4DE5A

Pantothenate synthetase in complex with fragment 6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 93
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4de5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4de5A01
1D2RA 4EF6A 3K9WA 4EG3A 2QJTA 2H29A 3AL0C 3U1VA 3LCJA 1GAXA 4R2MA 1MRZA 3QTTA 4Q16A 1R6XA 3H99A 1H1TA 3JXEA 1KAMA 2CV1A 1N78A 1O97C 4YP5A 1O94C 5JBNA 3F3MA 1NYLA 4RPIA 3FNRA 2HZ7A 3H9CA 1EFVA 1LW7A 1N3LA 4MUFA 4MUGA 4X0EA 3X1KA 3MLAA 1Q19A 4NAHA 3X1JA 1O96A 4MUEA 1CT9A 1Q15A 3CVYA 2BTEA 2A1UA 3COYA 3COVA 1MBZA 4ZT4A 2JANA 3CLTC 1YIAA 2X0KA 5J5AA 3KT6A 1N1DA 1UFVA 2QUJA 4DNXA 1VBMA 4HJXA 1IH8A 1J70A 1U7XA 4KKVA 1N2EA 4QREA 3TNJA 2PZAA 2DUMA 4AQ7A 1SURA 3N2YA 3RK1A 2ZUEA 2QTRA 2Z08A 4KPUA 2CT8A 4K03A 4ND7A 4R2LA 3VU8A 4EG1A 4KR9A 1V47A 1WJGA 3N8HA 1ZJWA 3IDFA 4ZCPA 5HUJA 4CQNA 1T9GR 1GTSA 1IHOA 1FYDA 3AIIA 4DE5A 4MW1A 3FDXA 3I05A 3GLVA 3ZGZA 4GU5A 2PZBA 1I2DA 2C5SA 3CVUA 4DLPA 2IELA 1QU3A 2VTBB 1VL2A 3LOQA 4F4HA 2IP1A 4YP7A 1N2IA 2H2AA 1KP2A 1TQ8A 1K97A 1NUTA 3K32A 4EGAA 1COZA 4XSVA 4MLPA 4ZT6A 2A84A 2PIDA 1KQNA 1M1ZA 4MVYA 1WY5A 3A04A 3AFHA 3ISJA 5H7XA 1MB9A 1PFWA 3Q12A 3NV7A 1KQOA 1WKBA 1EXDA 1WOYA 2A7XA 3HZRA 5LFAA 3IMEA 3CVWA 3IUEA 1JEEA 1OBHA 1N2HA 3H97A 4ZCQA 4ZT5A 2DETA 1OBCA 3RBAA 2CUZA 4EG5A 1IQ0A 4A91A 5AHWA 2PFSA 3X1MA 3ZJVA 3MLBA 2YWCA 1PFVA 3M5WA 3HL4A 3SEZA 2DR2A 2CV2A 1JMVA 1XNGA 1WQ3A 3TQOA 4NATA 3PXUA 5LM3A 1G8HA 3KT3A 4XFDA 4MVWA 2J4DA 3ELBA 3LE8A 2EJCA 3DLAA 4TS1A 4U7JA 3FG9A 3MMXA 1PG2A 1XJQA 4MUHA 3QE4A 1N2JA 2RD2A 2BYTA 2E89A 4UZFA 5DEOA 1PFYA 1MJHA 5TGTA 3ZXSA 3N9IA 1H3EA 4J76A 2AZXA 1MC1A 4MW2A 1X6VA 4MW5A 2WSIA 2ZUFA 3KT8A 5J59A 1OWLA 3CLRC 3TS1A 3Q10A 2D13A 1LI5A 2QJFA 1B6TA 4MVXA 5J58A 1ILEA 3RJZA 1O5TA 5BNZA 1J1UA 4KR7A 3CLSD 1NURA 3IODA 4I6GA 4E1AA 1YUNA 1M8PA 1GPMA 1VLHA 3FI0A 2CV0A 2X1MA 3D6UA 1LI7A 4OJMX 4PBSA 3PNBA 4R0NA 3IH5A 1EFPB 1YUMA 3P0IA 1I6LA 1NSYA 1Q77A 4F3RA 1RQGA 4PY2A 3IVXA 1FFYA 4DDKA 4S1OA 3P52A 3DPIA 1QJCA 5FO0A 2CSXA 1QRSA 3AKZA 4GRIA 5HUHA 1J1ZA 2DEUA 3IOBA 1YIDA 3CVVA 4PBRA 4UZEA 4JZYA 1KAQA 2YXNA 3GUZA 4CDMA 1JILA 1TFUA 3CLSC 2J09A 3HV0A 2WQ7A 2A1TS 1G59A 2Z3VA 1DNPA 1KP3A 1U3DA 3TZLA 2CYBA 1V8FA 4CT0A 2DLCX 1G8FA 4MWDA 1WXFA 3UOWA 3ILVA 1KH3A 1JZSA 4ZCSA 1NUUA 5IJXA 4J75A 4EG8A 2GKSA 1EE1A 4XFJA 1OD6A 3IOCA 3BL5A 3DO8A 3FETA 4U63A 4MQ6A 4PBTA 3G6KA 2PXHA 1M8KA 3OP1A 4MW4A 4CDNA 4L2IA 4H3SA 2NZ2A 5F23A 1OWPA 4MAFA 2R5WA 3ZJUA 1M8GA 3ZIUA 3L93A 4DDHA 3A05A 4I6JA 4ZCTA 1NUQA 4MUNA 2PZ8A 3S3TA 3UC5A 1O95D 2CYCA 1TYBE 5TS2A 1K4KA 3PNYA 4P2BA 1XNHA 4MWEA 1VBKA 3PNVA 1GTRA 1NI5A 3P0HA 5TEWA 1K4MA 1I6KA 1OWMA 1WXHA 4OUDA 2VTBA 3FOCA 3SZGA 1QRTA 1KH2A 3CR8A 3IMCA 4MVCA 1M8JA 1QRUA 1N2BA 2DPLA 3UY4A 4ZT7A 2DXIA 3DV2A 2VXOA 3HGMA 3ZJTA 1IRXA 1O95C 1A8HA 1MB2A 4G5YA 1NUPA 4ARCA 3ND6A 1IQUA 1T6YA 4KR6A 2A86A 1PG0A 4EFKA 3ND7A 4EG6A 5KHAA 1WXEA 2A4MA 1MAUA 2TS1A 5HG0A 1X8XA 1JECA 2HMAA 1ZH0A 3FY4A 1EUQA 3P0JA 1VBNA 2X3FA 4QRDA 2PG3A 1KKUA 4HK4A 5DASA 5FO1A 4NX2A 3OTWA 1IVSA 3HMQA 4MULA 4ZT3A 4G6ZA 4ZT2A 3ZUGA 3N05A 1O6BA 1F7UA 4JXXA 1WQ4A 4MWCA 4U8HA 1QTQA 3COWA 2A88A 4MW9A 4QBTA 3VGJA 4ZCRA 1JIKA 4ARIA 2NSYA 1OWOA 1TEZA 3L92A 3FHJA 1MOPA 1WZ2A 1EFVB 1J21A 1JEDA 1NP7A 4WNYA 1Q11A 2J07A 3FIUA 1QNFA 4HPWA 1G8GA 3CLTD 3A2KA 2CYAA 3RFFA 4MW0A 3COZA 1H3FA 1O96B 1ZH6A 2J08A 1BS2A 4K0RA 5K0SA 4AS1A 1QU2A 1XNJA 1M8FA 2A1UB 4G5FA 2QTMA 2JAXA 3E27A 3C8ZA 3TQIA 2JA2A 1T6ZA 1T6XA 3FWKA 3SEQA 1N75A 1KQPA 1F4LA 1KORA 5KWVA 1TYCA 2WB2A 4YMIA 2V0CA 3TZEA 3IUBA 4MW7A 3SDBA 1O0BA 2D5BA 4MW6A 1N2GA 3IOEA 3GMIA 4DJAA 2GOYA 5LLTA 4KPUB 4HJRA 4JXZA 5IHXA 1Y42X 1U7DA 1R6TA 3IMGA 3NBKA 2XRZA 1N77A 1T9GS 5DB4A 4MUKA 1JHDA 1EFPA 4YBRA 3Q4GA 5EKDA 5K0TA 1MAWA 2HGZA 3H05A 3AG5A 5DK4A 1S4MA 4I6EA 2QUIA 3NBAA 1U0BB 1GN8A 1J09A 1JGTA 3G5AA 3H9BA 1ULHA 3G59A 2I1LA 3FH0A 3HFJA 4YP6A 3MXTA 3CLUD 3MUEA 2A1TR 3INNA 5FNZA 2YWBA 1F7VA 1OWNA 4L2IB 3A4IA 2DERA 3D6VA 2QUKA 2G36A 1F9AA 4FZJA 1KR2A 2XRYA 3CVXA 1U3CA 1EUYA 1P7PA 2AG6A 3SYTA 4DDMA 4JYZA 1YULA 2OV4A 2Z09A 1QQTA 3RK0A 2X1LA 3SZ3A 2QJOA 3AG6A 4OUDB 3CLUC 1TYDE 3IVGA 2O5RA 2RE8A 1EJ2A 4NDAA 1GZUA 1TYAE 2EL7A 4JFAA 2CFOA 2E18A 3QTBA 2QTNA 1ZUNA 1WXIA 1JIJA 1GLNA 2D54A 2O8VA 5KCMA 1JZQA 1YI8A 2YY5A 3KT0A 1NZJA 4MUJA 3VRHA 1NUSA 1WXGA 1I6MA 1H3NA 1O0CA 2B7LA 5TEVA 4MWBA 2QUHA 3ND5A 2OQ2A 1R6UA 1N2OA 1IQRA 1J20A 1IFXA 4ND6A 1PFUA 4NAUA 2J5BA 4EG4A 4WSOA 1KH1A 3PRHA 2GM3A 2ZP1A 4BWVA 4MUIA 2IJGX 3KFLA 3UMVA 4EG7A 2WQ6A 2AKEA 1M83A 3CA8A 1O97D 4NZPA 1HYBA 1O94D 5H16A 3ZXIA 1K92A 3UK2A 2E0IA 3CLRD 3RHSA 1JIIA 2V0GA 3IVCA 2E21A 4Q93A 3SP1A 4RUKA
chains in the Genus database with same CATH superfamily
4U02A 2IHYA 3FFTA 3Q11A 5SICE 2QD5A 4E5VA 5C4GB 5IKMA 4DCJA 2J0UA 5IEBA 3U1VA 3OU2A 4KOEC 1K68A 1MZVA 4CMIA 5F4ZA 5JFTA 1YZHA 1QH8A 2PUJA 3PYLA 1K6EA 1ZU4A 4TLBA 4U4AA 5IXJA 1L5OA 4I9GA 4U0KA 2DE0X 3LIPA 1MH9A 1KI1A 4MMZB 1T6NA 4QL3A 4A16A 1DHTA 2DG2A 1W5EA 5JOQA 2R1UA 3JZAA 2X5JO 3CUEF 3WMFA 4YV7A 4JB2A 2QUAA 4UULA 4W7HA 5BNTA 1O97C 4WRRA 5D3KA 1O94C 2AYZA 2EWWA 3S8MA 2GJ8A 4UEJA 1YBAA 2E49A 1WMBA 2Y93A 3DJFA 1T4BA 1XPOA 3IPCA 3IQZA 4DR3B 1A27A 2ZDQA 3N2IA 2JHGA 3BXFA 4UHKA 3QPBA 3K71B 2IYEA 5FF9A 1IAVA 1LV7A 1RZ3A 2VCYA 2YXPX 1T1SA 3ST7A 3BHJA 2O8CB 3ZH2A 3K05A 2HM7A 3TVYA 3BGOS 3DP9A 3SVZA 4ZAWA 3TCKA 5KYKA 1ZD5A 4XASA 5KI6A 1AY0A 3MCTA 3OT1A 4U5QA 3H75A 3PSAA 5DXFA 3UCXA 4C43A 4DA7A 1ZN7A 2EKLA 3GEDA 2O8DB 2AC2A 4UC0A 3GAMA 4E88A 2VF5X 1SXHA 4MRAA 1JNYA 4B4VA 2WIAA 3ABZA 2EFHB 1VBMA 3WK5A 1F3LA 4M38A 2FRDC 3I9LA 5E6UA 1ETHA 1R2QA 1S01A 1SBYA 2CW5A 2PNFA 4TTIA 4ODIA 4ZN6A 4RK7A 5LL6P 4FT2A 1LPOA 4AN1A 1UPTA 4KN5A 4A03A 4IRXA 1ML4A 3N2YA 4RJIA 1GNQA 2MMCA 1Z4JA 3DE0X 5BV7A 5KYWB 4DV2B 3DMTC 5TQ2B 1QLWA 2AEMA 2PTHA 3GFRA 5IN5A 3ZWNA 3Q6NA 4INZA 2Q6IA 2VZ0A 1DHRA 3C6KA 3D02A 1UFRA 3G13A 1GQSA 4C06A 3HXQA 4M98A 5I7VA 1T36B 1ESCA 3PVCA 4LHVA 5E4TA 3GQBB 1SUBA 1QWSA 1OW3B 2QZJA 4OF4A 1M0SA 2QQFA 1PLKA 2YMMA 3CUVA 3KAKA 3BHNA 1CEQA 1SHZA 1TVEA 1FY2A 4MVJE 4TUYA 3W2GA 5IT4A 3BIOA 1O5OA 3WHIA 2BFEB 3STWA 4DOMA 3I12A 3QW2A 5EE0A 5A1JA 3ZZUA 3A10A 1SEVA 1ZR4A 1VPTA 1BVUA 1XVIA 1U0JA 2CNWA 5ERXA 3UO8B 2OGSA 2BFOA 3H8WA 3RRNA 3TQRA 3CINA 1VZ3A 2AG1A 3BCRA 3RABA 5LIRA 4UJ3A 4EGQA 1DDGA 2RG1A 3G2NA 4F4HA 5KQLA 2B8NA 4ZICA 1JTFA 4XWAA 4UHBA 4XSVA 2K2WA 3C7TA 1WETA 3FOEC 4LK2A 2A84A 1P91A 1SBIA 2PIDA 1GG9A 3FPEA 1U02A 3R77A 1TKBA 5A0FA 3CX6A 1ISIA 4URWR 1PJAA 4B2PA 1UBUS 3G79A 4B1FA 1ZNQO 4ZU3A 1HEIA 1XWFA 5PGMA 2C83A 2AFVA 5EWJA 3WBFA 1OFTA 1ZH4A 2BIFA 1DUVG 2VNIA 3DDCA 2XA9A 3G9QA 3I2JA 3IAUA 3UJPA 2XEXA 4RFSA 1PZGA 3S6JA 3NNSA 3ZXYA 4JB8A 3MRTA 4BBZA 3A9VA 1T5HX 2H3EA 2IYNA 1PR3A 3KD2A 4RWZA 3H97A 2B21A 4E03A 3G1UA 4G2TA 3KR0A 3WS7A 4BNVA 4DR2B 2GKOA 4DDUA 5AHRA 1YACA 5EPUA 3KV3O 4O4JF 2X2PA 3NH9A 3ZJVA 4MJXA 3OD5A 5EE3A 4FFNA 4P58A 2JGIA 4PYQA 2QZ9A 2Q29A 4LJ5A 5JNLA 1G7SA 1W47A 2FWAA 2PT9A 4JSTA 5GOZA 5BR7A 3DL2A 4NULA 5IZCA 1GL9B 1E4OA 1DOZA 3R9XA 1G8HA 4YDQA 3DLCA 3GXBA 4WJZA 3U4DA 4I55A 4L72A 4MEAA 2G1UA 4YJGB 1I4LD 4Y2SA 3H2JA 3JAWB 1ZIXA 4MVWA 5J3JA 1I3MA 2ZI9A 3OP4A 3EFOA 4RYDA 2BUAA 4HH0A 3A1FA 1HLDA 4ZPJA 2FZLA 1JSLA 2ILVA 3HWX1 3KYDA 1VHJA 4BFTA 3H9GA 4TT8A 5D85A 1ZUWA 3WWZA 1P3DA 2HRZA 4MUHA 4JLVA 3V8NA 2IUYA 1WUJS 1VIMA 5HFNA 1W85A 1JA1A 2P6NA 1FMLA 2UYQA 2VA8A 4JX8A 5DEOA 2X0EA 3C6BA 2R8PA 3G89A 3SZUA 4W5TA 5TGTA 1IM8A 3DHWC 3INTA 4F72A 3P9IA 2EQAA 4AU1A 5IM4F 2VDQB 2DGDA 4MR7B 4MW2A 2F7SA 2HV9A 2Y0BA 5BSWA 1G9TA 2XMSA 1CLEA 5CFLA 1Q2UA 1VE1A 3OZIA 5LKRA 3T9FA 4R1LA 3ESXA 2WSYB 2O14A 3PE6A 1ENYA 2VK1A 3FPSA 1J39A 4Z49A 1MABA 3R44A 1O54A 1XNRB 3IBYA 1KEKA 3LRXA 3PRJA 1JDJA 3UGQA 5LR6A 1GV1A 1BD4A 5CVJA 4GQBA 3E8MA 5LQKA 2PKWA 2ZYRA 3V3KA 3CM0A 2IDZA 2PGAA 3OLQA 4RQBA 1YR1A 3L1JA 3WDMA 4BO0A 4OJMX 4FGKA 1ZIOA 4KLCA 5TMDA 2XRMA 3ZY2A 1STOA 1WVGA 4BFUA 4G36A 3ORHA 3RIXA 2IHUA 4S1OA 4M89A 2J9RA 4XOUA 1TC1A 2P27A 3RC7A 3T1QA 4B85A 3IURA 4DR4B 5DWVA 1ECJA 4D74A 2R6JA 4QGSA 1GUYA 5A6SA 4E07A 3T3EA 4FIDA 3CVVA 1E9AA 3K8OE 4S2EA 1Z6PA 2AJBA 1Z4KA 2AJDA 2NU6A 3RH0A 3S68A 3HV0A 1WCWA 2H1WA 1G59A 3MCVA 1LK0A 2D1FA 2X86A 1EGHA 4OBEA 1YMUA 1FA9A 4B3FX 4G65A 4WN9B 4RW0A 5AKXA 4AF6A 2I29A 2XUHA 4OXIA 3DBHB 2HJVA 5FPKA 3ESYA 3ICOA 3CZPA 4CR7A 5E1OA 3T0GA 5IJ9B 1HGXA 4O2BF 4GLFA 4Q05A 1KDVA 2Z2IA 4M9RA 2H65A 2XQJA 1M7GA 1GQ2A 4Q03A 5HA5A 5A3QA 5KNCH 3MSCA 3HK2A 4M36A 2HO5A 1YVEI 3DMGA 2MYTA 5BMVB 3N8KA 1S2MA 3JWJA 4H4CA 3QELA 1JR6A 1EXVA 2R79A 4RDHA 3ZGVA 3L6CA 2QQGA 3EZ6A 1JHUA 3BMQA 4JNCA 4Q3LA 1L7OA 4X7MA 4ZYUA 3PTAA 2O5VA 1BS9A 2Q99A 2WV7A 4PHHA 1OAKA 1XQVA 3N1UA 4BBAA 1Q21A 3QW4B 2POQX 3DLBA 1CJVC 3UC5A 3P45A 3RFXA 3T15A 3SXPA 5CB4F 1KVUA 2RHOA 1TLTA 4IXJA 1LDEA 3H1GA 5T57A 4X00A 4A0HA 4BS9A 3FBWA 1HUQA 3BERA 5B53A 4B6OA 4LHZA 3L0PA 3QBEA 3UAGA 3IHWA 3D8UA 3WGZA 5GWXA 1WB4A 1K4MA 1S3IA 3UCFA 4C4RA 4AIRA 1K7YA 4RPKA 4RPJA 4G4IA 7REQB 3HNPA 3B70A 4L08A 4AZSA 3WHPA 4ZVLA 1DI0A 4ILKA 2AKAB 4QO7A 3SZGA 2IRWA 1SA0A 3D6NB 4B6FA 3K2IA 3ROXA 1NN5A 4V2UA 2E48A 2HRDA 1JALA 5IU6A 2V45A 4RVSA 1Z7YA 1M8JA 5JI3E 5K6AC 1XRRA 1LQ2A 4R1QA 4UUQA 1II0A 4AKEA 3PUWA 1SXPA 1FXWA 3DMFA 4WK0B 1U0LA 1Y8ZA 4Q6BA 3CIOA 2GO7A 4G5YA 4M88A 3G8YA 2GEKA 1Q0LA 5JALA 4OXQA 1AJEA 2Y1FA 2ACWA 3L0IB 1F12A 2BP7B 2NO1A 2V6IA 3ND7A 3GK3A 2DWUA 1RS0A 3DXZA 1CR4A 2BRUC 1PF7E 3AHIA 4ND8B 3AF1A 5KHAA 2IWRA 2ZRCA 3S1AA 4CMAA 2P1ZA 4IIXA 5DEIA 1C14A 1W59A 1ZCFA 4KFRA 5CFZA 1FFSA 3KX2A 3ZY4A 3AGQA 1KO7A 1UBJS 4AT1A 1DUIA 1TLFA 1YZFA 2EKQA 2O5CA 3ESBA 1ZA2A 4Y6PA 5ILGA 4N48A 1HDYA 1Q1ZA 2FWMX 4EATA 3R9KA 2HEGA 3TIFA 4Z5XA 1HDXA 2JC3A 1M1UA 1Y7IA 4NX2A 4PZLA 4IH9A 1ZVMA 5IKXA 4WNIA 2ZUTA 4MULA 4W5QA 2ADOA 1L8XA 4KYUA 1SCJA 2CZGA 3A3PA 2HWWA 5E1DA 4XB1A 5KVVA 3OCJA 3U4CA 1VIDA 1OGIA 3OOSA 3QNMA 4JXXA 1GPDG 3HEAA 3NEPX 1DZIA 4FSHA 4U8HA 1P61B 2IPOA 3DNFA 5ALKA 5CAEA 5DM70 3BWEA 1QO0A 5F2KA 3VGJA 4YPVA 3DEHA 5K3EA 5KWSA 4BFCA 3RBXA 3S27A 5MF6A 4ARIA 4O33A 5AOCA 3PQ7A 1YR6A 1UJ5A 2AW5A 3AKDA 3FTEA 2IU6A 1OGYA 2Q6VA 3BA6A 3AR5A 3HJTA 3I8SA 5K3FA 5T67A 1PTKA 5E6RB 1C2TA 2OV3A 3CKMA 3ZXUB 3O2QB 4B76A 1QHFA 2PYZA 3EZLA 2FA9A 5DX8A 5K2MA 3MJRA 4TWIA 3WRXA 5BSVA 1S5PA 1CQIA 1JLKA 3GFQA 4P93A 2XJ9A 3DOCA 3W3AD 4UATA 1BS2A 4UNSA 2GXUA 3KE8A 4INAA 2A3NA 3SQOA 1XNJA 1CQWA 1E2UA 1M34A 3E05A 4DANA 3REQB 4KN6A 4G5FA 3LNCA 4CIVA 1EXMA 4DEYA 2SNIE 1MW9X 1SFRA 1MTOA 1ST3A 4RH3A 3S2FA 4LDNA 4FQ8A 3DZKA 1E1RA 4KLZA 1TVKB 2VHVA 3P0FA 4YRDA 1N75A 1KQPA 4B6RA 4BFVA 1VLQA 2ZRDA 4R6XA 2W6PA 5KWVA 5CVVA 3GLHA 4NF2A 4QOHA 3CZRA 2QMQA 1E2BA 4YR7A 1RBQA 2XUOA 3GGOA 3LWNA 1XJ0A 1N2GA 1XEAA 3OSZA 3M6XA 4HXFB 3I2YX 4EHFA 1Y42X 5IC5A 2EHDA 2YZ2A 1ZM7A 2VS1A 3MYYA 5EVJA 1FSFA 1RVV1 4F9FA 1OFUX 1G8JA 3KTOA 2VDWA 4FYMA 1Z0FA 4CFYA 2QBYA 3TDMA 3LRPA 2GLXA 2V1UA 1GQQA 5FP0A 1N2ZA 3QU9A 4YCLA 2CVZA 3H0EA 2IOYA 5DK4A 2WM2A 2FFRA 2RK3A 1I2ZA 2ZBEA 2J5RA 3SZRA 1KSGA 1MD9A 2AFHB 4CCAA 5JD4A 1ULHA 5AJHA 3KDAA 3GJ5A 1ZG3A 5EMHA 1T2VA 3PWTA 4D9IA 4EW1A 5BVGB 2PRYA 5ELXA 1SQSA 4DNFA 3MUEA 1NW9B 4BNZA 4D3YA 1T4CA 3WHKA 1W48A 4O63O 3PJRA 2VIIA 1NVVQ 3VC3A 1I7QB 2ZXUA 3P27A 1YK0A 4K6MA 3NEAA 4MINA 2QUKA 1A96A 3BJEA 2A9FA 1H42A 3WGHA 2CNKA 4AYXA 4PSKA 2RIPA 2CC2A 5C5IA 4EGCB 4RM3A 2YOGA 1ADBA 1PRYA 4MQLA 4DUPA 4EA8A 3PFIA 3QWAA 3Q5EA 1BCRA 2NAFA 2GW4A 1HL7A 3NWEA 1FJ2A 2A57A 3K72B 4HVCA 1M73E 2V7TA 2X1LA 2DHDA 3D0RA 1LWOA 4RGYA 4OIMA 1NQOA 4ALMA 4FW9A 3BWBA 5ADUS 1UEXC 2I4LA 3RJTA 2EHJA 2JASA 1YMQA 4E4TA 1JDUA 1KMHB 4PO1A 3UMSA 3DZDA 1KEVA 3WYEA 3WK8A 1T5DX 2P7IA 1IJBA 1J8FA 4YQZA 3HE3A 3L4BC 2BD0A 1WZCA 4MKFA 5FRDA 4BX8A 3LO8A 4URYR 3FPCA 5EJ9A 1DOHA 1NIPA 1XKXA 5LA6F 4MDEA 4WOPA 4XJXA 2A6PA 4CF3A 2EJUA 2XCUA 3GEBA 1B4DA 4MP3A 3TL6A 4NCIA 5KCMA 2HXSA 1NF8A 2XOEA 1JHQA 3AETB 5LU9A 1N0HA 3R4CA 4BMNA 4CRWB 4MUJA 2XECA 4Z4HA 2F43A 2E4ZA 4ZU6X 1H3NA 4QLOA 3RANA 2B7LA 2DLDA 3NUGA 5TEVA 1OZAA 3P2IA 1PR0A 2J3JA 5TB5A 3D4OA 2ZIWB 3LL7A 4ND6A 1JYFA 2VAXA 2X3UA 2JFHA 3E7PA 2GNPA 5G1OA 1VFPA 2I4RA 4LECA 2E6KA 1WX1A 1JQ5A 3U62A 3I0ZA 5GTDA 3WSWA 2PX8A 1ZW6A 4XB6B 2QG9A 3MW8A 4KU4A 3Q7IA 1DTSA 4A6DA 1O03A 1XCJA 2V7QA 3BGIA 4H17A 1SHKA 3LF2A 4DCCA 1GFSA 1YJ8A 1GXSB 2I2XB 2X8BA 1YJAA 4JH0A 4P7GA 3KKNA 1BN6A 1ZM4A 1RI4A 5IJAA 1G16A 3B60A 3RS9A 2PUAA 2Q4TA 4YV1A 1NN1A 3ABRB 1E5DA 2XXAA 1NXXA 4UBOA 5BW8A 2ZR0A 4K8RB 1Z2DA 2YDXA 4LDRA 3AL0C 1WDKA 5C51B 3M6MD 5KKCA 2ZAYA 4JFRA 1XMVA 5B1YA 2AOUA 1DAFA 1P6XA 3D6TB 3LVFO 5K3CA 3TQQA 2F1KA 4C03A 5CTAA 3I42A 2C42A 2OCGA 5FBQB 1KK1A 1E1CA 4NPAA 5DZSA 1A50B 1MC5A 2UYGA 3H99A 2RGUA 5KNCA 1IN5A 2QGZA 1Z8HA 1HOTA 2H1SA 1UOQA 2JAOA 2PR7A 3OFVA 2NNLD 2WKSA 4MLCA 5C18A 1Q92A 4HRVA 1QLJA 4F56A 3UMGA 1XFAA 5B30A 2CE2X 5CT5A 4OQPA 3UJBA 3NBQA 3TFQA 5ADWA 3BSFA 3AF5A 4LGYA 2I54A 5HJ7A 1FFDA 4YY3B 4KFUA 4DMMA 5E7QA 2OFXA 3AO0B 1VHDA 4NK5A 3I0NA 3FM9A 2QOEA 3X1KA 4REQA 4ER7A 1CYEA 2FRXA 2G4VA 3DUFB 3EZFA 3LI2A 4FZ3A 4KR0A 4QYIB 1G42A 1IDN1 3RTGA 3TSWA 4EB6B 4D3SA 2BTEA 2O5EA 4CQJA 1E58A 3PCXA 1R9JA 1ESEA 1HDEA 1V1JA 3WMRA 1NOKA 3TI7A 5LP6B 3AGPA 3FHLA 4P33A 2BZ1A 2CDBA 4ICIA 1XMXA 2XNJA 2O3QA 3G2KA 3ZIDA 1EUCB 4TYPA 1FYEA 4CEHA 4QPJC 1W4BA 1T3TA 1GQYA 4XKJA 3RT7A 3NHBA 3S2YA 5DNCA 2IUSA 1CY4A 2EW8A 2Q7DA 1XKTA 1YZUA 3U3RA 2DUNA 2AZXA 2ATXA 1OGJA 1CZHA 2BEUA 2OLKA 3EGOA 3TNJA 4C6SA 2D1TA 3WADA 1NFQA 5JZ9A 2Y1EA 3GFTA 2XCRB 1L4EA 4IDNA 2Z08A 3MWEB 4MVJI 3U7EB 2QMZA 3IUMA 2PV0A 5LP6C 2Q3BA 4AP9A 5L40A 1CXZA 1JDPA 1B8NA 4FT4A 4BNMA 4EG1A 1CNFA 5ECWA 3L1UA 4FMPA 1R6DA 2PKQO 3WNCA 1V11B 2G0NA 3N8HA 3SIPA 3ZTTA 4M7WA 1AUVA 1B6SA 5LZ5A 3KUUA 4AMBA 1BVYF 2WA2A 5DIFA 2MOKA 2QJWA 3MJTA 4J0CA 5CD1A 3ICEA 1FYDA 3B53X 2MDTA 3O93A 5BVHA 4TM7A 1F38A 2AFRA 4RZHA 1ULUA 3V2HA 1EGVB 1UIRA 3B48A 3BXEA 2P2GA 2W93A 3ANTA 3WKBA 4EW3A 3MGGA 4YQYA 1ZITA 1LLFA 3GZJA 1OJ7A 3FJ1A 2HTEA 3ZV5A 1JFFA 1KTVA 4EY4A 2FR8A 3PDIA 5AVJA 4JA2A 3V8RA 3X3HA 2XCQA 4A26A 3ONNA 2WYOA 3V4SA 2Z2YA 2P5SA 1HRKA 3IT1A 2RONA 2W2MA 4R2JA 4UXIA 4BU0A 3OESA 1KP2A 4L5YA 1TQ8A 1BN7A 1NUTA 2OFWA 4QXMA 4YDRA 4D9HA 4URFA 5FWNA 4GM0A 1KJ8A 1J7JA 4ARVA 4H16A 4E5SA 5A7FA 1T6BY 4EHBA 4EYSA 2NX2A 1DQYA 3HYTA 1P2VA 2ZTLA 4NV3A 4E2ZA 5DI3B 3PE3A 1F1JA 3ZLBA 2CJYA 3PEEA 3B5EA 4OHKA 5H7XA 3RIGA 3LPCA 1XB2A 1KVSA 2XOXA 1J0XO 1S02A 3SHOA 1V7QA 3SQNA 1RRPA 2BKUA 3BGSA 2AK2A 3JATA 2DPXA 2Q07A 4DARA 4QVIA 2YHIA 1WW8A 2GA8A 2H2HA 1K88A 2LVBA 3L49A 2BE9A 3ZWCA 5EJ8A 5JMWA 3KIPA 2QP4A 3OEHA 4REMA 4ZT5A 1DBRA 4RY0A 1VKJA 5D8DA 3T0IA 3RBAA 3MTEA 3JVVA 2E4YA 3P9YA 3JTMA 3EGCA 3FKQA 4NLLA 4AUEA 4TLAA 4U6QA 1EK2A 3KCNA 5D3QA 1IEVA 4UBNA 5GMOA 3GLFE 1CEYA 2RKBA 3SX0A 4JXKA 1XYGA 4W8GA 3WIDA 4JVOA 1MX3A 3PKJA 4JLDA 4NZ9A 1V3UA 4PZCA 5CU7A 5BYAA 4G0UA 1AK1A 4BMVA 5CDHA 4NNPA 2H5EA 3PXUA 1VG8A 5AUOB 3T5GA 3UV7A 3IUSA 4MKGA 3TSOA 2VF4X 4BQSA 4IO1A 5TDHA 4HTAA 4PTLA 1W30A 1SG6A 4HDMA 5FHQA 1GDTA 2IYYA 3FSJX 6AT1A 2QSYA 3BRWD 1U1FA 3ETDA 1KY5A 2ZUVA 3AESB 3FG9A 2A92A 4K9LA 4LC1A 1AM4D 3C3YA 4XGNA 1JQBA 4H7JA 4ERNA 2H16A 4DIUA 5K8LA 5F7ZA 2VOJA 3UJ9A 3HSYA 4PICA 4RTSA 3QIVA 3OLCX 3AOEC 3IHTA 1OFIA 3TW4A 4E11A 2PAFA 2BYTA 4J8PA 4DLSA 1KOGA 4YJ2F 2PGIA 2ANBA 3MHPA 3N7AA 4QE3A 4WFIA 4LV5B 1X7YA 3F1KA 5IM4A 3T7AA 2V9PA 2VNSA 2WSIA 3KT8A 9LDBA 1UMBB 5CVCA 2BGRA 2AJCA 4MTLA 4ZOAA 1NQWA 1T8YA 5F98A 2QVZX 3MGAA 4UEKA 5AW5A 4K9KA 2FPUA 4JCCA 5ERGB 2CSUA 4KDRA 1ULSA 4BJHB 1C41A 1H2AS 3D7SA 1NASA 4CQMB 1S2IA 2HCFA 1A8PA 1MJGA 4IQ0A 3H2IA 5KB3A 4YLEA 3TBKA 4PLVA 4EVQA 1XXHA 1CX9B 4INPA 5JCZA 2VSXA 4P0QB 4AKHA 2JAWA 3U4QA 5M7EA 4K87A 5IW8A 2D5LA 2ABWA 3ZD9A 1EBUA 1Z2NX 2C00A 1PQ4A 2EGHA 2MIIA 3NHZA 5FKJA 1Y1LA 1LS6A 3U5ZB 2M2IA 4UHFA 2UZ1A 3BXOA 1YCFA 4RADA 4Z0HO 4DV3B 4CIXA 1Y1TA 2X0FA 5AVTA 2ZBDA 3HXTA 3KO8A 1EFPB 1K0UA 2ZIFA 3ABIA 3OM9A 4O0MA 5LB4A 4RTNA 1EFAA 3ZDQA 1O3YA 1ADGA 4U0JA 1C29B 1E2HA 1E2PA 4YHHB 1GA4A 3Q72A 4L5AA 5LUBA 3IAEA 1UMDA 4IVQA 3AKZA 3G9XA 5F1PA 3O2JA 3OO1A 2X9VA 3VAYA 1ONNA 1WS6A 2XTZA 3LL4A 4JBGA 4JBWA 4RSRA 1LDMA 1C0LA 1REQA 2Z9DA 2ECOA 3QKRB 1ANKA 2PRJA 4BLRA 2WQ7A 1EGAA 3HXMA 2G17A 3UKOA 4AC9A 3C3WA 1XZDA 4ZQIA 4Y30A 1U63A 4L4ZA 1OI2A 3TZLA 1RXCA 1T9KA 2IEAA 3DOFA 4EHNA 1UWCA 1X8KA 4R9VA 3NRBA 3MYRA 4MH0R 5C3MA 2VDLB 3LT5A 4EIWA 2ZRJA 2VXYA 4OKNA 3ILVA 3HBFA 3T7JA 3NRCA 4R9RA 4P7JA 4O2BA 4ZVTA 1RDFA 4ZCSA 1KARA 3RRZA 1T9BA 2YIDA 4EG8A 1D09A 1BFUA 2Y68A 4MKRA 2HIGA 2ZPUA 2L69A 3D1JA 3GCZA 3IDSA 3S2SA 4CMKA 2PXHA 3KP1A 3LQ1A 4DQLA 4YCSA 1GAEO 4KQEA 1FS6A 1EK1A 1MO2A 1CPYA 1JF8A 1U9CA 2QW1A 2X8JB 1D0SA 1QIMA 2XPCA 3BCHA 1N8TA 1HORA 2YL2A 3FOWA 3OPXA 3SC2B 3UG7A 1U3VA 3QUSA 1T4GA 1DSSG 3HJGA 1JG3A 2EW2A 1OUMA 1M1YA 2RG7A 3BRSA 4HO1X 2O2IA 5KSPA 3TW0A 2W2OA 2BGNA 2C0CA 3B12A 5JZBA 5EINA 2B1JA 4HAXA 4YRIA 5LMZA 4CKEA 1RYHA 1IJFA 3C3PA 1GTRA 2DSNA 4F96A 1DC6A 2P69A 2WIKA 2XLBA 3P0HA 3R9WA 2QF7A 2DLNA 2W58A 4OAOA 4KIGA 3VPHA 1XEWY 3TR6A 3AR2A 3D0KA 4ETIA 3QENA 2VTBA 2WTMA 3FHTA 4IDPA 4PFKA 3VSAA 4ZIRB 2WT8A 4Y1RA 2XUJA 4XPIA 2Z6VA 3FCAA 1VXRA 3TE7A 5JJLA 2OR3A 3I9FA 3NBYC 1CE8A 1SZJG 2GARA 4FW8A 4L7QA 5J1SB 2DY0A 4CV3A 2A8YA 2NUPA 1Z5PA 3HGMA 1TIBA 3GEHA 4UDXX 3C6MA 2EJTA 2R8EA 4WJKB 2AEEA 1V26A 4XM1A 4Y7DA 2Q5QA 2QTLA 5ESRA 4Z3OA 1IPFA 2GGSA 2XADA 4DKXA 2A86A 1QG0A 2NZXA 5L3RA 4ZYWA 2FB9A 5LJIA 5EIBD 1QXSA 1RTKA 3EH1A 1VSBA 4FXPA 3UWOA 5E7JA 5AWFC 4GFDA 3TTSA 3W2IA 3IIJA 5BP7A 1W5BA 2A0FA 3FDZA 3RRMA 1ZH0A 3AEKB 1Z63A 1ZQ9A 3BZUA 3OZGA 3GBSA 2VYVA 1SCKA 2Q1XA 3Q3CA 3L4JA 1RU3A 3DAPA 4RANA 3P0JA 5IDVA 3PFWO 4RM2A 4CUKA 4PYIA 3VR6D 1ZCBA 2P78A 5DXJA 1PAUA 1Q0UA 2PG3A 1KMCA 3IAM6 2DHCA 2R7LA 3AR9A 2JLYA 2AQIA 4MIOA 1HQCA 4YCJA 1WW2A 2G4LA 3PTLA 4G5QA 4II2A 3F9RA 3N2GB 8LDHA 4BV8A 2KMLA 1FVXA 2G5TA 3OKAA 2CCKA 4IMPA 2IF2A 4FNAA 3AHEA 1EA7A 1LZLA 4KUEA 4YP0A 4MR8A 1QTQA 1EFRA 2F59A 2KHZA 1QM5A 1J22A 3LCRA 1O94A 4HFRA 6Q21A 1D6NA 4WXMA 3WKCA 1W0CA 4G0OA 4URZR 5KVCA 2IT1A 1V5GA 1K2VN 2XQIA 4OHWA 4HRAA 4BO8A 3LLUA 2C99A 3EY4A 1C5KA 4M37A 1L9XA 5CEEA 4OCZA 4YIKA 3WK4A 1RBYA 2DCUA 2ZI5A 5FOQA 4GR5A 2TMKA 2VLBA 3BDIA 1DLJA 1V1RB 1ZK4A 4M1SA 4AS1A 3E23A 4OP2A 3VYVA 3ZK8A 2LDBA 3WLTA 4OQMA 5HIKA 2R4UA 8AT1A 1SBHA 3C14C 2HA3A 2BFBB 2EBHX 4RVUA 4H7IA 2AXNA 4B3JA 3TIGA 1T6XA 2MU1A 1YVPA 4D6XA 1KYZA 2FRDA 2FG5A 1G7RA 2EVWX 2QVGA 4HXGA 4OMDA 3HUFA 1NP3A 4QJ5A 2ST1A 1UBTS 3PLNA 3RJ5A 1YS2X 2CLMB 5A7GA 1S7CA 2F8MA 4F0JA 2YJ4A 4NOJA 1YFLA 1E99A 1V41E 2GOYA 3EAFA 3G9ZA 3WLHA 5E6SA 4YRSA 3JRWA 5HSGA 2P5UA 1CEXA 3CH5A 4CMGA 3DMTA 3HO1A 1ODKA 4QSHA 2XE6A 5TV2A 5LZ4A 2E4XA 1UUFA 2GJAA 2R1TA 4IOMA 5EKDA 5IN4A 4R7TA 2EKZA 4MPPA 2CVHA 2LW7A 4BHRA 3YASA 1XBTA 3NBAA 1XTTA 3GJTA 4UU7A 4EY6A 4MPDA 2YVUA 1J09A 4PLGA 5AVYA 2QS9A 2Z2ZA 3QKSB 3TNYA 1RAHA 5KYWA 3HFJA 3RSSA 4BE4A 4BO4A 2W6MA 3ZHOA 1Y3HA 1TT7A 1Z28A 3CLKA 3H5OA 3I9NA 3Q6IA 4YGXB 3CR3C 5E8JA 1B1AA 2M6LA 3ZCPA 5JHGB 3OE7A 4YVFA 4QUAA 3IB3A 3GF4A 2PX6A 1D1SA 2I3AA 3DE5X 3DZ8A 3GQBA 3OX2A 4BZXA 3RNOA 1VGRA 1NMEA 2G36A 3IA7A 1GL7A 3WTCA 2XCOA 3DTVB 5JZVA 2Z9BA 3A6DA 1OZ0A 4P3XA 3ZWBA 5E38A 1D04A 2AG6A 2VHXA 1VCIA 1TZMA 2BFNA 2FEXA 2P68A 4QBGB 621PA 3O94A 2IDJA 1N6IA 4UOQA 1XDZA 3R24A 2G77B 3DULA 4XWYA 5CCDA 1QZXA 1U8EA 4JMLA 5T4BA 4BGUA 1P5ZB 1UT8A 2Q6OA 3E3OA 4IAOA 2QJOA 5BUSA 5TC4A 4OUDB 2L42A 5K0BA 4KV9A 2JW5A 2PCJA 4MA4A 3L1VA 4JWKA 2O05A 1BNCA 2GPNA 2F64A 5ILQA 3HPRA 1XAGA 1SIBE 1U80A 3K9GA 3OZRA 4JFAA 4UUOA 4OJTA 4X1KB 2PSFA 3L8HA 4QT0A 1L4YA 4U6NA 3NAGA 4ZVKA 1PD1A 3D3QA 4P6VF 5DM1A 4IIJB 4E1BA 5LA6A 2QL5A 2FMTA 1DXOA 2JI9A 4B71A 3AVYA 4NABA 3MLEA 2YY5A 3C6ZA 3L0BA 4AJ2A 5JAHA 4EPWA 2PK3A 2JHCA 1CZNA 1R16A 4KE8A 3DKPA 2R00A 2XSZD 3HDHA 4GPIB 4P4UA 3FYHA 1G63A 1P9LA 4Q7KA 4WKPA 3UAOA 3GLIB 3CN9A 3HU3A 1NDHA 1O9BA 2GNOA 4ITVA 1IQRA 3NTQA 4L02A 5EIWA 1VSTA 2WZBA 5LOVA 2QP9X 1PFUA 1W0JA 2WI8A 3CRZA 1KEWA 1E79D 3K2QA 2J5BA 3EAGA 4MV7A 2JIPA 2ZJ2A 3H3XA 4Q4AA 4Y6OA 3VHRA 3BMCA 1XVAA 4YRTA 5HQ3A 1Y4SA 4U3JA 3EZYA 4OFXA 5BUCA 3E7XA 1NNI1 5JDCA 2JJ1A 1K6JA 2HXGA 4ZKEA 1FU7A 1T4MA 1UBLS 1XK7A 4FHZA 4M1MA 5TARA 4XWTA 3ZWPA 4CVNA 1P2SA 5CG1A 1CR1A 1OTHA 4M9UA 2LE0A 3TTXA 4AZ3B 5CBKA 4CN8A 3BSSA 2XX3A 1YJ5A 5JXWA 1H2EA 2ZVJA 5IWCA 2H08A 3Q3IA 1Z6AA 1K8ZB 3HCPA 4LHWA 1JIIA 1TEXA 4RXTA 5FADA 3WGTA 1WHTB 2O2XA 2EX0A 2XA2A 1W75A 2GPSA 3KYCA 4EF6A 4BE7B 1ZW1A 3AERB 4CR6A 3K9LA 5D00A 3FMGA 2C4MA 3HB7A 2DT8A 1IN4A 4UNNA 1X1BA 4XUGB 1RM4A 5GADl 2R6CA 2GN6A 2F1IA 1AS0A 1H1LA 1TU0A 2CE7A 4R1UA 5CMLA 2FYTA 4E2WA 4MGEA 2CUTA 1Y6FA 5F9HA 2WWRA 3A8TA 4BUCA 4EY5A 5KSWB 1HLPA 2QRZA 2WPNA 1KAMA 4QYMA 2FF7A 2JIOA 4MV6A 5LB2A 1O4WA 4R3WA 3VPFA 3MVEA 1POXA 1XXLA 5I4KA 3GT0A 3O4GA 4HYYA 1QV9A 3KKEA 1U2EA 2V7BA 4MYRA 4FEEA 4UU1A 1GKLA 4QUBA 4DC0A 1AO0A 1BHO1 3GRZA 3QEMB 2HMWA 4MUFA 2XOKA 5COBA 1M2OB 4OQNA 1DXQA 2ZWIA 5F73A 3WKEA 4GX5A 4ZQEA 3NWPA 5HP4A 3I01M 2C9OA 3DVRX 1OF1A 1JJ7A 3COYA 2ZRHA 4WUTA 1U1IA 1G2IA 1DBVO 4GF5A 3UK1A 4YJHB 5JVDB 2WTNA 3HRKA 4Q3AA 5FBZA 1UFVA 3ABOB 3U56A 1MVNA 1VPVA 2C78A 2I1WA 3NALA 4DNXA 4IX1A 2X0RA 3PJGA 1LRJA 1A7JA 2VBIA 2YXEA 3DEKA 4LCBA 4RGVA 5DYGA 3V5NA 4EECA 4DSAA 9GPBA 1E64A 2EP8A 3ZHBA 5JNSA 5L6LB 2CN1A 4QYXA 4HLQB 5TF0A 1OI7A 1U9JA 3C5CA 4JLJA 3AYXB 3JQ6A 4ZVQA 4OX9Y 3FMVA 4DUYB 2YMQA 4ZOLF 3DEAA 1DAKA 1NDQA 3NIFB 4IQGA 3IAHA 1R8SA 2ZB8A 4JL8A 2O7VA 2YICA 3A9UA 3RRYA 1WULS 2NO6A 4GPAA 4IO0A 1ZGHA 3A3KA 3U81A 4KFSA 4BATA 1XQ9A 3RFCA 1QP8A 5AJZA 3PXCX 5B64A 3SHVA 2GN2A 5BXYA 3PHCA 4FUTA 1KJNA 3P20A 4JYBA 1UP6A 4W63A 2A5LA 3D7NA 2AJTA 4KR3A 3OWXA 1BJTA 5DRTA 3UMFA 1UXKA 3GFVA 4TLEA 4IP0A 4EKDA 4MW1A 4MRMA 3DC7A 4F8EA 1CRPA 1TZKA 1SVNA 1P0QA 3IP3A 4BVKA 2JGAA 4IIHA 1CIPA 3GXOA 3ZDFA 3I0MA 3N3BC 3UAVA 5G0TA 2VRWA 2JI8A 3AWIA 5THKA 4XJTA 3RS7A 4LYGA 1VJ0A 3QVLA 3LOQA 4IEFB 1DAPA 1JFVA 1YB1A 2FNAA 3A1SA 4XUCA 4BE9A 2V5VA 4QQNA 1GPUA 2BR3A 1IY1A 4ND5A 3TQSA 1WMSA 1UP7A 3FRIA 2GX6A 1A7AA 1QFYA 2ZRQA 1NKVA 1PEKE 4QBFA 1EFTA 3FUVA 3UT6A 4BGIA 3ANXA 1WR8A 4P5EA 3TCNA 5LBUA 4D97A 2H1OA 4HB2A 4D99A 1I33A 2Y0CA 2V6FA 4Q1BA 2OG2A 1J07A 3IQGX 3WJAA 4EUKA 4F8JA 1E66A 3PF8A 2ZRBA 3EY9A 1DAIA 1NYTA 3ONWA 3DB2A 4YMLA 4MKXA 4UDOA 3PUVA 1AQYA 3QEJA 1U2TA 3FNFA 3MWLA 2BFMA 5K6TA 4LGMA 1QZUA 1BOOA 3FTQA 2BRUA 4NPHA 1GSOA 5DCYA 1YFKA 4Q3BA 3WGUA 1KETA 2FPWA 3I32A 5ECYA 5F1OA 3URKA 4A6XA 4G0VA 1Z34A 1E1KA 2DPHA 5JAPA 2QI9F 2AMFA 2XMPA 5IKPA 3JWPA 4RU1A 2ZJ0A 3SICE 5HIAA 5A7HA 5HRAA 3T9EA 4L5JA 1A98A 4NATA 4CFSA 4KSCA 4C3OB 1V8PA 5ARCA 4HC4A 1E59A 4EPXA 4ZTUB 3WQRA 5KNDD 3CWCA 3HUUA 4DLAA 3KSMA 4ND8A 5J40A 3LDAA 1O6GA 4TS1A 1GT6A 2IYFA 4RK1A 1X9HA 1RC1A 3LHIA 3REFA 3BD9A 1RPAA 4RA9B 4HQ6A 1FSSA 5KYNA 4NOLA 3RR2A 2NYVA 2WFLB 1N6PA 2X8WA 3JQ9C 3GWGA 3HCRA 3N87A 4RFVA 3L6EA 3OCVA 3T4PA 1US8B 3Q87B 4G1BA 2I33A 3LA6A 1G9SA 1QVWA 5KHOC 3M4ZA 2OC9A 2OAQ1 2XGSA 2AD5A 2H3HA 2REQA 2B30A 4YJ2A 4EPYA 2C04A 5L3QA 4UM9D 4AUNA 1OWLA 4HT3B 3IRVA 1ISMA 3FTCA 4OBBA 5EZSA 4D4LA 1W0KD 4E30A 1DAGA 2ZJAA 2X8AA 3LLVA 4JNKA 3K35A 4X61A 4A92A 2XGOA 1UXJA 4TVKA 3RVJA 1ATIA 2YY6A 4F38A 1AV6A 2R84A 1T3GA 2HRCA 4G2NA 3CF0A 1IBRA 4M0LA 4QULA 1KAEA 1RC8A 5JE8A 2EBWA 5JYBA 1OV4A 4Q7MB 2HXYA 4N82A 1ISPA 1QIJA 4F6RB 1RXVA 3H16A 1YE8A 2RJ3A 1TTTA 2Q9AA 2ZXEA 1PQWA 2FSVC 2H52A 3MM4A 3VVBA 5MN6A 3RTCA 1ULZA 2DF8A 2WF9A 4BUZA 5DNDA 4G5SA 2ZUWA 5KYGA 2FJ0A 3B2NA 4MJ7A 2D8MA 2ZSKA 4RD0A 3D6MA 1JR3A 1XCPA 2YHAA 3SIWA 1LBHA 1D6SA 4AJ4A 3DEYX 4RLQA 5IHPA 3RIMA 1A9XA 4XLLA 4US0R 1W44A 1QHYA 2FQQA 3MCAA 4TKVB 1UQUA 3QUCA 5CFNA 5FO0A 3U1BA 1RACA 3M4NA 1JWLA 3U4IA 4EF5A 1QGED 5H81A 1IRIA 3BPSA 4M55A 2VPXA 3AHGA 2GNAA 1T5IA 3BILA 3PC6A 1UXHA 4EOGA 1I7DA 1NY5A 2CZCA 3A3OA 3K1AB 4JC0A 1I1OA 5FOXA 5G3YA 2PPVA 4IYJA 3RV3A 5E3IA 4HDAA 3BREA 1FFHA 2X0DA 3REGA 2V7WA 1VC2A 4OM8A 4C2AA 5A62A 5E0KB 3QPUA 5ERYA 4WNAA 3GFOA 4AXBA 4B4WA 4L4YA 5FD8A 5HCUA 3I1YA 2ONYA 4I08A 1CJKC 3ISTA 5DI9A 4Q66C 4AY2A 3ZNNA 2ZIZA 1FUYB 3T61A 5K0ZA 1KH3A 1QUFA 5I9LA 3L4SO 1KGDA 5BSRA 3ZJ5A 4J1TC 1GFZA 1YGPA 2F6RA 5EQFA 1CJCA 2IV7A 3IQEA 5DDIP 3WAGA 4O5OA 3UOGA 3BGDA 4PLWA 2WTUA 2FZVA 3BL5A 4U63A 1W8IA 5U4XA 1PR2A 2I66A 1MC4A 2OXTA 4CM6A 3WI7A 1P39A 2FUG1 1LW6E 4WZAA 2CHGA 2OO5C 3U3OA 4ENQA 4Y0AA 2V9CA 4C6TB 3JRNA 3DR5A 4HQRA 1Q6ZA 2GR7A 3AXTA 3MXOA 2XVAA 4BYGA 1GYQA 2J59A 4NMXB 4ZCTA 1NUQA 4ZO4A 1O8BA 2VBFA 1BWSA 1PJ3A 1QFJA 1WCV1 1TYBE 2CLEB 1VIYA 3JQGA 3L40A 3MAGA 3NX4A 4IICA 3T5MA 3UJ7A 4TYYA 2LPMA 3BSYA 4ZTZB 1JWAB 1SVIA 3ZU4A 3ILHA 5AK4A 1RYEA 1E3QA 1FBNA 1M6VB 1FYVA 2FW7A 3O9MA 4HVAA 1I7PA 1HQKA 1L2TA 2HCJB 1ZWLA 3P4YA 4P80A 5G0SA 1S2LA 3FOCA 1G8PA 4C89A 4KE6A 2ZYTX 1JPVA 2WJPA 4K8OA 2R6GA 4B4DA 1ZOIA 1XX6A 3RG8A 5AVZA 5LZ2A 2O0KA 4MVCA 4KH0A 5BWBA 4DCVA 1AQNA 4BNNA 2GPTA 4B3SB 3FGOA 4ZT7A 2W4MA 1BJKA 2R1ZA 2ZWVA 3DNPA 1PVVA 4EW6A 4GKJB 2O1EA 2QY9A 4DYVA 2AN1A 2BDTA 3RKUA 1U1CA 3AETA 1D2CA 3V8PA 4F8YA 3NDBB 3ELYA 5EQJB 1TQ2A 2FOLA 1C1DA 3J7TA 2ZE7A 4CGYA 3AJEA 2CLLB 1SOWA 1GKYA 5FHRA 4RL6A 3ZKWB 2BKLA 1IOLA 4I4TB 4WLNA 3RVLA 1TUBB 3R09A 4FFOA 5GZ1A 1MAUA 1Z0IA 4TL8A 2C4UA 3WO1A 3ESRA 2I3GA 4R8LA 3MN1A 4HS9A 1E9CA 3T3OA 2YNMC 3G2QA 5AQEA 3I2HA 2A5YB 4HNAB 1GWNA 4W5WA 1G5TA 3A2MA 3TQFA 1EUDA 2IVZA 3GAZA 3WQSB 2X3FA 1UC4B 5DASA 3VVCA 3TYXA 3LY7A 3F5QA 1R15A 2NXJA 2CWWA 3TPCA 5BV0A 3ZWAA 4OJQA 2JRLA 3O7WA 2GD1O 2GK3A 3ZUGA 1XELA 4RGQA 1EFUA 1O6BA 4UTNA 3C85A 5CEJA 1VCOA 3NRJA 3DG9A 7GPBA 2CVQA 2O3TA 2Q5LA 3JD3A 3KWLA 2Y8EA 5DP2A 3GHHA 3FF1A 3KJZA 5G53C 3RBZA 2JHFA 3H2HA 3JZDA 1C1XA 3O84A 3QY0A 4ZVVA 3IV6A 4UQLA 2FZ4A 3ZWKA 3D4PA 2MINB 3I5MA 4KL8S 4IGEA 1PEYA 4CL3A 2J6BA 2Y99A 5EZQA 3PA6A 4FNOA 3RC1A 1KDOA 2QZZA 2RHMA 3GEEA 4HFJA 3N76A 5J5CA 5KTKA 4WLVA 3GLFA 4N54A 4MW0A 4Z4QA 4W8OA 3WNBA 4CLEA 3NTXA 4PPFA 4A2CA 5JC1A 1QU2A 1C2YA 2CXNA 2E5FA 1I5EA 2QRGA 3CX7A 2FUNB 2O57A 4N5HX 1Q95A 3ZN2A 3K6JA 1KFEB 1M6WA 1ONBA 2JGKA 4I9UA 1G21B 2ZRNA 3AY6A 3W1WA 2AG8A 4WLFA 5DHPA 4LOJA 1KJ9A 2F2TA 2O2EA 3EGVA 4HLCA 5H5JA 3WFZA 4G0NA 3W8NA 2RHTA 3TGWA 1F2DA 1JN0A 1XTZA 3VOTA 1AX9A 3FJOA 3IDZA 5AOVA 4HN4B 3IOMA 3FUCA 4QYIA 1Z29A 3RSQA 4BPBA 4FSDA 1P0IA 1M6HA 3ID6C 4E5MA 3ACBA 1YS4A 3CLHA 4HB0A 5HM8A 1LK5A 1V39A 4LYAA 5FFNA 1MXHA 4UOEA 2QD4A 1XZPA 5JBQA 4WJLA 4WWHA 4Y0VA 3HJRA 4P08A 1EUCA 4M99A 2Q0SA 1L4FA 5K0TA 4ZYYA 2FCAA 1KMNA 4YQFA 4NNOA 1D2AA 4RZSA 4NE9A 2VHYA 4CTKA 1KMQA 3JPYA 2GAIA 3KJFA 2YVAA 4LYEA 2XYGA 3VU0A 4DZTA 4WADA 3AT1A 1DMSA 4V0KA 4KW7A 2QQ5A 4PU0A 3SXUA 3GFPA 3VR2D 2I80A 3K0CC 4JC4A 2A3RA 1RQPA 4OLFA 2HAEA 3Q88A 1YIOA 4IDHA 3FNEA 2D4HA 3OBIA 4GM4A 5DNVA 4X6YA 4A7PA 5AESA 5BO5A 1B8PA 2G9ZA 1F9AA 4HNVA 2ORED 1VLJA 2PS9A 3N8NA 1Z45A 3ZW8A 1UBEA 4Q4HA 2UAGA 3RHTA 4AYWA 1HE1C 2NQ8A 2VYFA 1K5HA 1IOZA 3BTVA 3EEBA 2YYSA 4U2FA 1YS7A 5IVDA 2OV4A 3PUIA 4ZZIA 3UWDA 2XKBA 2MSLA 5HE9A 1M76A 1UDXA 1A5SB 4I2VA 1V96A 1HBJA 2G1JA 4KO1S 4PSUA 3T1VA 3R6WA 3JAMA 3T7RA 3O3OB 4L8YA 4OJYA 1UC8A 3TTUA 2IODA 2VPWA 4XUEA 2IPMA 3TTYA 2GEFA 3LKVA 4OGFA 4P31A 4D8WA 1DEXA 3O1IC 1TYDE 2VSFA 4UUBA 3PX3A 4NICA 4ZDWA 4URXR 3WYBA 3UVEA 1AZWA 4H1TA 3AILA 1XRNA 3VTAA 1ZBDA 2XUIA 1CUDA 1TVMA 3G88A 4NS4A 3RFTA 3W2FA 2GESA 3S55A 2ZM6B 2QMEA 4GBED 4QFCA 2OV6A 4I1VA 4LGCA 3G1WA 4ER3A 4YJ3B 3WB1A 3JYOA 3HA5A 1DKPA 4TKMA 4ND4A 1IOWA 2OORA 3HY3A 1N5LA 3HCEA 1XZEA 4BKMA 4ZZ1A 3QU2A 5CCBA 2JLSA 5FA5A 2AKYA 4NOKA 4BNDA 1Z82A 2GBLA 4FKBA 4QA9A 1QE3A 1AUXA 5KOJB 2P62A 3MWKA 3GLKA 4PLTA 3B8HA 1UCFA 1U2ZA 3HCWA 2BR4A 4IG9A 4DXHA 3LYLA 4KN9S 3K9CA 4ADSG 1TAUA 1WXDA 3ES9A 1YQEA 5EMNA 4DV1B 1ECCA 2GM3A 2PS1A 2ZP1A 1JEJA 3LP5A 4BWVA 3Q7EA 1VJRA 1PGNA 4QBHA 4C0WA 2B8WA 3VPGA 5FI3A 3HBLA 4XGQA 1SC1A 4DC9A 2AKEA 1D5WA 1E9SA 4LC9A 3E2PA 2CLKB 3TUIC 3ZXIA 5I7FA 5LPNA 1GOTA 1NXQA 1SY7A 4DMCA 3GUHA 4ZVNA 4GMDA 3VZQA 3EWNA 2OGTA 1A9SA 4KVZA 3ET5A 3BL6A 2Q0HA 4N18A 4MPRA 1QBKC 2D5CA 2RJNA 3A6JA 1DXYA 3L82B 2RKWA 4A2WA 4B75A 4HGYA 8ABPA 4IIBA 4DQKA 5JCPA 2HB6A 3RAFC 1NKTA 3DTYA 4GS5A 1FNNA 1MDBA 1XCLA 2O3JA 1QQ7A 4IZOA 3A6FA 4QDOA 3QF4A 3L0SA 1NF3A 3I9V6 1Q0SA 2BM9A 4IDEA 5EZYB 2I2BA 5DKFA 2DYKA 3QTTA 3E9CA 2BGLA 4MMYB 4QIHA 2IWHA 1RKXA 4Q9NA 3INGA 5KTOA 4F5YA 2YJ6A 1WP4A 16PKA 1E2JA 1H6BA 1PE0A 2CNOA 4NL4H 5DCUA 4F91B 3P9ZA 4AAYA 4EENA 1Y9DA 5JBNA 3D4NA 5JNUA 4L76A 4UMVA 3RK4A 1NYLA 1XEXA 3UHPA 3PGVA 5LZ7A 2G08A 4BRZA 2ZVDA 2X4LA 1E63A 1RWBA 3MT0A 4DLYA 4UHHA 1YK1A 4E2FA 3B51X 3N2LA 4O4HB 1OKKD 4A0FA 3J7AC 1HTWA 1L3BA 1K6IA 5ISMA 3AFNA 4BKRA 4KI0A 3KUKA 4C6RA 1ECPA 2WYWA 1SKYB 1SVKA 2CMHA 3HY4A 4ARBA 2JANA 1JIVA 1P72A 1YIAA 2C59A 3M3PA 4RK6A 1JHVA 2IW1A 4MV5A 4Q4LA 1NXPA 3R3UA 4G86A 5FEUA 3AUUA 1V3VA 1ZGAA 3ADKA 2M9MA 1WU8A 3GPIA 1AKYA 5IDXA 3I45A 4N03A 5DLYA 3CRW1 4Y9RA 5I7UA 2TSYB 4DNQA 2WVHA 1KYWA 5EE9A 4D4IA 2HK9A 4KKVA 4XYLA 1N2EA 4DR1B 3BH0A 3H1PA 4LXGA 4OXKA 4WLEA 1IZ7A 3GFBA 4NJEB 2H5JA 1C7JA 4GSKA 4WI1A 4ZRDA 3NTUA 2CT8A 1N8NA 1AKWA 4CTOA 5A05A 2AC4A 6ADHA 5F1YA 1Y3FE 2FZ5A 4ZOLA 3PWZA 3PXGA 1V47A 4G0ZA 3AFOA 2E3JA 2GCGA 3F8WA 1FP4A 3KTAB 4G84A 1G7CA 1ZCJA 4XUDA 3I58A 3T41A 5JSUA 3KHTA 2XB2A 1AQ6A 2FOIA 3M6AA 3R5JA 1KFJB 1U8YA 4LPSA 2J0QA 2A9OA 4GKBA 2RGNA 1SAYA 3WJ1A 1TQHA 1RW4A 4L8WB 1G3IA 1NY6A 3V1NA 1VJTA 3SJBA 4UUPA 1TRHA 5FYDA 2GHRA 1Z2PX 2Q27A 1C4XA 2Z9CA 1LTKA 1DZ3A 3LLCA 4I99A 4JT2A 1NVWQ 1FFAA 3KOUA 4YN3A 4BJ1A 4Q9KA 2IZ0A 1IXSB 2DJIA 2RHWA 3PR3A 2GJ9A 5L3SA 1QCZA 1C3XA 4TPKA 3Q6MA 4F71A 2CJWB 5SZKB 1XZ8A 1SKAA 3K5HA 4MEBA 1ZHOA 2WKQA 1N2IA 4DQUA 2P0AA 3DDHA 2P67A 3ZW7A 1LBEA 2YN4A 2ZIGA 3TE6A 1X7XB 2X22A 4PPGA 4R1OA 1HF3A 3HI4A 2I6SA 2JKVA 3M70A 2FPXA 4MVYA 3RVQA 4ZCIA 4OQXA 3ZU6A 1OB2A 1WDTA 4D9NA 4LWQA 3D3KA 3CVOA 4HR7A 1FDTA 2W6IA 3OJ0A 3IGFA 5F51A 3AB8A 4ZZ2A 2FZWA 1WKBA 2HPHA 4E1VA 4F46A 3D6JA 4FDTA 4GGPA 3G9UA 2JLCA 1Y3BE 2Y2VA 3ZCUA 5IKOA 3Q7PA 3HYSA 4G4SP 3NBXX 3IMEA 1F0YA 2BFFA 2CUKA 3C43A 4HYTA 2OQVA 4ZIRA 3K9BA 2P9YA 4BO2A 4XR9A 2QSUA 3NBUA 1NWHA 3RYIA 1SBZA 1ENPA 1Z5GA 3CW2A 1S8NA 2PT5A 1FX1A 2HY7A 3LXMA 3OPVA 3CF4A 4COKA 4M8NE 2HMTA 2YS7A 4IX9A 1V1MA 2YFQA 1MNQA 4NXNB 1C4WA 3WZMA 1ESNA 1XEWX 3KEQA 3QQPA 1SBQA 4HUQA 4TWJA 2NO5A 1E2EA 4I4TF 5IP5A 2W2LA 2FPIB 4KQCA 2R96A 4AVYA 2II6A 2J7PD 1RYMA 4G41A 4QQRA 4XEUA 4ZAZA 2IQIA 2OPHA 3SFVA 4XFDA 5FNVB 2DUUA 4KDCA 1SXGA 1GU7A 2VH5R 5ALQA 1W4ZA 3TLYA 1E3LA 4UDNA 4CEIA 4HVLA 4TYNA 1AMOA 4HDSA 4YPOA 2I6FA 5K3DA 2A9KA 2FDRA 5J4LA 1NMZA 4XWWA 2QLLA 4K86A 4B83A 1O87A 1SC9A 1QK3A 1TLLA 2XIQA 2GZSA 3V7WA 3SXJA 4B6PA 2RGAA 4DXAA 3H2SA 2Y1WA 1GNRA 4ZJPA 1BXGA 2CDCA 1A9ZA 1CB0A 5AO9A 1KC1A 1P4JA 2XT6A 6LDHA 3GVPA 4FGJA 3NASA 3LXXA 4J76A 3B6ZA 5J2TF 4P22A 4S0ZA 3B1WA 1CFZA 2KBFA 3O8BA 5AHOA 3TTVA 1WXQA 1RJDA 1U6IA 1Z18A 5EOVA 1MV5A 1VA5A 1YONA 3FSRA 1E2IA 3A1EA 1Z3CA 3NDPA 5DCWA 5JC8A 1ESMA 1JJBA 1LSUA 1Z2CA 3FMPB 1F0KA 2ZSBA 4PPNA 1JA0A 4D25A 1ZN2A 3G17A 3CZAA 1CUHA 4US1R 3KU1A 5HTOA 3T3IA 1G4HA 1QBGA 2ZTMA 4C05A 1OCEA 2FFAA 1QF9A 2WF7A 5KTNA 3DB1A 2RHDA 1WVIA 2OK7A 1OBFO 1OBVA 1GJRA 3DVLA 2X9LA 5BPHA 1Y48E 4J16A 1WCIB 3H0KA 4YBZA 3GGPA 5DHTA 5EIEA 1R8YA 4DCSA 2HQ1A 5C35A 1Z22A 2ONZA 1QYCA 4R0NA 3W0LB 1BEEA 2Z58A 4UREA 3CSUA 4ROSA 3DHYA 1ILWA 1FFYA 1Y3CE 3IVXA 2I52A 2VRCD 3P52A 5DTJA 3T7CA 3WA7A 1QJCA 5JJ5A 3WLNA 1XZQA 1KR5A 2W2QA 2Y05A 3FNHA 3IOBA 2OXFA 3ZWOA 1NULA 5F64A 3W6ZA 1H0SA 4K1XA 4OHMA 4GLLA 1K1EA 2A1TS 2EEPA 4NJOA 1KZ9A 2Q9UA 2GVNA 1OXUA 2FE4A 4PVCA 3RS4A 5FJJA 1B8OA 1VTKA 3KZOA 4HEJA 5E8RA 1RLMA 4XX0B 3ZGNA 4TYMA 4KV7A 1NRJB 2XKAA 3AVQA 1R4MB 2NN3C 2IZ6A 4LRTB 4ZAGA 2KYRA 4RKFA 5G41A 2PLWA 3RUDA 4ESOA 1DKQA 4M83A 1MEOA 2RSLA 3V80A 3WGLA 2PS0A 1ZRSA 3X1XA 3IKTA 5C34B 1NBMD 2PN1A 2IZ7A 3UATA 1JDBB 4IFTA 5H02A 1BCSA 1OD6A 3I3SR 1NVBA 4GP7A 3FETA 4R1TA 1T43A 5DXAA 3UWKA 3ZHCA 4CW7A 3P9PA 4PVDA 3HJHA 4X3PA 1T5SA 4M0UA 3G6KA 4Y2PA 4KO3S 4BMCA 4OD0A 2OWEA 2NZ2A 4KUHA 3W2HA 2QGNA 5HBGA 2JVJA 3ZWMA 1JPUA 1JEYB 4C0LA 2R5WA 3HEBA 3DTVA 3V7UA 3W3ZB 2HFJA 3ZJUA 2XVXA 1K98A 2YC4C 2ZSJA 4X6XA 2FFHA 4CL2A 2B4KA 2VTKA 4L9WA 3I5AA 4MUNA 1FUIA 1JDBC 2G8LA 2NT3A 3AYZB 3CUSA 3KE9A 3MTGA 3OAAD 3JALB 3PNYA 1OLOA 1YQDA 4KWTA 5BN5B 2I1VB 2YJGA 2Z2JA 4O08A 4JOQA 3U80A 2ZBVA 2UYHA 2C96A 4X7RA 1QC5A 2W98A 5JCJA 4YAWA 4YAIA 5MDHA 4OUDA 5FPYA 4E09A 1O7JA 3FWYA 4MWTA 5CUQA 4RVCA 3SYRA 3WIOA 3G8DA 2EV9A 2LIPA 3DWIA 1E1DA 3UHFA 3HYLA 5ALPA 1R66A 2JJYA 3IIEA 4RKWA 5BWOA 1MO5A 2FI1A 3P9QA 4QOIA 4DRZA 5AIBA 4FJ1A 5FLEX 1UJBA 3UFBA 1PZNA 5ITWA 1CP2A 1KQ3A 1U3TA 5B4TA 4MQFA 2R6HA 4UE6A 3GLIA 4Q18A 4LDAA 3C6XA 4JN6B 1SIWA 2E4VA 3KZKA 2J46A 5KKAA 4MQ4A 4BBPA 1ZLYA 2Z8ZA 3OETA 2BM1A 4KBFA 3TJMA 4HZUA 4TVOA 5IYZB 2A4MA 3GCWA 2LUOA 2HUNA 3AONB 2BZ0A 4FZRA 4QJ4A 5B7NA 3QUQA 2O07A 4A8TA 2PX5A 3STHA 3VOAA 2IYVA 4GI2A 5EP2A 4LY6A 3KOYA 4BAGA 1N7IA 1DCTA 2C4VA 3GA0A 2PL9A 2O8EB 2FPMA 2XQVA 2AFIA 2H00A 1CJBA 1PN3A 4HK4A 1T2CA 3IVAA 4AZ3A 3IO5A 1GAWA 1L8QA 2DPGA 3PK0A 2VJNA 3A4TA 2H07A 2CFTA 3RF7A 2WNHA 2GYYA 2J7KA 1WNTA 4P4SA 4B3TB 3D3WA 2QHXA 1PLJA 4G8CA 4GX2A 4UASA 3G2MA 4NMHA 3KFVA 5DNWA 4BP1A 1PTJA 1UM9B 5AW0A 5AK0A 3VH3A 2JH3A 4B4OA 4UAUA 3EF0A 4OXXA 2RHRA 3NTVA 2XKKA 3LT2A 5LQCA 4YAJA 4M8KA 3EG5A 3GMTA 5JAIA 5LMNB 2G88A 2J07A 1LJ8A 3OECA 1G66A 3HKBB 4KUGA 4YGYA 3F0TA 3P2YA 4H27A 3RC8A 1DV1A 2RH9B 3EXIA 1K9SA 2Y2UA 4OYHA 2P65A 1HE4A 1Y1RA 1E4VA 5ECDA 3O7MA 3I28A 3JQAD 2YV3A 1M8FA 1U2DA 4N3AA 2ZIXA 1Q1BA 4MYSA 5CX1A 1XEFA 5EZ5A 2WAOA 3F4BA 4HYEA 2GVZC 4TQAA 1M10A 5AKJA 3TWOA 2N47A 2GDJA 2X5KO 1FFWA 1N5KA 2JA2A 1PCXA 3BE5A 3OCCA 4EKGA 2Q5JA 1XALA 1NBWB 5GPBA 1ZYUA 3QEMA 3SEQA 1HTBA 1GYPA 3EBOA 3OH8A 5LQDA 2EERA 3G2LA 4G9EA 4K9RA 3LA8A 5EWLA 3GMSA 1UT6A 2JD0A 2V0CA 1DQPA 2OHJA 4P84A 3FTFA 1P4AA 4MYUA 1DKUA 2YJNA 2P6RA 1JXMA 3OQIB 1C1HA 3N0WA 4D45A 1EWQA 4LZOA 2GVDC 2P2YA 1Q91A 4HJRA 2GHIA 4PS0A 3VR4D 3A6EA 4TL7A 3UK0A 1M33A 3M9WA 4L7VA 2OY0A 4H2DA 1N77A 2PUTA 2P4EA 3AV0B 5ITVA 1T9GS 2C9DA 4ZRNA 2VEDA 3I4FA 2IBMA 2Q2NA 4KAXA 2BELA 4YXWD 4NBWA 5FCDA 3SCZA 1TIPA 2E6UX 3BRCA 2EL9A 3NS7A 5B37A 4CHTA 4DSTA 4UTZA 5JXGA 1X15A 1RNLA 1SBCA 3LWZA 4FR5A 1GUBA 2G28A 2QLJA 2WR8A 3L07A 3UQYS 2GTPA 4HEA6 3IEXA 2FLVA 2H5LA 2XKJE 4W1QA 1ZD4A 4YAGA 4BXOA 3V8MA 1DG1G 2EFJA 3IUJA 4DLNA 4LK3A 4DZRA 2W6QA 4EW2A 2RGRA 4JJGA 3HWRA 1IN6A 1AIPA 3E1KA 3AKYA 5HCIA 4AY3A 4GXRA 3RUPA 1YF3A 4RS3A 3GZTB 3WB0A 2MR5A 2XAUA 5CFOA 5IASA 4IQ8A 4MAFA 1NX9A 2Q7XA 3G02A 4AKTA 3D5TA 3B2EA 3P2KA 2H9IA 1P7PA 2ZIUB 1ECLA 3WDSA 4DVJA 2Q2OA 2R25B 3EC7A 3H6KA 3O8OB 4YI5A 2BT4A 4WOBA 3QA9A 1JR4A 1PNOA 1MCZA 4FWBA 4NBSA 4TTAA 3ZBUA 4Z0PA 1PX2A 2QKYA 1TMKA 2CFCA 3K15A 4OLAA 3DT9A 2GRAA 3F6PA 2ZOSA 3DONA 3GDOA 3IHLA 1OH6A 1E1NA 1MQAA 3C0KA 3T0FA 3C7DB 2NXCA 3W3AH 4IDGA 4IL5A 4KQ9A 1FUUA 5JAZA 1E5QA 2NUTA 3PUJA 3FMOB 1YE5A 2EL7A 3NVAA 2BBTA 2CFOA 1ZOOA 2ZSAA 2J8ZA 4FGLA 4OP3A 1DBPA 2AF4C 3DW3X 3KJIA 3G8AA 4NCBA 1RC0A 3F46A 3SJCA 3THXA 4YMVA 4EAAA 1AGRA 1WXIA 5D5PA 4G5OA 1U90A 2HSDA 3M3HA 3KWJA 4ZQFA 3SJUA 5A5FA 2WJGA 4IS3A 4NU0A 5AXBA 4BYMA 4JV5B 1F5SA 3ULKA 3WNDA 1GGMA 1NJFA 4HSEA 1ZN9A 5AJTA 5C8ZA 4W9MC 1DMRA 3T94A 1RM5A 3THWB 1WXGA 3LUHA 1I6MA 2R66A 3IAM1 1M5TA 2OGUA 1PP4A 3MRSA 4M86A 5EKSA 3SJ7A 1R6UA 4P83A 8OHMA 3H5LA 3BXXA 4XPZA 3DMYA 4FHDA 1KI2A 2IY9A 4NG5A 4ZJUA 4JROA 1D2GA 4ZO9A 3U3JA 1BOFA 2IHZA 2LRHA 4C29A 3DLHA 3NHMA 1E89A 1YRWA 5AVXA 1DKNA 3TK1A 2HQSA 3ZHYA 4HY3A 4PGAA 2FEOA 1UFQA 1Z8DA 3N0TA 4LZNA 4C9BA 1T0IA 4BX3A 3U4MA 2JKZA 2AUNA 1U28A 3PGJA 4MKZA 3HEMA 1TFRA 5FWAA 4F6LA 2VT3A 4FQ7A 1AN9A 1F8XA 1Y5IA 2ZKIA 3KSRA 4B45A 4LMAA 4DCOA 3LSTA 3HUEA 5DYTA 3D7MA 5GIPE 1LPMA 2FF5A 1EDEA 4HX9A 4MYDA 3IHKA 4G37A 4PCAA 2P4UA 1DB3A 3DVAB 3GH1A 4JBHA 1JLSA 1KO5A 4ESHA 1MOSA 5EPEA 2XWJI 2RARA 1QRAA 3UA0A 4HMPA 4HTFA 4GXTA 3OZWA 2WFLA 2PWZA 3DVSX 3E9YA 3I6QA 3LLSA 4O2AB 4JI1B 5JY6A 3G0HA 3P2JA 4FVTA 1KXJA 2UYOA 5KJEA 5KEIA 3RAJA 1US8A 4UZSA 2XGJA 1VSUA 5LYJA 2GZMA 3N8IA 4KG7A 3TOSA 3BH6A 3GYGA 2X5NA 2H1IA 3ISVA 4MWGA 3TB4A 2F67A 2G9UA 4EJSB 4ZMBA 2ZEJA 3R4VA 3LAWA 3L1IA 2GPWA 5LQNA 3CR7A 1ZGJA 4B6QA 5KMGA 4AY6A 1WPQA 1GSAA 4Y9SA 1XHEA 2DT5A 2YW9A 3JCZA 3LOUA 3NV9A 2GK7A 2LDXA 4UMDA 3OIFA 4EMBA 1SU7A 3ADBA 3BXPA 1NE2A 4JSYA 4UHCA 4B34A 4DBZA 2V7GA 3K09C 3E82A 4C14A 2ZRAA 1BX1A 1EFVA 4XI9A 4CKXA 4JGGA 4DB2A 3PQDA 1UP4A 4QZVA 2FW6A 1HDGO 2Y0EA 4EJSC 1EDOA 3BWDD 2X15A 4KRXA 4W1SA 3PI7A 4CNQA 2JBHA 3K1TA 4M54A 1O96A 3ZD7A 1I3OA 2C5AA 2PX0A 3DZHA 3WDKA 3FDIA 3QMPA 4MI6A 2WRZA 3BFJA 4RA6B 5AM1A 1JHZA 2C2YA 1E9EA 3ON5A 3H1EA 4GR9A 5BN3A 1D8AA 4TLLB 4F5ZA 3ZQ4A 4EVRA 4N8DA 1N9ZA 4CT5A 2G6TA 2GN8A 3LHFA 2XBLA 1RHUA 3NH6A 3EVTA 1L6RA 1BYIA 1WXWA 1U8AA 1WA5A 2OMKA 2EFYA 2YHSA 4D4MA 3RC2A 4W6QA 1L4UA 1PL6A 2EFCB 2VP9A 3EZ9A 4FONA 1PL8A 5KYVA 4MUAA 1YRLA 4KYTA 4JOCA 1QIKA 3W5AA 3AUSA 3F9IA 3QF7A 3K4PA 1Z4IA 2Z98A 3TZHA 3PD0A 1OPXA 3DS8A 3G0GA 1N9GB 3N28A 2XTMA 3VU8A 2QQ0A 1GEEA 3BDAA 3LBYA 2V4ZA 4JI3B 1T3HA 2H11A 3ZDYB 1P62B 2O2ZA 3JU3A 5KC8A 4JLSA 2MSDB 4H6XA 4N5IX 4DEVA 1GTSA 2GRJA 5C5DA 4BZPA 2A78A 3MMNA 2I99A 4N3CA 3JQ8A 1MW8X 3WFJA 5HPYB 1DAHA 1R4NB 2VN8A 3KQSA 2O0LA 221PA 3QMWA 2X6RA 1AHHA 3O4IA 3V1LA 1YWGO 3AI1A 4DM7A 1JG6A 2GZ3A 5IJ0B 3F7NA 1DFHA 1DWPA 1PFKA 2GDZA 4Z9YA 1QZTA 4FUQA 1B74A 2GI4A 2OCPA 4WD3A 1I3CA 2DTXA 2G07A 1RZVA 1EAMA 2VDVE 1SHUX 4YJFB 3EIFA 4C6TA 2QM3A 5L6MB 1MV8A 1G19A 4JLNA 2H2AA 1W35A 1JDSA 3GJ7A 3RVMA 4HV4A 5KSYA 3BFVA 1Q5PA 3EMDA 1HKHA 1JKJB 1R0ZA 2ZUCA 4MLPA 5D3MB 5AW8A 1QQ5A 3L5KA 3K9FC 4EBFA 4EHIA 3H5AA 2ZREA 3U26A 1GCAA 1YOVB 4B40A 5EKUA 1E2NA 1PFWA 4DGQA 1AKUA 1C9MA 1DC8A 3W78A 1WOYA 1UMCB 3GJ3A 1GIAA 2V65A 3LHDA 1GTMA 1R0WA 1K3FA 1V3QE 1YTLA 5FTLA 1AKTA 2E37A 4JBIA 1RRCA 4WW0A 3HP7A 3ZVKA 2XUKA 2B36A 2C3UA 2Q1UA 3AZOA 1N2HA 1RJGA 2KWIA 2Z4RA 3Q9SA 4DM4A 5AIAA 5CM9C 3AZPA 1DUSA 2ZYHA 3ORSA 3OHSX 5AVWA 1C7QA 5AJWA 3JTEA 1ZISA 4CTMA 1M0WA 3B7PA 1IWBB 1L5MA 4H4EA 4NARA 3ZZ1A 3RC9A 1A2KC 4J91A 4ZCMA 1AQLA 1QP4A 4H15A 2XYHA 2X19A 4GE3A 4AWAA 1XZAA 2DBVO 2RBKA 3VO9A 3WRYA 1E5XA 2W22A 2MYNA 5JO0A 3KT3A 5IYZF 1VL1A 1SUSA 3IJPA 3UA3A 4PO9A 4LBZA 4PNPA 3ROGA 3ZKWA 4QT4A 1E77A 1KE2A 2VI5A 3KEFA 3TNLA 3K16A 2P6OA 3OTIA 4U7TB 3KELA 3RE1A 1JMYA 4BLVA 3TRFA 5ADHA 3M6LA 3B1FA 3GHYA 5EXEA 1U7TA 5CH3A 3U39A 4FFPA 1XJQA 1CWUA 5HIJA 1MO3A 3K0EA 3WNVA 2W6NA 3PGXA 3OX3A 2FTKE 4JYMA 1KK0A 4HEQA 1JJAA 3HRIA 2OOKA 2OLEA 3LFTA 2HHAA 4D98A 4RK5A 4JB0A 5TQ0B 4CM9A 2VJOA 5J2TA 3E9ZA 1LGYA 1KI7A 1PQUA 1DELA 1JBKA 4NMWA 5JFOA 3JSAA 2EQ5A 3IP7A 1H2HA 3X1ZA 5KX5B 2MINA 2YQZA 3S40A 4QTTB 2WSSD 2IU4A 3H04A 2WYHA 2ZRIA 1XRQA 4RMGA 3LUPA 3TIVA 3RYCB 4F3NA 1EESA 2AHRA 4BFSA 3I2FA 1NURA 4CXMA 5CXSA 1E3WA 3RM3A 2O19A 1ZI9A 2A9PA 2YJ5A 1YUNA 4RHYA 1LU9A 2PVSA 4WK6A 4P0TA 2IXDA 2C31A 4FOPA 3IX7A 2X1MA 1LF5A 4I9NA 1EQUA 5DO9A 1G21A 3PT5A 2OV8A 3COSA 4OQQA 2H7XA 2ZYUX 4H7PA 4ARAA 3DFKA 3ZYZA 1TZBA 2BGTA 3B6JA 3HADA 3PNBA 3W3AA 1IXZA 5I7AA 3ZWDA 2C7RA 4F3RA 1BW9B 1CUSA 3HJFA 2HLPA 1G8MA 2SICE 5CA1B 4IVPA 4H3VA 4ZO8A 3DPIA 1B93A 1OLSB 3H5RA 1WSBA 3HVUA 5TQVA 3RT9A 1NR1A 1Z16A 2QL9A 5BRNA 2J0SA 1K6MA 2P5YA 4C30A 1YIDA 4DLKA 1ORVA 1DEKA 1QHHB 2B98A 4EWLA 1TA4A 2Y9MB 5B55A 1DVRA 2Q8QA 4ALKA 4QTZA 2A0UA 4E6PA 1R0CA 721PA 5IAOA 3EOBI 5DWQA 3K0CA 2PV7A 1KEPA 1KYYA 2O2CA 2R3SA 3O03A 3PC4A 4AX8A 3FCXA 1T3SA 1SKQA 2OV2A 3U3XA 5KOYA 2BH2A 2PKEA 1OT5A 4G0XA 4H35A 5DN9A 4BJ6A 5A5VA 2VT6A 3LUGA 4RXMA 3UJNA 2DLCX 1F2TA 1LLUA 1QZ3A 3CO5A 3E03A 4LA4A 1N2CB 3KG2A 1NJ1A 3IDOA 3LGSA 1PZMA 4LJYA 3ODGA 1C1YA 3QXCA 1AF4A 1UXIA 4L8LA 2XD4A 4NBVA 1MHPA 3EUWA 4K6CA 4OMFG 2NMVA 4DNPA 4WESB 4NU5A 2P9GA 3LC1O 3I34X 4MQ6A 5I4IA 3SHTA 1Z6XA 1QG2A 2ZPTX 3VKVA 1UFKA 1KPHA 2LCFA 3RUCA 1L5YA 1RLIA 3T1HB 2ORWA 3L9WA 2AX4A 1QHNA 1P7ZA 2PT7A 3TOCA 2YV2A 3HV2A 2QUBA 5F5XA 3EGXA 1ORRA 4DDHA 4W8HA 4EUNA 5DNEA 2BDUA 4PEVA 2VLIA 1D2HA 5LD2B 1H2ZA 2HDOA 2QAJA 1R6VA 4TSRA 4IDAA 2NQ2C 3NT2A 2AHOA 1V25A 2RBGA 4RDXA 3HB5X 3UW3A 2Z30A 4M3NA 5H70A 2C0QA 3D43A 3P9CA 1B1CA 2QWXA 5TQJA 2BEVB 5AXCA 2FSFA 3AY3A 4GKKB 4AI6A 4MCJA 5JT1A 1T2NA 5IF3A 3KB1A 3E22B 5LD2C 2R8YA 4V0ME 1FQOA 4GMFA 4X8OA 4G01B 3ZE0B 1W9HA 1KKMA 1SUPA 4KQXA 4LJ7A 2VP6A 4W9NC 4TQGA 4HN2A 4JLOA 1NJ6A 2I1QA 3WTBA 2R6R1 2HJGA 1IRXA 6GPBA 3R1IA 4OHPA 4F7WA 3KQUA 5H3LA 1DCKA 2QTVB 4URUR 4YUVA 2R65A 1BTOA 1XVVA 2YFHA 4ECEA 3CU5A 1GEGA 4FZVA 3TVTA 1PGPA 3B7WA 4Y2GA 3G82C 3UT0A 5E3JA 6YASA 3EW9A 2ZGVA 3UMYA 5KOJA 4NCNA 3JVUA 3HBAA 2OENG 2OAGA 4B7ZA 3RROA 1QH1A 1XPUA 3PLRA 1X8XA 4FDMA 1XE3A 1JECA 1K66A 3JARA 1NAIA 2HJRA 1D2NA 1EP1B 6CHYA 3RAEC 6REQB 1EUQA 3QHQA 2WM3A 3DEJA 1G8YA 1L5RA 1Q1GA 1D0IA 2DKNA 2HZBA 3R5XA 4ME6A 4P1ZA 4IOJA 5H9WA 1KKUA 1TM2A 2FPKA 3ZV3A 1ATZA 3KZVA 5HDQA 2W42A 4RTOA 2E87A 1PX0A 5JASA 4IGIA 3T9AA 1S3FA 3PUZA