ1A 2YTZA 4HNTA 3K71B 2H2DA 4RV4A 2QUJA 3W4JA 2C61A 2A0XA 1A5SB 2XYRA 5B4VA 2F90A 2V5UA 2SICE 2V7UA 4LN1A 4CTNA 1H3NA 1H8ED 3C16C 2AEEA 3MJRA 2N47A 1FX0B 5GWXA 1NUHA 5I8PA 4L57A 3WB2A 2AOUA 4BE9A 1UDBA 5JDCC 1Q11A 2G7MC 4P80A 3TQIA 2D7DA 1NQTA 2O8BB 4O02B 3HNOA 3UB3A 2ZTSA 2YN0A 5BSMA 2QJRA 2CNKA 5ALNA 3TZ6A 4YRRA 1VTKA 4JQSA 3AVUA 1T3ZA 5AM1A 5B1IA 4FBLA 3EY9A 2Z95A 3AT1A 1KQGA 4A36A 2ZYHA 4P22A 4XWTA 4OU5A 3ZXXA 1L5YA 3H83A 2SNIE 3WYEA 1NONA 5KYUA 4ZYLA 3IHLA 5A4KA 3A4MA 3ZS8A 4BRUA 5IKMA 1G41A 2HUNA 2RBEA 1G5RA 3MCVA 2WUFA 4HDKA 1WD7A 4TMFA 2PZGA 1OXBB 1W52X 3OCUA 3NBYC 4LHXA 4OYLA 3B6IA 5AW0A 2R1VA 1JT2A 5A0VA 3CT4A 1E5XA 1FMJA 1KIFA 1OXVA 2QMZA 3KVOA 4GX0A 5FBQB 2D0IA 4EUSA 1O94A 4YJGB 2XIQA 2WLSA 1Y9ZA 4I1IA 1UAYA 4K0RA 3IJPA 4KRXA 4OAQA 1O2DA 1Z15A 2I0FA 1OAAA 2J3EA 4JYPA 5B1DA 5LZ5A 1B1AA 1WNFA 3EIQA 4YS6A 5KYYB 1ZL2A 1V35A 4HAVA 1JR3D 1YQEA 4C03A 2X4GA 5B30A 1TO2E 1UBUS 5C8ZA 1GXSA 3L7BA 3JS5A 1YS4A 1BMTA 2P1RA 3MS2A 4C5CA 4WACA 3Q41A 4C7OB 1U02A 2D1QA 5KWIA 1QANA 1WZEA 4UDNA 4BNNA 1DBVO 1FDUA 4BMNA 4Z1MA 5IT9A 2PLRA 1WSDA 4NBSA 4UOZA 1I4EB 3OPYB 1T10A 2H6EA 5K4AA 1E2UA 3GNQA 3UXMA 3SBXA 4MS3A 3ABIA 3E7WA 5EFOA 4IXMA 1YCGA 5JS1A 3MCWA 4FFBA 1AIPA 3PZBA 3UKJA 3OI7A 1K8RA 4C4AA 2ZVPX 2PY6A 3KQWA 3ZG6A 5EJ7A 1C8VB 2HN9A 4A0RA 4CM4B 3NMUF 2DFPA 3AU8A 1U0JA 3AERA 1CUSA 2FZ5A 3AC0A 1QGUB 3DCJA 3HB5X 3QUAA 2NZWA 2Y0PA 2QPTA 4JX8A 3RTAA 1T6ZA 4E5NA 3WMWA 3QEBZ 4UCWA 4NZOA 4A2QA 2OESA 4NPHA 4A82A 1M33A 2LPMA 3H9EO 5KJ1A 4GIBA 1JQBA 1TU3A 1G0OA 1QCYA 2KBEA 4MDYA 2O8DB 3IPYA 4Q4JA 1TEVA 2QGZA 2W2PA 3TAXA 3MD0A 1X92A 1T2EA 1CVLA 2PBFA 3AW8A 1U7UA 3N2IA 5KJEA 3ZOKA 2HLDA 5EJ6A 1Q50A 1VE1A 3DS8A 3THRA 2I3ZA 1UADA 3GLIA 4O4HF 3G5LA 5G40A 1M7HA 2XJ4A 2WIBA 3OTWA 3IAXA 1DOAA 5CM9C 1A96A 1IWPB 2A57A 2B82A 2YCBA 3JWGA 3UNXA 2OORC 4KN9S 1QKJA 3TX2A 4E14A 4LHSA 3N39C 1Z3IX 2QK4A 4XM2A 5E6UB 3ABZA 4FHZA 4LOAA 4YONB 4K9SA 4BN0A 4A73A 1SXHA 3KWLA 2WHPB 4A4DA 4RNCA 2ZYSA 1JLSA 3HGMA 4R01A 2VP5A 3GUCA 4WGFA 1QLJA 1O7JA 3KU1A 4D9GA 4RVOA 1UM9B 2BHLA 1VJRA 3B7GA 4GPBA 4U8HA 3X43A 1Z22A 2C77A 4M22A 3O73A 4GM0A 4RMHA 4GGMX 4PFJA 3WDKA 3EZGA 1JTFA 3G8YA 4CEHB 1F0PA 4R7TA 4CKWB 1SEPA 3RRNA 2J7PA 1R0LA 5ELXA 1VLMA 3R7DA 4EHBA 3L02A 4UMVA 4YCNA 3PI6A 1UWKA 3FH0A 3PUHA 3EPRA 2O06A 4ZOBA 4L4YA 4D8YA 3NC1C 3CRW1 1XU4A 2Y67A 4I55A 2ZS8A 3QBTA 5EKTA 1EIWA 3A4YA 4QWWA 5K5EA 4TKLA 1JQJC 1D0VA 4QYIB 5CLLA 3C6YA 5FI0B 3TRDA 4DIBA 5JC8A 1NX9A 5DHTA 2ZTMA 3EY4A 3QY0A 2QOEA 4C08A 5BUSA 2V7QD 3HYLA 1C29B 3CUWA 4LF5B 4Y9RA 1NA5A 3ROEA 4UQOA 3A7EA 2D00A 4M0MA 4L8LA 3DHEA 5JQWA 2G09A 2GEFA 2VJAA 4G4SP 3ZNNA 3TG8A 2OZLB 4P36A 4KQKA 5DT9A 3G0DA 1E8NA 3QXJA 4MB2A 1O95D 5I9MA 4BTEA 4BWFB 2RMKA 4S0ZA 2VJQA 1LPSA 3TEFA 1BOOA 4B40A 1II0A 1X42A 3T3EA 1C2TA 2I6UA 4N9QA 3DE1X 1KO1A 1KH3A 4MITA 2NTJA 2WKSA 3B78A 3J7TA 3PFCA 4KDFA 2OYRA 4PPNA 2PXXA 3RIXA 2ZIGA 1F0NA 2VQEB 1GKIA 2IUTA 3GAZA 1V16B 1FX0A 7GPBA 1XL0A 4HT3B 5AOCA 2H4JA 2GCEA 1EWTA 3Q7QA 1QZTA 1IPEA 4F9GA 1DWUA 3I5UA 3DEAA 1NAIA 4XWWA 1BVYF 1XKTA 2I4MA 1SXJA 1FXWF 2I4RA 2IHYA 2RGAA 3KWMA 1MH9A 1N7GA 2JFFA 2KW5A 3FHOA 1F17A 3FN4A 3HUTA 4RPLA 5K51A 1LPAB 4OQDA 3L0OA 3JRNA 4AG5A 1W1IA 2VSXA 2W43A 3EX7C 3QEKA 1N2CE 1K63A 2PYZA 3R41A 2J3QA 3SS7X 4HZGA 1Y82A 4RGQA 3EW9A 4JT8A 5DBGA 2O4UX 3V4FA 2BLNA 2L19A 1JFVA 1THZA 1Y1SA 3RNOA 1Z7WA 2BFCB 1I24A 3ZHVA 2R8ZA 2ZTUA 3COWA 3CF0A 1NYTA 3NHRA 4JI7B 2ZZNA 2J59A 1EEXB 5G0SA 4FGSA 3RYIA 1KEVA 3WLTA 3K0FB 1R9NA 3V2GA 4D2IA 1E9CA 1SG6A 3BCUA 3IE0A 4KGXA 3KO8A 1C7EA 4GNKA 3DMDA 4J16A 1I1QB 2H11A 3NTVA 5H4GA 4JJEA 2Q1TA 2VYVA 3OE4A 2JLZA 2GPTA 3D8UA 2QNIA 3ET4A 2ZS9A 1B14A 2HEGA 3QWBA 4IMRA 1E6CA 1SCIA 1U4NA 3Q15C 4KVGA 3CKYA 4Z54A 1T0PA 1K6JA 3OT1A 4B4WA 3N58A 5EMHA 1SQSA 1TAGA 4EX7A 4ESEA 4KGDA 2VOEA 4TMZA 5K8IA 4HNSA 1N34B 4MQFA 2BCEA 4WTOA 1NHWA 2EYQA 3MTDA 2C3MA 4DNQA 1IK6A 2IZ6A 4L4UA 5D7BA 3T7EA 3VH1A 2H1IA 4RZSA 4YVFA 1REQB 2BUCA 4CG1A 5HUHA 5E7IA 2WB2A 4HGOA 1XR3A 3MSCA 1XD2A 3RFVA 2IC5A 1ECFA 1JG3A 3AK4A 4XLZA 1CW2B 2BW0A 2D5IA 2AN3A 3FOBA 3Q11A 4C88A 4V3CA 2VLBA 3EUEA 1G2QA 1DE0A 1RAEA 1V1JA 1EFKA 1T2VA 3RIMA 3E4CA 2FA9A 3N7TA 4J07A 4PC7A 2Y0BA 1Z83A 1ZOLA 1ZSYA 2C5AA 1M6VB 5ECDA 4DGQA 5TQ0A 4DBLE 3I8XA 1U2ZA 3GXOA 3IFSA