4DE5A

Pantothenate synthetase in complex with fragment 6
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 93
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4de5A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4de5A01
4MW2A 1RQGA 2Z3VA 2VTBB 2TS1A 2HGZA 3TNJA 1D2RA 1WQ3A 4EG7A 1OD6A 4MAFA 1QNFA 1O95C 2H2AA 4ZT4A 4MUFA 1KH1A 3K32A 1J1UA 3UK2A 1PFYA 2E0IA 5J59A 3H05A 2OV4A 3FDXA 1NUSA 1G8FA 4DNXA 4YP5A 4CDNA 1MJHA 1O97D 2CYAA 2QJFA 3HGMA 1IQRA 2J4DA 4Q93A 2CUZA 1OWLA 3KT0A 4EG1A 3CVUA 3P0IA 1IRXA 1WOYA 4EG5A 4EGAA 3KT6A 4F4HA 3IMGA 4NAUA 4NDAA 1I6KA 4DLPA 2CYBA 2J09A 3CA8A 1CT9A 3SEZA 1S4MA 1V8FA 3L93A 1U7DA 4ARIA 3CVYA 3IUEA 1TEZA 4L2IA 4CQNA 1K97A 1OWPA 4G6ZA 1NUPA 1OWOA 3HV0A 4NX2A 3IUBA 5DEOA 1EFPB 4ZT6A 1PFVA 1TYBE 3FY4A 5LM3A 3ZGZA 3CLSC 1WXIA 3BL5A 1J20A 1KP2A 2DEUA 3PRHA 4K03A 1OWNA 2A7XA 1G8HA 1EJ2A 2YXNA 3PXUA 4KR6A 1YI8A 5TS2A 3HMQA 4YP7A 1I6LA 5LLTA 4QREA 3AL0C 5IHXA 3A04A 5J58A 1ILEA 3PNYA 1GAXA 3MMXA 4YP6A 4A91A 4MW6A 1IVSA 1ZUNA 2D13A 3Q4GA 1KQPA 1Q11A 2A1TS 1VBMA 1EE1A 3H9BA 3K9WA 4CDMA 3LE8A 2AG6A 2XRYA 3KT3A 3RK1A 3DO8A 2IP1A 1EXDA 5AHWA 3TZEA 3MXTA 1EFVB 1JEEA 2JAXA 3FNRA 1KKUA 4MULA 3TS1A 1T6XA 2GM3A 2CYCA 4WNYA 4GU5A 4MW9A 3OTWA 2ZUFA 1I2DA 3TZLA 3IDFA 3AKZA 3IMEA 1JILA 3DV2A 1M8KA 1WXGA 1NI5A 4MVXA 3RJZA 4AS1A 2CV2A 1N2GA 3NV7A 3VU8A 1KR2A 3IOBA 1GTRA 4PBTA 3AFHA 3G59A 3H99A 1VLHA 4MUHA 1M8PA 1TYDE 1JIKA 4F3RA 3UC5A 1N77A 4MUGA 3SEQA 3LOQA 1H1TA 1JHDA 1M83A 2VTBA 4HJXA 1WJGA 3A05A 1KQNA 2OQ2A 1FYDA 3ZUGA 3P0HA 2X3FA 2DUMA 1TFUA 4MVCA 5TGTA 1MBZA 1XNGA 4ZT5A 1OBHA 2CSXA 1ZJWA 1IH8A 4DDMA 4XFJA 3MLAA 1LI7A 3RFFA 2A1UB 1N2HA 2O5RA 1N2OA 1OWMA 4MW0A 3QTBA 3FIUA 2X1MA 4MVWA 1O0CA 3M5WA 1O95D 1G8GA 4EG4A 4YBRA 4MVYA 1T6ZA 3Q12A 1KQOA 1GPMA 1N2BA 3ND5A 4YMIA 1MRZA 1V47A 4U7JA 3U1VA 5BNZA 1T6YA 1QU3A 3IVXA 4RPIA 1QQTA 1O5TA 4WSOA 2X1LA 1R6TA 1N2EA 1N2JA 3ZXIA 3AG5A 4I6JA 1WZ2A 1H3NA 2QUKA 3IVGA 4NAHA 4ND6A 4G5YA 5LFAA 3X1KA 3MLBA 1N2IA 2E18A 1JMVA 1EFPA 1KAMA 3P52A 4ZT2A 1KORA 4EFKA 3INNA 1X6VA 1GLNA 3CR8A 2J5BA 3UMVA 3COZA 1K4MA 3HZRA 1JIIA 3ND7A 4MUKA 1J1ZA 1Q77A 3FH0A 1A8HA 3CLTC 3N2YA 3X1JA 4XFDA 3IH5A 2V0GA 1IQ0A 5DK4A 3COWA 2PFSA 1EUQA 1N3LA 2A1TR 4MW4A 3H97A 3L92A 1PFUA 1ZH0A 1KH3A 3A2KA 4DDHA 5H16A 2JA2A 2WQ6A 2JANA 3DPIA 4ND7A 3LCJA 1M8JA 1QRSA 2Z08A 2EJCA 5DB4A 4HK4A 1EFVA 1SURA 2QUJA 4X0EA 2ZUEA 4MW7A 3JXEA 1TYAE 1R6XA 3AG6A 4PBRA 5IJXA 4EG3A 4FZJA 3FETA 2DERA 1MB2A 3ILVA 4TS1A 1O94C 1M1ZA 4MQ6A 2H29A 1QU2A 1N75A 2WSIA 3CLRC 3ZJUA 1VBNA 1U0BB 2CFOA 2VXOA 1JZQA 2EL7A 3SZGA 3SDBA 3I05A 5K0TA 3SZ3A 3CLUC 1JZSA 1N1DA 1F9AA 1NUTA 4J76A 1Q15A 5H7XA 2B7LA 1QTQA 3FG9A 1XNJA 4QBTA 3Q10A 1F4LA 1KH2A 1WY5A 1COZA 2NSYA 4KPUA 4MW1A 2HMAA 5TEVA 3IODA 4MWDA 3SYTA 1ZH6A 1O0BA 4OJMX 2PXHA 3OP1A 4HPWA 1TYCA 3C8ZA 4AQ7A 3N9IA 2A1UA 4JXZA 1MAUA 1JEDA 5FNZA 3KFLA 3HFJA 4KR7A 4JYZA 1WXHA 3CVVA 1G59A 1YUNA 1BS2A 4EG6A 1U3DA 3E27A 2G36A 2E21A 3RBAA 1N78A 3NBKA 2CV1A 4ZCQA 5EKDA 5J5AA 1J09A 1YULA 1EUYA 2PZAA 2QUHA 3COVA 1HYBA 1OBCA 4XSVA 2O8VA 2A86A 1O96B 2PZ8A 1KAQA 2D54A 1J70A 4MUJA 2QUIA 4MWBA 3PNBA 4ARCA 2GKSA 1TQ8A 3SP1A 3S3TA 3QE4A 2V0CA 2YWCA 3FWKA 1JECA 4R2LA 1JIJA 3FHJA 4H3SA 1WXFA 1WQ4A 2PIDA 2WB2A 3IOCA 3IOEA 1F7UA 4I6EA 1IFXA 1NSYA 1MB9A 1UFVA 4P2BA 4MWCA 5HUJA 1J21A 4R2MA 2CT8A 1NYLA 1P7PA 2XRZA 2QJOA 1YIAA 5KHAA 1FFYA 2A84A 3PNVA 5HG0A 1WXEA 1GZUA 2RD2A 4PBSA 4OUDB 2QJTA 3NBAA 5JBNA 1O97C 5FO0A 2DLCX 2AKEA 4ZCTA 4MUEA 2IELA 2YWBA 1F7VA 3N05A 2DPLA 3AIIA 1NP7A 3HL4A 1H3EA 1R6UA 5KWVA 2J08A 1X8XA 3TQIA 3RHSA 3QTTA 1T9GR 1O6BA 2A4MA 2QTMA 4Q16A 4ZT7A 5FO1A 3N8HA 5DASA 2QTNA 3CLTD 3TQOA 3ELBA 4DDKA 2R5WA 5TEWA 3CLSD 2CV0A 3UY4A 1U7XA 1M8GA 2AZXA 1DNPA 4ZCSA 3UOWA 2DETA 4NATA 3ZJVA 1T9GS 4DJAA 3H9CA 4QRDA 4RUKA 4DE5A 4NZPA 2GOYA 1PFWA 1Y42X 3GUZA 2HZ7A 2E89A 4ZT3A 2C5SA 1Q19A 2BTEA 5HUHA 4U63A 2PZBA 4L2IB 1GN8A 2X0KA 3CVWA 4UZFA 3FOCA 1YIDA 1O94D 1K92A 2BYTA 2I1LA 3CLRD 1U3CA 3IVCA 4U8HA 1MOPA 5K0SA 3ISJA 4ZCRA 4EG8A 1JGTA 3MUEA 1XJQA 3CLUD 2IJGX 3GLVA 4CT0A 1QRTA 2A88A 3P0JA 4JZYA 1K4KA 2ZP1A 1GTSA 3FI0A 2PG3A 3KT8A 1NUQA 4MLPA 4ZCPA 3ZXSA 4MWEA 4S1OA 3COYA 2Z09A 1QRUA 3ZJTA 2QTRA 2YY5A 1M8FA 2DR2A 4BWVA 3CVXA 1H3FA 3GMIA 3ND6A 4KR9A 4PY2A 1KP3A 4E1AA 3X1MA 1LW7A 4J75A 4EF6A 2NZ2A 1PG0A 1O96A 3G5AA 2WQ7A 1I6MA 2RE8A 3A4IA 4I6GA 4MW5A 3VRHA 1MAWA 1NZJA 4JXXA 1LI5A 5KCMA 1IHOA 4G5FA 3D6UA 1NUUA 3G6KA 1VBKA 3IMCA 3D6VA 3VGJA 3F3MA 3ZIUA 4K0RA 3RK0A 4JFAA 1MC1A 4MUIA 4KKVA 5F23A 4KPUB 1IQUA 1ULHA 1WKBA 2D5BA 1VL2A 4MUNA 1PG2A 1XNHA 1B6TA 1NURA 3DLAA 2DXIA 1YUMA 4GRIA 4HJRA 4OUDA 4UZEA 4R0NA 1QJCA 2J07A
chains in the Genus database with same CATH superfamily
5ER6A 1P1BA 3HWSA 1DO0A 1JDUA 3PGMA 3V1LA 2VDPB 3LIPA 4HD8A 4GD3Q 4EG7A 3P9ZA 4KXUA 4MAFA 3E22A 1I1QB 2DUJA 2VYND 3RFVA 2V5VA 3SNHA 3FBTA 4F9FA 3UHOA 4MUFA 4J07A 2G17A 2ENUA 3O8NA 1RBZA 2CJWB 2DTEA 2AUMA 2WNSA 1DAHA 3UK2A 4TT8A 5A62A 1D2GA 3ADOA 1FVFA 1O2DA 4M1EA 4QEDA 4WOJA 4DV0B 1N8TA 1F6DA 1EEXB 4N40A 4BFVA 1FU8A 3V4SA 4K88A 1WG8A 5ALEA 4K6MA 1P7CA 5HTOA 3T4UA 3AF6A 2GGSA 4BQPA 4FMBB 4DVJA 4AS2A 3NCHA 5AI8A 5IXJA 4DR2B 2ST1A 1TJNA 3DLCA 3PC3A 1U81A 1C80A 3K7EA 3IAAA 3UHAA 2HR1A 3I9OA 4ZRNA 2CHQA 3CFAL 1IQRA 3QEJA 1YFJA 1ZFNA 4TLDA 5FPTA 1E9CA 5JO9A 4AQYB 1ORTA 3JQDA 4Q93A 5KINB 1GM5A 3GOQA 4CEHB 4YECA 5CLJA 2E6UX 1LCIA 4P54A 3LVRE 4LOKA 1MP0A 3KT6A 1NXOA 2D6FA 5HM8A 4JR0A 4KBGA 5I9IA 3PDIB 4YV0A 2HXGA 5ITVA 2D62A 4NYIQ 4RF2A 4DLPA 2QX4A 2WD9A 1L5RA 4QYIA 2YTZA 1AKUA 2WTNA 2V7BA 1X80B 5CPFA 3EPKA 2AF3C 1A8SA 3VISA 2ODTX 1SD5A 2JI6A 1RYYA 2QRVB 2P67A 2EFDB 2W70A 2GZ2A 2J9FB 3MYRA 4UNSA 1F8FA 4P82A 4G2NA 4IKEA 4NX2A 1VPWA 5ALWA 1GGJA 2POCA 1Z62A 1L7PA 4FEAA 4ZT6A 1UT5A 4ZOLA 1Q1QA 1IEWA 3NMUF 3V1TC 1HDGO 4E21A 3EBLA 2VUSA 1XGKA 1M6NA 4R05A 3YASA 2CLIB 1L3CA 3Q7RA 4AL4A 4WE3A 4XWWA 3F98A 1UZNA 4W5HA 2YIJA 3QLJA 3NJ4A 1DKPA 4RMGA 3TCXB 5IANA 3KKNA 4JEIA 3ONNA 4TTAA 4ZTBA 2FSHA 4L08A 1JT2A 3NXSA 4P7JA 1QORA 1YA8A 3LI2A 4TUYF 3AOEC 2WKWA 3WAGA 1IJFA 2O7VA 3Q3HA 1ZUNA 4C0HA 3B7WA 3C6MA 1VGVA 1C30B 4FM9A 2PWPA 1I4OA 2W43A 3ELDA 4JBGA 4BN4A 1I0LA 2C9MA 2AZMA 2G40A 2I9PA 2XGGA 4G0NA 4Z5XA 5ER9A 1B26A 4FCVA 2OC9A 4A8JC 4B2IA 1J2YA 1ZN2A 4RBNA 4BGVA 4D56A 4YDQA 4B3DA 1SULA 2PCJA 4MIEA 1OB5A 4GLOA 2IYRA 1EXDA 3TZEA 2H8GA 1FRZA 3WZMA 3EFEA 2ZWPA 4CLHA 4ZU1X 2HLDA 3AJEA 4V1CB 4YLGA 4M3NA 2AW5A 2PLWA 3CNNA 4FNAA 1F2UA 5LQAA 1X0XA 2WMYA 5ELMA 4E7OA 1HZZA 2O20A 2BFFB 2XTAA 5B7GA 3KK0A 1H2WA 1IOLA 5IM5A 4DA8A 1CUUA 4OKSA 5MN6A 1Z2CA 1XTQA 1MORA 4K26A 4HAYA 4D02A 4EI9A 421PA 3T54A 4JBXA 4WH0A 1PGNA 3ETCA 1Z7EA 4XSGA 1M8PA 3LT1A 4OREX 3SM9A 1UC4B 1UDAA 5E8RA 2CB0A 4QGSA 2PH5A 2F1JA 3LOQA 4MEAA 1KK3A 2VOEA 4RY9A 4C7MA 3CGWA 1BZYA 2C1ZA 3ZS8A 3ZUGA 4DB4A 4LQDA 3ND8A 4M7PA 1XJCA 4PRYA 3E0QA 1IOWA 1XIVA 3CUYA 3H04A 1SA0A 1G3IA 3KZNA 2H51A 3ZZ1A 1USVA 4CV1A 2XF8A 3GOHA 3MGGA 3QKWA 4P9NA 4Z4CA 4BB6A 1R5OA 2BY4A 4BMDA 3E23A 5JSFA 4XFJA 2Q1SA 2PA0A 2AJCA 1E3IA 4OHXA 4Q47A 1NW9B 2A59A 5DNAA 4EY5A 2ON6A 4J0HA 4HV4A 3FIUA 2OCLA 3C7CB 4OXXA 2QF7A 2NUTA 5B57C 5JAPA 4LF7B 1R64A 4C9BA 1U8EA 3HJCA 4P6VF 3V4OA 3BMNA 4GUDA 3GLQA 3TQFA 1UODA 2XW6A 4MWOA 5TARA 4C5BA 4KLAA 3RB8A 1XRLA 3D2CA 5UKDA 3DM9B 1LPMA 4RZIA 3ZV4A 1CS0B 4HUJA 2DFKB 3ADDA 3PQ6A 4BVAA 3VKGA 1T6YA 5H70A 1OFUA 3PXGA 2FR8A 4Y0NA 1PWYE 2NUPA 2JH9A 4TV9F 1S7CA 1U11A 3D4NA 1SKQA 2Y6VA 4X6LA 2QPLA 1KZGB 4IEEA 3SHTA 3LVQE 1ONSA 2A9FA 4C22A 1ZHFA 3AI7A 4PSDA 3FNIA 4ZCMA 1CLEA 3GUCA 5JD5A 4F2HA 1CV2A 4NARA 1ESNA 1Y3AA 2BSXA 2ZRFA 3PQ7A 4ND6A 5A9RA 2YXLA 3PUWA 3INYA 2HJSA 4BC1A 3KQSA 1T3GA 1RI3A 3MLBA 4PF1A 4RA6B 3VVMA 1FNSA 2IHVA 3RU9A 5I47A 3TQTA 2UKDA 1Q0UA 2A14A 2LVBA 3M1IA 1OPRA 4DVGA 1JEQB 2QTTA 5CRIA 3MT8A 4UD6A 1H0HA 1LC3A 5CVEA 2G0AA 3UC9A 1LRKA 1TX4B 2ZYIA 4W63A 3WMWA 4BKPA 4EMUA 1JIIA 3O8OA 1CY0A 1OXXK 4GKVA 3T12A 3IUPA 3GFGA 1ZPDA 3LWDA 4C6TB 2C04A 3VR5A 5KJ1A 4XFDA 4XOUA 4AMGA 4B5LA 1FEZA 1R4NA 3AHEA 1Z5ZA 3RODA 1KSHA 2Z5FA 2IYQA 1UBJS 5JCOA 3X3HA 4JBIA 5EMHA 1K98A 4PS0A 3W0LB 2NZVG 2D8MA 3BSFA 3EGCA 5GVRA 1PFUA 2PMEA 3OX2A 2QN9A 1E8NA 3A2MA 4W5JA 4YQEA 3IEVA 1MX1A 2EX4A 1NQXA 5AW6A 1QCDA 3RC9A 1NXVA 3PITA 2C9ZA 5F3DA 3RRBA 3Q88A 1E1CB 2FSUA 2CLLB 3LPNA 1H6AA 1N57A 4R8SA 4QT4A 1B2LA 4PYKA 4HDNA 5K3EA 3FFWA 4F06A 2XUFA 3NHAA 4TLEA 2IHTA 3AGPA 4X66B 1NNSA 4JYMA 1ZVKA 4UOZA 3IJ5A 1TYAE 2CNWD 2HTEA 2VHYA 3BMOB 4G67A 4Z9XA 3RQIA 4RVHA 4TMXA 4N7BA 4OIFA 1Q1GA 1YQUA 5DOVA 2WD8A 4R81A 2P4HX 1MJGA 2JLBA 5E7QA 4DT1A 1EUDA 4ZK2A 2BZGA 2OUKA 5FD8A 4BRUA 1OT5A 2AC7A 3OHPA 1EBFA 2G67A 4L50A 2QTZA 3RD5A 4BX9A 4DMCA 5KNBD 4BP1A 5KTPA 1L5LA 1R6BX 3K5PA 3W5HA 2O2YA 2YV1A 4FQ5A 1J99A 2ID9A 4FLEA 4CTJA 1RCUA 4BNIA 1FYFA 2BEKA 1X77A 3GRRA 2DCUA 3P5BA 4HVTA 5E95A 2H5JA 3HDQA 3OTHA 5D2CA 4JY7A 3RC3A 3TJZA 2UUOA 1IHUA 3R09A 3KTAA 3S2SA 3G79A 2I4NA 4N5MA 1EM6A 3RUHA 2YBDA 1XR3A 2XOXA 1C8BA 2F7SA 4RK1A 1H6BA 1H2ZA 2PJDA 3MWJA 4KG7A 4LE2A 5G41A 3REQA 2ZJ3A 3ISVA 3GLHE 4GICA 1I9CA 4IJMA 1J0CA 2NTYC 1KHTA 3EGXB 2BM1A 3LBFA 4MWDA 2ERYA 1A4UA 2CFRA 2GCGA 3KPYA 4IVPA 4LUCA 3FZQA 4EPXA 3R7AA 3SD7A 4H7IA 2DQZA 2BCJQ 4EPYA 2IEZA 1ZN7A 5G1PA 1Y1LA 2DUUA 4Y6SA 1F14A 1JHYA 4BVLA 3N9IA 1VPDA 3AIMA 1YMQA 3I4FA 2YW9A 4JN6B 2OXIA 2PVCA 3R5KA 4IFTA 3SICE 1DADA 4YJFA 4E0BA 1JEOA 4MMZB 4ODIA 4C7VA 4WK2B 2CJWA 4EEZA 2X41A 1GNQA 1XLTC 2GEUA 3HJRA 1G8MA 1RKXA 1V41E 4DOMA 2IBMA 5FT9A 3FNGA 1IBLB 3U5ZB 3UAGA 2Z2YA 5DBHX 3UXMA 5J5AA 2F17A 3ASYA 2WTUA 1F6BA 3H1GA 4F21A 5JAMA 4XSVA 1CRQA 2OT3B 5TF4A 2XKBA 4KO8A 3G0HA 4AIIA 2HQBA 4IZHA 4IOMA 1TO2E 4BVEA 3GZNA 2FX2A 1WU8A 2AFIB 4HEJA 1IMOA 4DFDA 5MFPA 8OHMA 1WXWA 4KFCA 4F2DA 3R0JA 2GPNA 2ZIAA 1TLLA 2XWJI 1FNNA 4HO1X 1SC6A 4UXIA 3OUZA 4M8LA 2OFPA 3P0RA 5AIBA 3IOCA 2BM9A 4UMFA 3UFXA 1WB4A 2UAGA 2PZGA 1A0OA 1CIPA 3OX3A 5ADUS 3HBFA 3EZNA 5DBIA 1RQ7A 3FRJA 3A9RA 1NJ8A 3C3PA 3UO8B 1DG9A 2IYVA 3DXYA 3EFHA 4GYWA 4P0TA 2JGAA 2P2CA 3B3QA 5HG0A 5NULA 3MTQA 1RJGA 3LX6A 4QARA 5FWYB 3ZJYA 4LYAA 3GLIB 4YWHA 3CIFA 4WVLA 1SY7A 3A26A 3LF1A 5HHTA 2OEPA 3NAMA 3HRHA 4L9RA 4RSMA 1XVVA 1XZHA 4RJ2A 2BHLA 4GBJA 1TMGE 1NWHA 2GR9A 2Q6VA 3LYHA 1E6UA 2FYTA 3RAGA 4HGOA 3RTEA 4R1TA 3ZNQA 3GUVA 1PJBA 1FFAA 4BB9A 1V7PC 3VQTA 4PZDA 1XRQA 2VSFA 3ANNA 1S8AA 2MMCA 3NASA 2RIPA 3RYIB 2VQFB 5A4DA 1WUIS 3A6LA 2PZEA 1BX1A 2WKPA 1ZEJA 3CXUA 2A9JA 2IZOA 3EZLA 3NUZA 1XF1A 4TMWA 3H5TA 3C5CA 1RTTA 1N4DA 4AP6A 2JA1A 3HWX1 1N2SA 1RYMA 4LXIA 2X5KO 3GHYA 3E6AA 1WUJS 2IA5A 4C4YA 2PPVA 5EFOA 3N8HA 3JQ8B 2EEPA 3OD5A 1AQYA 2FSFA 4NJEA 1T4MA 4RFSA 2WWYA 2COUA 1GL7A 2J7KA 2HU8A 3PUZA 4R2JA 4RFLA 5ALGA 1U7HA 1N0WA 1QR2A 1Z6XA 3M8KA 1QCZA 1S2NA 3G2NA 1VI6A 3BM5A 2WU3A 2C4NA 4DEXA 1MU0A 1L7OA 3EBPA 1FP6A 3WGVA 1SQ0A 1VYUA 1MAAA 3OLYA 4P7FA 5L3SB 1JDJA 2HFJA 3ZUPA 2G5TA 4XWTA 3FKJA 1U7UA 4FFVA 1SBQA 1NNUA 4UATA 5EE1A 1RWWA 3KXPA 4MQLA 5AOAA 3GUZA 4JV5B 1XQYA 2E89A 4ARAA 3HGQA 1C1DB 4BPRA 3BWDD 1XA0A 5A2QA 3D2AA 3SQWA 1AQUA 3PJDA 4WJKB 3CXRA 5ALLA 4MTCA 4LOHA 3DO6A 2HSDA 3GAMA 2I62A 4N5HX 4ND8A 1BFUA 2VHUA 4UCXA 3TFQA 2BTQA 4AO8A 4DIOA 4XLZA 5JRJA 1DGQA 2UYCA 1I7SB 2RMKA 4RVCA 5LZ9A 4DSAA 1U8YA 5JWOA 4IJWA 3ISJA 1YJ8A 1YRLA 3VPDA 2IIVA 4GMGA 2J5XA 4YJ2F 4DCJA 2VDOB 2Q7XA 4MRNA 4CWAA 5EYPA 4YC7A 3ROPA 1RKUA 4Z7NB 3SSOA 5F2NA 3PRJA 3EXHC 3GLGB 1QAQA 3R9XA 3FSEA 1J5XA 1RLOA 1WDKA 3C7AA 1P74A 3VZRA 1LFDB 1CJMA 4MWEA 5E9JA 4LV8B 2H59A 1R6DA 4PZPA 1M8FA 1Q92A 3DOHA 3QVGB 5ULLA 2P4UA 1VL1A 1JDTA 3LTNC 2XOEA 2WIDA 1IWBB 2CK3A 4XD7A 3E9DA 3A4IA 4UOEA 5KNLA 4DILA 5DCUA 3RIMA 2E4WA 2W6JA 1SG9A 4JQZA 2O5EA 4IZIA 1GLGA 1Z35A 2HNBA 2XNSA 2OY0A 4CMGA 1D6SA 5JNRA 1YE8A 5EXSA 1N5JA 5ARCA 2QQEA 1WX1A 1X15A 4YAWA 4EK9A 1MZVA 5I8ZA 4HNVA 2AN9A 3OTQA 2UZ3A 5BR8B 3R3YA 5F4BA 4J2TA 1FA9A 1SK8A 3ZIUA 2VK4A 1UJBA 2OHHA 3ETHA 1YCDA 3H4TA 4G1VA 5GGYA 3UVEA 5A4MS 3IQFA 2QMYA 4KPUB 1UAAA 4CCWA 3VXKA 3ZZMA 2QP3A 4A8JB 1L5WA 1W88B 2V96A 4IWXA 3P19A 5K3FB 3KSBC 3W9SA 4AY4A 2R8ZA 1KMCA 3FOBA 3VX3A 3X43A 1R0WA 3F6YA 1E3LA 4L9AA 4GRIA 1FSPA 4M9ZA 3LQ2A 5H3CA 4JI5B 1MZPA 4WFIA 2Y1EA 4BBZA 4RA6A 3IUSA 3DD1A 4BQIA 1R0CA 4KZPA 2PCLA 1ISPA 4F92B 1RWOA 2ZUTA 3UJDA 2HXYA 4J9UE 1QNFA 4WFKA 3WIUA 2FLKA 5DTJA 4OP2A 3PQ5A 4I4LA 5BOSA 3GJ5A 4HAXA 3PFBA 4M9QA 4DV5B 1ZMRA 1YQWA 2PH1A 1GO2A 3L6RA 1AS2A 3R2JA 2XUQA 4KUHA 4NP6A 3LLCA 3ORFA 4HRYA 5CX1B 1EDDA 2ZYHA 3TMAA 1XN1A 4XGRA 4GLBA 2VN8A 5FPPA 5CG2A 2IS2A 1GCGA 2FPOA 3SQMA 3NQ41 5LA6B 2R6HA 3VZDA 5CVTA 4R1MA 4BY9E 4C6TA 3R75A 2PUDA 3T3GA 1YZFA 5A9TA 4U4AA 3R0ZA 4MJ3A 4YP5A 3C8HA 3RS7A 1D04A 1YH3A 2EG9A 4URXR 1B23P 2D2XA 2JJMA 2OLJA 2EKDA 1E6WA 3IEUA 2AI3A 2AV6A 1Y48E 4P4LA 1Z6YA 4MZDA 1BE8A 4FIDA 3LT2A 4A26A 2FG5A 3IB3A 4PCUA 5C7OO 9LDTA 3BXFA 3ESQA 4EENA 1RXWA 1F0KA 1KZ7B 1VKNA 3WLOA 1L4UA 5B5SA 4KRYA 2G16A 1W8IA 5BUQA 4CKBB 5DN6A 2XITA 4F7DA 3JASB 1UBEA 2WC1A 1NOJA 4KMRA 3EXG1 2WE8A 5KAMA 4EHFA 2H9IA 3O1JC 1YF3A 3R40A 2QUAA 1EJ0A 1PJAA 4RD6A 1B1CA 1I1OA 2B0JA 1SG6A 1X1EA 3E3LA 4F46A 1QIKA 1ND6A 1W49A 3DV0B 3OPNA 3RUIA 4E33A 4FUTA 4BNDB 1T9BA 3L7LA 4MKHA 1RRVA 3LM8A 3UW3A 3VKWA 5AJTA 1Y6QA 3G17A 5U1PA 4I50B 2A30A 4Z4QA 1QJ4A 2HDWA 2X9LA 4JBNA 4TZTA 1B6SA 1P33A 4QOSA 1P6XA 1HK7A 2OM6A 3HEMA 1W4ZA 5DGIA 4CPDA 2C4TA 2DUWA 3WNCA 1IQPA 4DJEC 3OP4A 4C4SA 1NI4A 3D0OA 2X5OA 4NS1A 2R97A 2VWHA 3IPCA 3N2GB 4JVSB 2NV0A 3V4PB 3UBTA 1WL8A 1I6LA 1B0AA 3D0QA 3NHWA 3U7IA 1SHJA 1UC9A 4I4CA 3IKMB 2JFPA 5AXBA 4PNEA 4RTQA 2D2FA 5CDSA 1H0KA 4EZIA 2HBYA 5J58A 1ILEA 1M5RA 1N6LA 3NKLA 3IILA 3ZGNA 5LIPA 1JHPA 3CNLA 4AD8A 1M7HA 2VJYA 4OXYA 3TNYA 1RRMA 1QDEA 3CKKA 4K6OA 2GUWA 3Q7QA 2VWQA 3E7WA 3LE8A 2Y93A 2WVGA 3H6GA 4HLUA 1VJDA 2ZRPA 5HJEA 2AQIA 5DIFA 2Q49A 3D6MA 4HAWA 1QIMA 3H5VA 4OP1A 1ZGCA 2ZYUX 1GARA 3Q7IA 2I2FA 3I9V1 2WJZB 2R8PA 3FNRA 3BSYA 1HDYA 2YZKA 2O2HA 3BGOS 3L9WA 4Y9SA 4AKSA 1P7YA 3L43A 5T4BA 5TV2A 4HGNA 1QH1B 2JI7A 1EP9A 5DHAA 4XPIB 1BS1A 2Q0SA 4AY5A 4BRZA 3OCUA 1UBTS 1KEWA 4F3KA 1T8PA 2H85A 3T94A 2X15A 1HH4A 4ZANA 4ZI5A 1F7VA 1D8AA 2WF8A 3GLFE 3MSXA 3TDMA 1F1JA 1GILA 3TFWA 1EZ1A 4BNWA 4Z49A 1NI5A 1DQNA 1PJSA 3E2IA 4FFDA 3BMQB 4AJLA 1VLQA 5F7ZA 2O14A 1RWKA 1Y81A 1EZ4A 1LH0A 3H5AA 3O0TA 2J4FA 2X0IA 3CEPB 1G9XA 1LK5A 1MJFA 1DQSA 4BO0A 4KRFA 2QN3A 1JHOA 1ESCA 2GPBA 4LZPA 1X0VA 1TJ4A 5FNVA 1D2EA 2PY6A 1PHPA 1KOJA 3UC5A 4OCZA 1CDEA 3QXXA 4TV8F 3VU1A 1JHDA 4PTYA 1NN5A 1Q22A 3LP6A 4XTRA 3GJQA 3LJKA 4ALLA 2GH1A 5EL0A 1FYDA 2QRLA 4KN8A 4DLKA 4DMGA 4ESEA 3O94A 3R6TA 2X3FA 2EF1A 4B8ZA 4ECAA 4KO2S 1YZNA 2I52A 3BK2A 2P8JA 1V8DA 1Y3DE 1ZM3A 3EQ8A 5AIAA 4CV0A 2QM3A 1YCGA 4ILEA 1K2WA 4LW8A 1VLLA 2BGTA 4QJ5A 1P44A 1C4WA 1JR3E 2P0EA 4Z6KA 2WPNA 1C9DB 3IP7A 3PA8A 3KKKA 4MS1B 4UHKA 4F4IA 4C0XA 5JAUA 1X8LA 4DLVA 1S1CA 2ZLBA 5EJAA 1HETA 2CL7X 4V3BA 1PIWA 4ZCIA 2FUKA 2NQ2C 5F78A 1SIUA 1TB4A 5K5EA 1X1CA 4R51A 4P98A 3IAUA 4INAA 1VL8A 3ZHBA 4DQDA 4DUGD 2J33A 2PKWA 2CBGA 1A8QA 1TEHA 2GO1A 3KBOA 3KG2A 1L9XA 1V5GA 4YMIA 2ADFA 5FWDA 2AVNA 2BLLA 4ALMA 2RGXA 3IVXA 5HM6A 4BB0A 3QXGA 4NK4A 3QTLA 3HCAA 2XUPA 3EB9A 3ENQA 1JQBA 3KPWA 4WI1A 5THQA 3HXOA 2N0SA 3HB4X 2LIVA 1A2BA 3NHPA 4TZ0A 4GDMA 1DAOA 4FVTA 3KOZA 1NP3A 2WWTA 1AMUA 4J3NA 3IA2A 5K8VA 4N49A 3OM8A 4QULA 1BX3A 1EDEA 3D81A 2JGJA 4L5AA 4LWQA 1BWQA 4R8LA 3JV7A 1XMPA 3PLNA 4GMXA 3HUUA 1TAGA 1W1IA 1TADA 2FR0A 3C45A 4MYDA 1HFKA 5GM1A 1SAYA 3PE3A 1MNAA 3NBYC 3JWGA 1YJCA 4H7KA 4HDMB 1Y0BA 4O4LF 3OSZA 3ISTA 4MCHA 1U0JA 1ISRA 4GI5A 4JAVC 3TRHA 1OI4A 3G1UA 2MSDB 1J0AA 3ZOKA 2LP4Y 4A8HA 3WGQA 5K6TA 1YGYA 2YYYA 4JYCA 4CHGA 4FMDB 4GSKA 2RAVA 5A05A 3W6UA 4UBNA 2OLEA 2FPUA 5BPHA 3GUYA 3A1DA 2P7HA 3B20A 3EXIA 4L4ZA 1G8YA 4D4KA 3QV1A 4E14A 5IM4F 4BNXA 2XSZD 2B94A 4B6RA 4BX2A 2FUG6 1HFWA 3STVA 4BAZA 2O8EA 5BSHA 4CIWA 1MQAA 1PEYA 3H1FA 1SM4A 4ALNA 1DOAA 1ACJA 1YZQA 2L82A 2ZRJA 4NZMA 3N53A 4K8RB 4YFVA 1FLDA 2IZ7A 5AJZA 4NULA 1SURA 3Q3EA 4PAQA 4B6PA 4FCTA 3E81A 2VF8A 3EDQA 2UVPA 3FRHA 3R1IA 4RD4A 4D4JA 4FD2A 1FFHA 1XTBA 3KOOA 1DKNA 3ENWA 2WSYB 2UZ4A 4TS1A 4GSLA 3TQHA 4YA6A 1F0NA 3CWQA 3FSGD 3PQ8A 3KXDA 2C4UA 2FWMX 3DR5A 1MV8A 4FIZA 4N5NA 4NMMA 3UB4A 2ZANA 2D7JA 4MQEB 1JG6A 3IT1A 5EIAA 2L2QA 4QYXA 5BYJA 1JA1A 3UMYA 3AYZB 1C3VA 1YK1A 4M9SA 1WZIA 3DVRX 4Q4JA 1ZRHA 2OORA 1G7RA 4RK4A 1MV5A 5K2MA 4QKQA 4QOEA 5DRYA 3K0AA 4P33A 4YCSA 2WOJA 2W0SA 4D3FA 4B7ZA 1Q1AA 3FLBA 5IBQA 3UOAB 4QVKA 1QX3A 4IDPA 2C2MA 2FMIA 4AKHA 4LHZA 4NG4A 3OZGA 4QBTA 2REBA 4KPUA 2FFJA 4Y2XA 2GEJA 5DU2A 1PTJA 4IVRA 1LPOA 4C4RA 1Z63A 5G0SA 5K3FA 1SC4A 3HBAA 5GZ6A 3AR4A 1JR4A 4HAOA 1NVVQ 1Q50A 3G7SA 3AKYA 4EF4A 3FHCB 3KEMA 2BE9A 3H6KA 3W5VA 1TVKB 2C03A 1C3XA 4GRDA 4Q3OA 4IOJA 2ES4A 4P83A 3QX8A 1MAUA 1IG3A 1VP9A 3E5NA 3HXKA 2VDNB 1V16A 3HP4A 2B4AA 5F7OA 4ZWNA 1J07A 2JIOA 4GAEA 1EK6A 4L8VA 3L6BA 3OPYI 4D9IA 1VCOA 3KR1A 3ZCUA 4KL8S 4EG6A 5CG1A 5CX1A 1VJ0A 1N5DA 2W6PA 5DIZA 3FGPA 3DBLB 1LXCA 1K68A 2CV1A 2PUCA 2WSLA 2Y9PB 2XNDD 4Z8XA 5FA5A 4DWJA 2NYAA 4HNHA 3KB8A 4IH9A 4FI3F 1HYBA 4IS2A 4JSTA 4MXDA 2PZ8A 1OHHD 1R1DA 1UBMS 4M9RA 5AXCA 3THOA 1XZPA 4IFIA 1X14A 4UUBA 1WPGA 4KX3A 3EXHB 1E1QA 3U3OA 2WWRA 3SP1A 1OZFA 3U5TA 2CUTA 5FBZA 5HYVA 4X1IB 4B3GA 2GPJA 4TT3A 3JR7A 4R2LA 1WD7A 1JIJA 1VZ2A 4HDAA 1L0BA 1SIOA 4DAOA 2XGSA 1SEPA 3CRW1 3DEJA 1R66A 1CR1A 2C8JA 3AKEA 5K0NA 2YRFA 3D59A 1OYYA 3WVNA 3KZOA 3LX5A 4BCBA 3U60B 1R0BA 4RKRA 2KPOA 1Y5LA 4TXHA 4BC0A 4CM5A 3T3OA 1ZM9A 4Y2HA 1JU4A 3E1GA 1GKKA 1NXQA 3RKUA 2Q46A 3H1PA 4F56A 5A4JA 2P3QA 3FAKA 4BUZA 5ERYA 4CF4A 4N12A 4BGDA 2VNIA 1MDBA 4Q3DA 4TPKA 2EZ8A 1EWRA 1P4HA 1ZXBA 1L5SA 2ZIZA 4UHBA 1NW4A 1VL0A 1Z56C 1OZGA 4E70A 1PO7A 2Y0BA 3MUOA 1BFDA 2O5VA 3C3KA 3QF4B 3BT7A 3KKZA 1XZLA 4ZAFA 3J80A 1XXHB 1ZC3A 1GY8A 1KI7A 4DGQA 3S8YA 2Z3WA 1ADYA 1HMYA 1WUKS 3C5HA 3QX3A 5JJLA 4TVSA 1KI4A 4N0DA 1G5FA 5KWVA 3OFSA 4QG7A 5DKFA 1NVMB 3B82A 1KEPA 3ZCSA 2VT6A 4G0OA 3JTEA 4RC9A 1W5EA 3BTUA 4WJLA 3WMGA 4D4LA 4MWTA 3QTTA 4KEAA 5JDIC 1XO1A 5BN5B 3N2EA 5K4HA 4Q16A 3A6KA 2I1VB 4IEIA 4KBFA 2XUJA 3HCEA 3PPWA 5CK5A 3ZTYA 3BK1A 2ATEA 4BP9A 1YO6A 1OLSA 3CLSD 3K1ZA 5EAIA 4AP9A 4JJ6A 2XUZA 3KKLA 1QYDA 1JHQA 4AX4A 4XXHA 5F12A 4KN5A 5E4FA 5C7LO 3DMRA 4JIGA 2FWAA 3W3AA 2AS0A 4NATA 4UM5A 3HN7A 4CG2A 2AB0A 1YGPA 4X8OA 3P9KA 2WG1A 2H1OA 1QH1A 1SFRA 4XPIA 1R4AA 3CF4G 1E9SA 3UJ9A 4ZJZA 1I14A 4GC9A 2FUNB 5EGSA 3WP1B 1UJ5A 1J8QA 2IGTA 4EI8A 1E7RA 4KC0A 1INLA 3OQMA 1IXKA 2X4GA 4F12A 1ORRA 2HMSA 5ESXA 3ROGA 3W7AA 4UZFA 3OCVA 1V8ZA 2HLNA 5C8ZA 3F4LA 2ZEJA 3U81A 1VSTA 3OETA 5FI3A 4CKEB 5D00A 2WTAA 2ZRGA 4KQ6A 3OEHA 2ZB8A 4R1OA 1T43A 4BB5A 2B25A 4HEHA 5KMGA 3AVTA 4RWZA 2YWHA 5DEIA 1P4GA 2EJVA 4BNHA 2HD4A 1DU4A 2VP5A 3EQ9A 4R3NA 4F6RB 1IZ9A 2D00A 5CLGA 1ZA1A 2CD9A 3WMRA 4OKNA 2WU0A 3T5DA 1STOA 3IE2A 3G9ZA 2GB4A 1E3WB 1RXUA 2H06A 3I73A 3T4EA 4TMZA 2JIQA 4H27A 3AF1A 5AVXA 2AR7A 4REMA 4YXWD 1DAEA 1OIXA 3ZHOA 5LU9A 5A0FA 1PBTA 2JLUA 1T4CA 2DR2A 4CL3A 1S2MA 2FEKA 5LPNA 2YRXA 3PHGA 4F45A 4IIFA 1KXZA 1RSZA 1D6JA 3PDUA 4MQBA 2GS9A 5T4EA 4F60A 1NJSA 1NMQA 3G2MA 3FX2A 5F9FA 2BZ1A 4EF6A 2IEAA 3MCTA 1UT8A 3R0QA 4LJ4A 4OK6A 1MHPA 3ZGYA 2HT6A 3GQVA 5K8LA 4GPTA 1SXHA 2B1RA 2G4VA 4TWIA 4LDZA 3MEQA 2AFIE 4HSEA 4JXXA 1ZD4A 4DKJA 4IZOA 2F3UA 3OCYA 1SUIA 1XI2A 5ABPA 3FF4A 3VSAA 3F74A 3K72B 3KZKA 2BTOA 3K1TA 3T7DA 4Y2GA 4QEKA 2FX5A 2I91A 2JHFA 4G8JA 4OF4A 1PL0A 1Z28A 4LRYA 4OH7A 4N7RA 1YJXA 5FUQA 3AUTA 1ZITA 3JD0A 5F23A 3U61B 1BO6A 3M9XA 3VR0A 3L4JA 4QJ4A 4ZA2A 2WU1A 2B1GA 4FEGA 4PICA 2PUHA 4X41A 2ETVA 2PRIA 5GADl 3CN9A 3JWHA 3D8RA 2QVCA 4N76A 1HRDA 5I3ZA 1GU1A 3MWKA 5G4KA 4OUDA 5K0JA 2HRBA 2ZTLA 2I71A 4KV9A 4A8TA 3GLIE 1NM5C 1P61B 2EW8A 5JH7F 4V0SA 5E6RA 521PA 1SOUA 1V1JA 1EHIA 1PT8A 5KSZA 3RAEC 4IXMA 2CXXA 2VF5X 3OLWA 3R3JA 5J4KA 2QLFA 1RD4A 4MS3B 5J2UA 1QE5A 2CNNA 2HQOA 1PR6A 5BUSA 4DRXB 3LWNA 1DRVA 2A5YB 3VO1A 1MXHA 4GMHA 4PG4A 1P0IA 4MVJI 3VZPA 2QTHA 5DTQA 1A96A 2WJYA 1XDWA 1YI0A 3BHMA 5E7MA 1PFYA 1NTRA 2OL4A 2XIJA 4BFYA 3SXUB 2DECA 4JI4B 5EIEA 2YJ3A 4E12A 3VI4B 1I2ZA 3H87A 2X23A 4MUMA 4N65A 3EVAA 1X7ZA 3MRTA 4LJLA 2QJFA 2CLFB 2O2SA 2WOOA 7ADHA 1N3BA 4LHYA 1Z39A 2Y1KA 3BERA 1P1HA 1YDHA 1E4OA 2CHVA 4A5SA 1GT91 3G0OA 4DLAA 2XZOA 5F9HA 3UT5B 4U7HA 1PP4A 2QRNA 5IJWA 1Y8QA 2HSGA 4EGAA 1YSCA 2R44A 3OJ0A 1USIA 5FI0B 5JZMA 3WO0A 2ZBRA 3IXMA 1YDWA 4KACA 3VHXA 3JQRA 4F4HA 2F8SA 1QCYA 3P20A 1GA1A 3WY9A 3W8DA 2IRWA 2DFPA 4JGBA 1VM6A 2P9JA 4KSYA 3CX6A 3H84A 3HMKA 4UBJA 4Y1EA 2ZJBA 1S8OA 2FEOA 2VJBA 3JATA 2R6CA 1QCCA 5DO9A 4EY7A 4H1TA 2RGCA 3DTTA 2HA0A 2GILA 2OV8A 3HB1A 1US8B 1XLVA 3IUEA 3PTLA 4L2IA 4K7JA 2AKYA 4M0CA 4O4HF 5EQTA 3VO8A 1EINA 3KCNA 4C0AC 3ETNA 4E5DA 1XSEA 3F9IA 4CQLB 1Z13A 2OO7A 5JSUA 1J0EA 3GAAA 3UMMA 4MVJD 3TCNA 1R12A 2QAGC 2V65A 4MQEA 1QP7A 2JK1A 2WV7A 3E05A 1ONPA 1NN3A 3BL8A 3FGOA 5F3RA 5I9LA 4AJ2A 3OY7A 3WA6A 4UM9B 5DRTA 1BA3A 2AK3A 2A92A 3KOUA 2BVNA 4Z9YA 2YXNA 1RYDA 3PXUA 3MHTA 2E82A 4L0QA 3U3JA 3TSAA 4JEHA 2XBMA 2Z8XA 4C6HA 4R1QA 1KBZA 3GLGE 1XOIA 1OTXA 2QEQA 3EK2A 4M0MA 5GGXA 4AJNA 4N6GA 4P93A 4DNFA 4AJJA 1PW7A 1SO8A 3T06B 1XMQB 1GAXA 4B76A 2IYXA 1B6RA 1Z6AA 3RRYA 3S0JA 2EHJA 1CQIA 2WWFA 2QW0X 4IDEA 4D99A 3PL5A 4BQRA 2EGGA 3S5JA 3FCYA 4C0BA 2E5WA 2RCYA 3PQCA 3R7FA 1ZGGA 3GJ4A 1WCV1 4ERXA 2WUGA 1Y5RA 4B3FX 3LPDA 3PHLA 1QPGA 1ZR2A 2CGEA 1REQA 4EG0A 4EJ0A 4ITVA 2GEBA 1KZHA 2E4VA 3VZBA 4ZYZA 4G4SP 1WSAA 2X77A 1DSSG 5LR6A 1T4BA 5B7NA 1ATZA 2CYCA 3DBLA 5FLKA 2R11A 2YZ7A 5I4KA 1FMFA 1VA4A 2ID7A 5AM4A 1FYEA 3AUSA 3V1UA 1E7MA 1OLXB 1RWXA 2VPXA 2VZEA 3BCSA 3NM4A 3PDHA 1T2EA 1C5KA 4HB0A 2Z58A 1Y33E 4W1SA 1QONA 1VRVA 3T34A 1XKTA 1NRIA 3GEHA 2A9PA 2O5CA 1QE0A 2EQ5A 2B98A 3BKWA 2ASVA 3DTVB 3SLKA 3IOBA 1MO4A 4ZI3A 3FDJA 3V2HA 3DE0X 2WHPA 4FYXA 4G81A 2GN9A 3MC1A 1EGAA 1XQ6A 4DLZA 1WVGA 3KB6A 4HH3C 3QLVA 1Y7PA 4AG3A 3HCFA 2A9KA 4TSFA 4HMQA 3G8DA 2P9ZA 1MEEA 2ZI9A 4YREA 2AQ8A 2OQIA 1AKYA 2C96A 4MPDA 1N9GA 4O4JA 3RDPA 3UUGA 4MA5A 5I8WA 1E3MA 2OP1A 3AY6A 1Z74A 2FRDC 4DC0A 1H42A 2WKQA 3Q7PA 3TTUA 4JSRA 5AESA 1KKLA 2PMFA 3VTKA 2PUFA 1E0SA 1W0KD 3V4LA 2XGMA 5AUNB 3PF9A 4KGVA 4A0FA 1JRLA 1IMJA 3A9WA 3A6DA 4GGOA 1F2VA 4AN4A 2ZIVB 4IDNA 3NETA 3A0RB 2Q07A 5JHHB 4C43A 1Z5OA 2PQ6A 4ZQCB 3Q8MA 2A1UB 3I2GA 2O0LA 2D5AA 1C7EA 1UK8A 2DMRA 1WCXA 4JJ4A 5AKXA 3TAHA 1E5LA 3DNMA 4JC4A 4ZYTA 5AQEA 3OO1A 5I7AA 1CY4A 1XXHA 3E18A 1Q1NA 3SYNA 4EO7A 4RU1A 4RTNA 2RK3A 1GR1A 4LTMA 4OG2A 3OZ7A 4LXHA 3RHTA 3DYBA 1BS9A 5FKJA 4FK8A 4BASA 3G49A 4V0LA 4XE5A 4NJMB 4RA9B 4TQGA 3U7HB 3GRUA 4UAUA 3V00A 4U7JA 3AW9A 5DLYA 1DLIA 5BNZA 2V7QD 3RCBA 5D86A 4EHKA 2HK7A 2D0OB 1K88A 5DSZA 3WTCA 1E4VA 4FFRA 3PGVA 4L5IA 2X1HA 2Q3CA 2CW5A 3OOWA 3ZLJA 4IWYA 1D1QA 4KSBA 1W29A 2QY9A 4GVXA 3V4VB 5M04A 3HXLA 3A4NA 1QPZA 1DC3A 1EH5A 1OXVA 4BJ3A 5JNLA 1EFAA 3QM1A 2Q5JA 3ZDEA 2RARA 5BMVB 3WYDA 1WEKA 4ZT2A 1LX6A 1JF8A 1E4EA 4OB8A 2Q5FA 3KJGA 1OB2A 1KPHA 3PC2A 3COZA 2GK3A 1Y1TA 2ZBUA 2F8MA 4M0KA 2G80A 5GY7A 1W46A 1AV6A 5AJHA 2NYVA 3ND7A 1NLMA 3U3KA 2EGUA 4W8OA 5IRCD 2QN6A 3Q15C 5IUJC 1N1EA 4DDWA 3O95A 3G6WA 4B33A 1A8HA 2FPLA 3N2YA 1DRUA 4R01A 2AMLA 3PA6A 2C5LA 4FNMA 1IQ0A 4CGZA 3HJFA 2GAFA 3EXFA 1TECE 2OCPA 2WTEA 4UVEA 4AFNA 4LFAB 3H97A 3L92A 2AJBA 4A8PA 1O87A 5IVPA 1TYEB 3ZE6A 4INJA 3ENNA 1W52X 4KAJA 2I65A 4QYMA 4CQMD 4DUZB 1NIJA 1QVVA 2YJ4A 3BGWA 3OFJA 1ZUD1 1BVYF 2HA2A 4K9DA 4CM1A 5BRJA 3G8AA 5HBGA 1GUDA 3W5UA 5LOVF 5LXTB 2EG5A 2VZ0A 3TW8A 4CM9A 5AKLA 1ZRSA 1Z4JA 1VHQA 1R74A 2ZU6A 2JGDA 3WGKA 2XODA 3TLZA 2I7DA 5C8DA 4Q9LA 4YR7A 4I14A 4ZQFA 3IBCA 4PYIA 3KDSE 4M9CA 5EXXA 3ESZA 5ALIA 2LWIA 3O9MA 4GE0A 4IHJF 3FTCA 2GERA 2XHZA 5F4ZA 5T8KC 2FSVC 1ZK3A 2OKGA 3ESAA 3AESA 5IBPA 3T7RA 1QIGA 3GGSA 1OI7A 2GZ3A 2JIBA 3VPAA 3ZGZA 2EYQA 1G0NA 1A97A 3DP7A 1C14A 3VR4H 1D4FA 1JDBC 2FG7C 2Q9AA 3I6MA 3H7AA 3JZIA 3CLUC 4KXXA 3BFVA 3NNDA 3I9KA 2N9UA 3AR7A 4WKGA 3WC4A 4E3WA 4FBMA 2BMEA 3EVZA 1NR1A 3NKVA 4LJ9A 4D9NA 4X3PA 1Q15A 5H0IA 3W5SA 1DX4A 1O1YA 1QIEA 3WSVA 2CDAA 4DGSA 4JJ7A 1F4LA 1KH2A 1K6XA 2W98A 1UKCA 3D4PA 3ESRA 3F5QA 2OAGA 2Q28A 2VR1A 3MJSA 3TGLA 4LXGA 4R1NA 4AWBA 1QBGA 4X92A 3ZD7A 1NJFA 4OJMX 2H92A 3NRJA 1JWBB 3DM5A 1E1MA 1GTZA 1U9YA 4CIAA 3UJCA 3KAJA 2AZDA 3MJVA 3R0IA 5KTMA 5IU6A 1V7ZA 1LLUA 3MOIA 4L8LA 5JLAA 4UFNA 1S2DA 2F3PA 1GQYA 4JYZA 7MHTA 1WXHA 5ALMA 4BU0A 3PVCA 3N8NA 3E7FA 4BMOB 5JECA 3ADKA 3CLHA 4RV9A 1ZVVA 4F2PA 4HN4B 5MN4A 1QO0A 1QIIA 1SNYA 3PX3A 3KX2A 1JMYA 4WK0B 1LRLA 2ZTHA 1MX9A 1ORWA 3EGOA 4K3VA 4EH1A 2XR1A 4BGEA 3KP1A 1X7YB 2WPDD 2YASA 3CSSA 3IKLA 2PZAA 4CJXA 5L4LA 4OHZA 2RBGA 2VHWA 1JG2A 4EITA 1I0ZA 1P0PA 1J70A 1HYEA 3ICEA 3K9NA 4LJSA 4JI0B 5C4GB 3IXLA 1GNPA 4KQEA 4NCKA 5D1NA 3WLHA 3ZEAA 2EL9A 2MYPA 2AN5A 4R9SA 3NU1A 2C4KA 3F4KA 1JSZA 2AX3A 721PA 2PMBA 3BULA 4RADA 1CNEA 3UT5A 3AR3A 3DONA 1R4MB 4Q1CA 4A10A 4H3SA 5TLSA 3CYFA 1RBYA 3NWOA 2PIDA 4DNQA 3KETA 5JAOA 1NUHA 1GZ7A 2QLNA 3B5EA 1UXKA 2ZQYA 2OBBA 2P65A 1OC2A 3I37X 4FD3A 4RABA 1ADBA 1RZRA 5TQ0A 2BWJA 1GGMA 1K5DA 1QDUA 1SU8A 4XH9B 5HBRA 1AS0A 1E3SA 1C7IA 2E4ZA 2H4WA 3L8FA 3I9V6 1FQWA 5KHAA 5AUQA 2ZJ8A 3JQPA 2H2WA 4BRWA 3I30X 3UPUA 4RZQA 1H4TA 3W4IA 3COPA 4MV6A 3JCZA 3NBAA 4CQLA 4BMCA 2Q1YA 2YIVX 1NG1A 3EWSA 3I28A 3VUEA 1U2TA 3V6MA 3QWBA 2DT8A 5DBGA 3DDWA 1NU8A 3WOVA 3GH3A 4G26A 4D8WA 4E1VA 1U28C 1B8PA 4NBTA 1DKUA 3WWEA 2QPOA 4Z3KA 1NP7A 3E3OA 4W99A 4RDHA 1X8JA 1B4DA 1BTOA 3TAUA 3RF7A 1KI1A 3FKSD 3GMTA 3SFTA 2VQDA 3K8QA 3ED1A 3EF0A 4JJ8A 3KWLA 3HE3A 4PHHA 5ERGB 1GSOA 2UZ1B 3T5PA 4BXOB 2QRJA 4IMJB 1NXWA 1AD2A 1XZQA 3TQOA 1PR0A 2UVQA 1Y1SA 3N28A 3O4RA 4ROSA 2FUCA 5JFOA 3GCWA 4OI1A 3OPVA 4P5DA 3M83A 1M8GA 1N7IA 3SY8A 3VC7A 3CF0A 1CEEA 5CDFE 4U3JB 4ZCSA 3FNBA 1TUBB 2IK8A 4RTPA 1JFSA 2C5HA 2BSQA 1EU1A 2LCQA 1J5EB 5CT4A 3B6KA 4NZPA 4QDXA 2EC5A 3MPOA 2Y1DA 1PFWA 2O0KA 3QKUA 2XTJA 2X0EA 3ANYB 4WDRA 4D1YA 4ZO9A 2HXSA 1RRGA 1KFKB 2C5SA 4ZT3A 2GR8A 3TLGB 3ER9A 1DEHA 4MLCA 4HDRA 1QYXA 3KTDA 3LV8A 1CUZA 3QMWA 4TXLA 5ALHA 3SS7X 5B2EA 4A4DA 2PZBA 3RYCB 2ODEA 5C46F 5BQFA 1YIDA 3I12A 1O94D 2YV2A 3GCGA 5F1YA 5BN4A 4FX5A 2C5EA 1UBKS 1SXIA 1WABA 3ECAA 3DTVA 4A27A 4D9KA 3EPPA 3RS4A 4XQ0A 2BOVA 1NVUQ 5KBYA 1U4SA 2XE4A 3L1IA 4Z3DA 3TD6A 4AMBA 3H2BA 2H4XA 2HIAA 3FPKA 3LLSA 4QOJA 4ZPXA 4GZ5A 5TT0A 3H7IA 5AW1A 4TWAA 3LAWA 5CT9A 4ALKA 3DKIA 3Q9UA 3VJKA 5CB0A 3B1XA 4KQ9A 1OPXA 5DLDA 2C7GA 2P1DA 2XDQA 1RACA 3P27A 4A82A 4D74A 4EUEA 1S9DA 3C3MA 1PX2A 3MCVA 1UKYA 2MINA 3ZWXA 1BE0A 2Q2NA 4D3ZA 1DMSA 3EH2A 1SKAA 1NXTA 1YR8A 2QTRA 3MCAA 1PT9A 3IALA 3P96A 4AN1A 1GG9A 1X38A 4YALA 1XZEA 1TGVA 2QAGB 3KZ1E 2O2JA 3F3SA 2JCSA 4JMPA 4N39A 4WNIA 3KXKA 3W9UA 4M60A 5TJ9A 4A5OA 1FLVA 4AK9A 4QG3A 3KHKA 4BYGA 2BC9A 3CUKA 1O8BA 3BC1A 3QLUC 1FX0B 3U80A 1CQWA 4CMAA 1H4SA 1EHCA 2XQVA 1WW2A 5JZSA 2IEBA 5F5XA 4XWKA 4BO7A 5LMCA 4EATA 4OMCA 2Q5CA 5C8YB 5LBUA 1MW9X 1ZOIA 3R3WA 4AWXA 3R6WA 2CUNA 3D6UA 2H00A 4TM7A 4RA9A 3PNOA 2QQ5A 1NVDA 1N1GA 3LRXA 1YDFA 3CPHA 3DAOA 5EWLA 2I8AA 3S2ZA 1ID1A 2FFHA 4IIYA 4LQ4A 3VGJA 1RC0A 4CIDA 4DW8A 3QK7A 3TRDA 3G2OA 1HSZA 3RS2A 1YBHA 3CNHA 3CRQA 1L4KA 2WW8A 3RC7A 3PDJA 2VAPA 4DJDC 2R8BA 2D5BA 3LUCA 4X6XA 2CEAA 5K4GA 1U8FO 5I7UA 2UVDA 3MTIA 3GRKA 1Q95A 2ATXA 3Q72A 4LE1A 1E0AA 1XZFA 5T5QA 3TF5A 3PQ4A 4UZEA 4V39A 1OLUA 2GCEA 4DEYA 4TZ6A 1DUVG 4MW2A 1RQGA 1KDOA 3BG5A 3JPWA 2F2TA 1P4RA 3MFYA 3UAXA 2QR5A 3SZOA 5LQCA 5B1HA 3BMCA 5LYYA 4R6XA 5KVVA 1RPJA 1NTOA 3VU9A 1ZR4A 2YMQA 3LO5A 2WFAA 4Q3KA 1E2LA 3C3JA 3PPVA 4MDEA 3A0UA 1FFXB 2REQA 3A3YA 3HQ4O 2QGZA 3NDIA 4G84A 5BW8A 2HWXA 5EIXA 6GPBA 2ZXUA 4E15A 2H6EA 5KWSA 5JOQA 1W47A 1GPNA 4LX8A 3ANMA 5A6SB 3SVZA 4AYXA 1QANA 3DOUA 3ZYZA 4BECA 3CS3A 3D5TA 5J3JA 1KRHA 2OAP1 3MYYA 3IAM6 4XDYA 3LUHA 1YC2A 1SVMA 1YQDA 4GLJA 5LA6F 3C8MA 1CZRA 1P2FA 2QTCA 4BV2A 3UJ7A 3B38A 3A1UA 3A31A 3AEKA 4EG5A 2BFDA 5HQ3A 1GUAA 2VDLB 4PSAA 1P72A 3D54D 5AICA 3L0BA 1H5QA 1YB2A 4TX1A 2OV1A 1AXRA 4Y0AA 4P4NA 2IDMA 4OBBA 3ZR4B 1XQ1A 2CYBA 3K0CA 4H15A 3WDSA 4BNTA 2V3WA 3G0IA 4MUYA 2DLDA 1E61A 2PBZA 4NU0A 2FMHA 2GNAA 4ZQGA 1FZTA 5REQA 3RBXA 1A5TA 3DJFA 1XDGA 3D7RA 1ACMA 3C4JA 3UV3A 1AUQA 4Y1FA 4Z9FA 8AT1A 3Q5GA 2D2EA 4UKDA 2HSJA 4CEJB 1GTJ1 3IDZA 3C7DB 3P7MA 1VLJA 4TLBA 1E9EA 2YXPX 3PC8A 1HEUA 1PBNA 1UADA 3OQBA 3OVMA 3S55A 3ZEIA 1MNQA 2V4MA 4P7BA 3DMPA 2B1JA 1ENOA 2WFLA 1Z6ZA 1OGIA 1ONBA 2HPZA 3GWGA 5JS2A 3TR5A 3BZWA 2SKDA 1RQLA 4PLTA 2JEZA 3MRXA 3HRIA 1IXRC 4UAVA 2WUWE 2IWHA 1EI9A 1XLWA 4INZA 5I6DA 2ZPUA 1KAHA 3EEOA 1BWSA 1QQBA 4I50F 5KC8A 4NFYA 1E2PA 3PZRA 2IX3A 3DKPA 3AB3A 4RXTA 5F2KA 1E4YA 4H7DA 4I5DA 3TQRA 4X94A 3AUAA 4L8FA 5AHRA 4LSGA 4EI2A 1Q6YA 1IXYA 4UNIA 2NU8B 1ACLA 4JLJA 4HEQA 5F7XA 1IZYA 1QHHA 4Y2RA 4JB8A 2OGUA 1DIRA 4LYHA 3GIDA 3WWPA 4IRXA 2XB6A 5IYZB 2Z95A 5KYKA 1THTA 2SCUA 4GI1A 3KYBA 2BEUB 4RVFA 4Q34A 1XZ8A 5TMEA 1DAKA 1GUFA 2QVBA 2H4JA 1JFTA 1XB2A 4URZR 2P41A 2L19A 3SN6A 5FX2A 1U8AA 4X20A 2Q4DA 5GIPE 3WGZA 1L6RA 3TZLA 2FFBA 1AXGA 3IDFA 3OE7D 4BATA 5BW6B 1XKLA 2VDUE 3ICPA 3ID6C 1RP1A 1GSAA 1Z8NA 1EVLA 2QDKA 4WBNF 1LSJA 4Q3AA 2HOQA 4WEOA 3SJCA 7REQA 2Q0HA 4LF5B 3EEFA 1MO6A 1N5LA 3VU8A 1GTRA 1DTEA 1KZ1A 4K8OA 5C1DA 4ZGGA 5K01A 2EAUA 1WMSA 3KAQA 3PPIA 1H85A 4DV1B 4MUHA 1M2OB 3VR6D 2A0KA 4G1UC 3OCJA 1ELOA 2C8KA 2AJDA 3DB2A 4U7GA 3T1YB 5KPJA 1DXYA 4CMCA 1MEJA 1EXMA 2CLDX 3H65A 1VPEA 1XT6A 3K9LA 1K7EB 4NENB 3ZC3A 3HHEA 3P0HA 3ROQA 4B9AA 1MT0A 2O8CB 2ZG6A 3TLXA 4NQRA 4NU8X 1OAKA 3HI4A 3K4PA 1CDOA 1V7CA 1Z8DA 5JAQA 4IFBA 1MQSA 2LTAA 4AZ3A 4QXQA 2A7QA 1UWLA 1JDBB 3EAQA 4DDMA 1ODCA 4TYMA 1WSWA 4REQB 1I30A 3O6VA 2ZKIA 4XVRA 4X5OA 2KJQA 2Z8YA 5FR2A 4DV2B 5DN9A 5DTMA 1H0SA 2G06A 2QZ4A 4L07A 4MW0A 2IXEA 3RVJA 4JLOA 4NBNA 1FDVA 5DSTA 4ZMSA 5JMWA 4MB6A 3TW0A 3RJMA 1XA4A 1XYVA 4JP8A 2I6TA 5JNTA 1WULS 3WMFA 4FDMA 1RIFA 1IY1A 4FQ8A 4CF3A 3OOYA 1ZICA 3M4ZA 3IVAA 1TD1A 3G82C 1N2BA 4HDKA 1PJ8A 1PKEA 2OPHA 3HP1A 4TYPA 5FWXA 1QU3A 5M7EA 2O1SA 2ZQ5A 1QQTA 1U2GC 1CLUA 1L1EA 1NM5A 2FW6A 2GN8A 2IOFA 1N2EA 2OFXA 2UZ1A 2V9ZA 2PMDA 3DW3X 5JALA 4A0RA 2JGRA 2VQ6A 2DSNA 2C00A 4RDCA 4QTYA 4PAMA 4G2TA 3CO5A 1O08A 1KPIA 3BA1A 1GZ4A 5AJXA 5DGXA 2MTBA 5BNFA 1TKBA 2FG6C 3HH8A 3Q6MA 3CEJA 1TC1A 1R8YA 2RGUA 3JVIA 4IGIA 4RKEA 4JKIA 2JHAA 4RK7A 4U3JA 4D9FA 5L3QB 2BBTA 2QVYX 2JLWA 1DBPA 4M0LA 3A4LA 4G01B 1F2TB 4O5OA 1C9JA 3AFMA 3MWGA 4FJ2A 1JE1A 2VP4A 2ZWAA 4HDSB 5THKA 1WBBA 4EFKA 2IZ0A 1V3TA 3LKZA 4C2UA 3UMVA 2IOYA 2FKAA 1WCWA 2KYRA 5HX7A 1KMMA 3MQ4A 4XPZA 3O4GA 1XDUA 3KWFA 5EEGA 4Z1MD 1I2AA 4K2HA 5CT5A 1KEZA 1JT9A 4D25A 4YEDA 1U0NA 2EJTA 5M3BA 3ONVA 4K6FA 5FLYA 3UCXA 2CD7A 2PV7A 1QXSA 1TTHA 2ZAYA 4F3NA 4L02A 2GZRA 4RGYA 4O63O 1OFTA 3T38A 1ENYA 1UWCA 5TPZD 2YXEA 3P0FA 4Q48A 1NOKA 5H16A 1UZUA 3WHIA 2FFQA 2QYOA 3N2ZB 4FMDF 4WY5A 3BE8A 2OM2A 3VYRB 5HDQA 4W9MC 4ZRMA 2ZAMA 4KB5A 1T6NA 4ESOA 4JMLA 4A7PA 5C37A 2ZS9A 4U6SA 1Z0ZA 4DR6B 5DCYA 4DQUA 1QKIA 5K8CA 3CX8A 4C4OA 4MTLA 1Y3BE 1FYWA 1Y3FE 5HA5A 2WJ6A 1C1XB 5AM3A 2BFWA 3PIIA 4I1OA 3T95A 2IYOA 2H29A 1NVFA 1OAOA 2MT9A 4MO9A 3OKPA 3BK7A 3CLRC 4W6ZA 1HC7A 3EQ6A 1NVAA 2QPAA 2VLIA 4PLWA 3K0EA 1XEWY 1SCQA 2F9LA 3HSKA 1G20B 1B41A 5K0TA 1YB6A 1AN9A 2FZEA 4L7QA 4DQLA 3B3AA 1LBTA 2BZ0A 4LWPA 1Q0QA 3L7AA 2W22A 4BNZA 2PUEA 2VK1A 2EZUA 1NYTA 2WINI 3WL5A 1SXJE 1NE7A 4M36A 4X24A 4RCVA 2XUIA 5FL3A 1ARZA 4PX2A 5A04A 1P0QA 3TIXB 1JA9A 1W1UA 3PTAA 4BIMA 1QHSA 1DUIA 1JHUA 4PPFA 3QBTA 4QNNA 5AUPB 4YCLA 3MXOA 1LS6A 1XCLA 1K7CA 2IYYA 1IRIA 2OCDA 1O6ZA 2I7TA 4PC1A 1CJBA 2IYNA 2JARA 3DWEX 2LXNA 1XAIA 1BKDR 1E3TA 1EJBA 2G1JA 2H4HA 1D2AA 5A7GA 2ONCA 4B4OA 1IY0A 3NATA 4YV1A 1Q1EA 1UXOA 1KDPA 1Q0RA 2QL9A 5KTOA 5CCDA 4IILA 4OQPA 3ENVA 4KWTA 3AVPA 4I4TB 1YZTA 3M6XA 1E1YA 1QV6A 5IVKA 3ZHQA 4AZSA 2A0XA 3DLHA 1EFLA 1G3MA 4O1HA 3NAGA 3TG2A 3E27A 4H6VA 2FPKA 3G2LA 3DEIA 3IQWA 3JQ9C 3IEXA 4ZVMA 1OU0A 2C0CA 4L6AA 4BP8A 1FFXA 4KNWA 3N7AA 1PCXA 1N0VC 5D3MB 4GR9A 4DA4A 1Q0TA 1V96A 1W96A 2R6AA 4F1KA 2RGGA 3F7MA 3K2BA 1AG9A 1JXAA 3CZCA 3KVOA 1Y8CA 4Q4HA 2G77B 3OEYA 4C0WA 2FSPA 2JDID 2IXFA 2G9VA 2PKCA 3PNBA 2OWDA 5BT9A 5EE0A 2FRDA 3C39A 3EQ7A 1ZGHA 2UXCB 2I22A 3PX2A 1D0IA 4HLQB 4JJAA 3RUAA 3U4CA 4ZV9A 2AEMA 3BICA 5KAPA 3IT0A 2EKBA 4N01A 4NPAA 1G5HA 3UKDA 4LNAA 4KTVE 2POQX 2W6IA 2IPLA 3QY0A 4ZVKA 2FOXA 1FF9A 1SIWA 2BAGA 2HBQA 3MT9A 5G0UA 3U6KA 1Z73A 5HUJA 2JAOA 3AVOA 4KMSA 3VA7A 4RGQA 5DBOA 2HHCA 1FDUA 4K05A 4QVGA 2RD2A 3CRZA 1V35A 2PFGA 3PKJA 3ETEA 4S2UA 4HTFB 2YVAA 3EDRA 2VUIB 2G88A 4N47A 1KMQA 4R2KA 3WQBA 2Z57A 3PUIA 3HJTA 2HCBA 3GG2A 3ES9A 5HTKA 4Q82A 3LUDA 1V95A 1E9VA 1T3HA 5JXWA 2PFKA 1FFSA 2J3QA 3V7WA 1BKYA 4NMLA 1IOVA 1Z4PX 3AEZA 3J7TA 2QVZX 4KUGA 3ZBQA 1WZUA 3GA5A 1TIPA 4RAOA 4J1SA 3RLIA 4BLQA 4KHZA 3PI7A 2BFCB 1GTVA 1VKRA 3DOEA 3ITEA 2Z43A 4R2HA 3URKA 2Q5HA 1F5SA 5IKXA 1PD0A 1ZJZA 2HWWA 4QHSA 3WXBA 3VNQA 3I2KA 1QG2A 1TT5B 4TMVA 3TVDA 2CCGA 4CBVA 4EUKA 3EEBA 1EWTA 1S8NA 2X4DA 3KYDA 4WA7A 5D01A 2Q4TA 3TQIA 3U39A 3USES 2EKPA 4DLYA 1QRAA 3PBKA 3AFGA 1XEAA 1JUDA 2QMHA 2QTNA 3HJBA 1N3YA 4GWLA 4LGCA 5I7EA 1WOMA 4DZTA 1OFGA 1U9JA 2F8TA 4DDTA 5EMMA 2JGLA 1T4GA 3UY4A 1BROA 4RY0A 4QBGB 5HGJA 2RHDA 4EW6A 4RMJA 3WWZA 5DYNA 3HVIA 3NONA 2V6IA 5IYZA 2O3JA 3QUCA 4C04A 3N6RA 2OOSA 3E1SA 4WZ6A 2GLTA 1W73A 2X6QA 3CRVA 1VB3A 2YMPA 3FVQA 3LY7A 1Z0SA 4OYHA 5IXSA 4E30A 2TMDA 1HDEA 3KQWA 2VKTA 1K1EA 3K1AB 5CFMA 3N2LA 2HZ7A 3WIBA 3HU3A 5HWSA 3AETA 1ECGA 4LSZA 3LC7O 3U4QA 2XI4A 4JUAA 4LECA 2VF4X 2BTEA 1P2TA 4U8GA 1AKQA 4LISA 1H2BA 3O4JA 4UAGA 4NS4A 4NZZA 1IWPB 1J0DA 1TJPB 3IDQA 4M89A 4XX0B 3O2QB 2ZTVA 3WGTA 1CUEA 4NY1A 3HY6A 4OQDA 3NHJA 3IVCA 3NFRA 2CVHA 1GKYA 1AIPA 3I92A 3T1TA 2P3OA 2AC2A 3ADBA 4OX9B 1EFHA 2QPTA 3WYNA 1S7GA 2KI5A 4JJGA 5EQFA 3FTEA 4KVFA 3WKCA 4B6SA 1P4AA 2IYEA 2VA8A 3VTZA 3KUKA 3TGWA 3MHPA 4I55B 4K9LA 1C3OB 2O3UA 4UM8B 5FJJA 5LQSA 2HJHA 4XYGA 2BGRA 3KT8A 4NENA 3NHRA 3I42A 3PI6A 2XE6A 4IQGA 1CUBA 2RGDA 2SICE 4XVCA 2JFZA 2XD9A 3EF1A 4JJFA 4EX6A 3R0VA 2Z09A 3MAJA 1SVLA 4R5HA 4Y6OA 1IY8A 4E5VA 2ZI3A 1SBTA 4KH0A 5TQ2A 4KR9A 5TXGA 3A4VA 1RKVA 1YRQA 2E55A 1KIFA 3X1MA 3VHRA 3S81A 4LYDA 1HT0A 3R4VA 1MB4A 4Y9UA 2A56A 3GJYA 4MITA 3ZU3A 4D43A 4L74A 2RE8A 4I6GA 4HB2A 3AVUA 3KL4A 1KSJA 1TF7A 2J0VA 5D6NA 1B1AA 4QOIA 2B2NA 2MIIA 3O38A 3VR3D 4QRHA 4EJSC 3ZWOA 3BWMA 3MF4A 1QTIA 3KQVA 4OYYA 3V8MA 4RQUA 4ACAA 5KSPA 1XJ5A 4CM4A 1A9QA 1UOOA 3PICA 4UHHA 4CLEA 4UTNA 2RB4A 1UIRA 4NCHA 4UBKA 5K51A 2WM2A 1D3AA 4GP6A 1KMNA 3SBOA 1KJZA 1T5SA 1WMEA 3OQHA 4UEJA 1E3EA 2P30A 3IJEB 1WKBA 3DT8A 3RPEA 2GHTA 3PSAA 4GYKA 2WLSA 1CY6A 4FDTA 4UNNA 1JJAA 4M49A 1JS1X 1OV4A 4MJLA 4LYEA 1GGKA 1Z5NA 1N6NA 4AZ0B 1GQQA 2Y0EA 3VYSB 5LJIA 3TIFA 3AHFA 4HJRA 4BTEA 1GQRA 5JE8A 2IH4A 2V4UA 2GBLA 5C18A 1ZNXA 3IP5A 5HFNA 3PC7A 1BD3A 5A1JA 1CR4A 3KC2A 3R9IA 1EE2A 1ZS9A 5BO5A 2D1YA 3W4JA 4U2BA 2VS1A 1FXWA 1TZJA 4IIJB 4J1NA 4N7MA 4PXSA 2HYIC 3FMGA 2ZUCA 2ACEA 3K32A 5DMXA 2G0TA 1AZTA 3IQXA 4TN1A 3TW4A 4EB6A 1W94A 1GHTA 3JQGA 4MSUA 4Q03A 3U9LA 4WW0A 1PQ4A 4HWRA 3RU7A 1N6HA 3O3MB 3ZV6A 5LSAA 5L4SA 5ALXA 2HHAA 4DMRA 2IPXA 3H75A 4LZOA 3SOPA 2FK8A 1PSZA 2OGTA 4HX5A 3S1LA 3AIOA 1DRWA 1XL0A 5FAKA 1CYEA 3BXPA 3I8SA 1RYHA 1NBIA 3NJ8A 2PK3A 4FXOA 1IHXA 2UYYA 2YN2A 2ZQZA 3RBZA 4AI6A 3ORSA 4MR8B 1O95A 1KNXA 2PL3A 4QBKA 3WGNA 2IHBA 2PM8A 2CUZA 4KDRA 4DPLA 4ZTZB 3MRVA 4PANA 1QGOA 2ZJ0A 4C3OB 3JRNA 3QBVA 2HZBA 3AP1A 3TM4A 1E0KA 1L8QA 4HC4A 3DDCA 3F6PA 4J7UA 1T8WA 5H80A 5ES4B 4B45A 5K05A 2PUJA 1Q44A 2YC2C 3DD5A 4ID9A 2Y1OA 1Y9AA 3M1LA 4MJ7A 3HXTA 4RZHA 5CUQA 4KXWA 4U7DA 4G3XA 2YXDA 3KSUA 1SRRA 3ZK7A 1PNRA 1KGSA 2I7CA 3C3BA 4HVLA 2GXAA 5ENDA 3ZHXA 2G07A 4ARIA 3CZRA 4LYFA 1P3JA 4URVR 1Z88A 2OD9A 2HMTA 1WB5A 4P4GA 4XRGA 1J2JA 3GVCA 2PS9A 4ZOCA 1X9GA 3VAYA 1JEJA 4A2PA 5HJ7A 1I4TD 4MS4B 1Y5IA 1G20A 4FHEA 4GR5A 3GAFA 4O1IA 3FRIA 3CG0A 3GT3A 3FKQA 4H59A 3QQ5A 2WT9A 3C43A 5I5GA 3O91A 2NOAA 4IXTA 1KY3A 4ZI2A 1Q83A 4WERA 3EMBA 2C4HA 9ABPA 4FGUA 2PDAA 3QITA 4LY6A 2EIHA 1IN7A 5CW2A 4JL6A 1SVKA 4HBGA 2QOEA 1CY7A 3R77A 4QREA 2RDMA 3P26A 4Z7QB 4EYSA 1OA0A 5G1NA 3TQQA 1UAYA 1Y7HA 5BSVA 3GHHA 3H1EA 4P3NA 4EMBA 1CUCA 4HQNA 3ZXUB 5EMJA 4ZN6A 3L07A 2J0UB 2OCBA 3LYAA 1F8XA 2WMNB 3UA4A 3ZHZA 4KO4S 3ZLVA 4R7GA 1AZSC 2WKRA 4B75A 3QX7A 4EEKA 3WA7A 4BCCA 1FRVA 4JLKA 3EGWA 3G88A 2D74A 1E3QA 1VJ1A 1LKZA 4GGMX 3ORHA 4KXFB 3NR2A 4OO3A 1WZEA 4GO1A 5JBQA 3VR2D 2JAXA 2QJWA 2ZWOA 3ELYA 1Z9BA 3TL2A 1G42A 1KKUA 1AKTA 2XMPA 1NF3A 3S8MA 2HWKA 1P0CA 4ZCLA 3P4XA 3KTOA 5EI5A 2GN1A 4Q3CA 5FA6A 4NG5A 2G08A 2C3YA 2W2LD 3LYUA 4KOEC 3HZOA 4QFCA 1JILA 2AMVA 1Q16A 1YU6A 5LUBA 5LQNA 4RIHA 4JOSA 1WXGA 2NO6A 3OM9A 1JTFA 4WBXC 3DA8A 4ENWA 3THRA 5IH7A 3U7GA 4Z4EA 2VDMB 4HVCA 1UBOS 3BKXA 5DV9A 1FJ2A 3G59A 4PC2A 2VK8A 4F9GA 2CBZA 3VYVA 1E62A 2ID8A 3Q98A 3DLPX 4KWHA 2PGOA 3BXHA 3DS8A 4DXAA 4JBHA 1G1MA 4TKMA 4E3ZA 2OV2A 2GW4A 4BHTA 4YMTA 3VH2A 1EGMB 2GN2A 4I2NA 1ID8A 4KOAA 1U98A 2GSWA 3B5JA 1SH7A 1M6WA 1LTHR 2GF9A 4M1MA 3ZV3A 1I5OA 4YMVA 1LVHA 2HNKA 3R6GA 2P3SA 4LC0A 1CQZA 3RU2A 4DG9A 4BLVA 3UMRA 4CV3A 2X6RA 3ZW8A 1DDIA 4XYLA 1TTTA 1H05A 1P3Y1 1Z3CA 5BW0B 3AF0A 3O92A 2MSEB 1WDTA 2OHGA 2P79A 5FBVB 3K16A 3SYLA 3TECE 4CKWB 5LP6A 4FDAA 4GQAA 4J1TA 1BQEA 4BHRA 1RLTA 3GFSA 3W1EA 1FPQA 4AVYA 5I7WA 1OZHA 1WXDA 3ECCA 1PYGA 1PG5A 1YMVA 2LMEA 2BFCA 2YV5A 1L8OA 2F90A 4YBRA 4BKQA 4CM7A 3I6IA 2C2GA 3FVTA 4LMRA 3NAQA 2DP4E 2NSJA 3AHHA 1SUAA 2VJMB 3VC3A 2VJPA 4WLNA 4Y6GB 1P81A 1YKFA 1XBTA 2F1IA 3DAHA 2PD4A 1WF6A 3JWIA 3N5CA 1AKVA 4GWGA 3QI2A 4D80A 1O5TA 4R8MA 3O3CA 1V43A 3IBFA 1Q7EA 2WYWA 3NYQA 5T67A 1JPUA 3ZHUA 2XVAA 1TU0A 1KA9H 4NCBA 4RCZA 4B17A 2WIJA 3A9UA 3SX4A 4S0XA 1SOMA 3UJHA 3MWDB 4TQAA 2HY7A 1A9SA 1UZLA 2OBMA 4R2IA 3NHMA 4C06A 1Q74A 2W2NA 3GPIA 2IYZA 2HWYA 4G41A 2AYXA 4IHKA 4WZBA 4DCGA 2OFWA 3NBZC 5FR1A 4I1PA 3VBEA 1YT5A 3AINA 1AKEA 2QNIA 1RZ3A 1VHJA 3K6RA 2FZVA 3GUUA 3AVVA 5CA1A 3X1WA 1HEIA 2ORWA 1FPMA 3D4LA 4B09A 4QDZA 4D98A 4ZODA 1QQ6A 3WICA 3MZ0A 1UJ2A 2QMOA 4HEA1 1HGXA 2VT7A 2PYIA 3EA0A 4MRPA 1VIAA 3V55A 2PE5A 4MUKA 4M1WA 1ZZGA 2OAQ1 5BMVF 2NQ8A 1F17A 3G2HA 4BV3A 2G8LA 2YY6A 3GNLA 1JIQA 1J25A 2FPMA 2GZHA 5DK4A 3RROA 4PPYA 1J2RA 1PLJA 2NGRA 1ES9A 2J3IA 2Q3LA 3THWB 4KNYA 2OBYA 1JG1A 3ZV5A 1RXIA 5C0OE 3PL1A 5A9SB 1L5QA 2Q0XA 4I8DA 1T13A 3NOQA 3K5IA 2IH2A 1GDHA 3L7CA 4OJKA 4PZAA 1DAIA 3L8ZA 5ICSA 2PAFA 1RHUA 4IEFB 1EBUA 1EFCA 3B51X 2JBAA 3I45A 3ILXA 2HLDD 1WKVA 3EEIA 2YW2A 5JJCA 1HFEL 4EYKA 3AUFA 4ZI7B 3BHIA 2B35A 3E9EA 3F1LA 4YMSA 2ZUEA 1N0UA 1EM8A 3EDMA 1DIHA 2ZW9A 1R6XA 1U1GA 3PD7A 4P3OA 4YT4A 4KR0A 2ANCA 1A5BB 5LXTF 2D8AA 4E2WA 2NVUA 3HO1A 1CEYA 5JFTA 3WK6A 1A9TA 2QSUA 4XGKA 3SJBA 4P2GA 2GRAA 1GNRA 1Y6ZA 4RVNA 4E32A 4ZYVA 2IU3A 2NADA 1ESZA 1TU4A 2O2IA 1W76A 4II7A 1T10A 4B0OA 3FYUC 3SZ3A 2HADA 1F8GA 4PQFA 3LWZA 3K0FA 1E0DA 2ZSAA 3QE9Y 1FYVA 1H8EA 1GT6A 3NBFA 1ZRMA 3L0OA 4KIUA 3M5CA 4Q39A 5HIJA 4DYHA 2EOAA 3FWYA 5L45A 3FG9A 4E2XA 5JARA 4PN3A 3Q10A 2QT9A 1U5BB 2CNKA 3DPUA 3EULA 3GGCA 2GJAA 1LDNA 3LHIA 1ZINA 2ZZMA 2DQKA 1G6Q1 2QTWB 4PXYA 4JBYA 1H0RA 1W35A 4JLDA 1SKUA 4AZ0A 3EGEA 2IPAB 3BORA 3M0EA 2FSGA 1W75A 3TB4A 5KOIA 2O07A 3FB1A 2PL1A 2CKDA 2LR0A 2Y92A 4XM1A 4YAUA 3A6GA 4H6PA 2WVJA 2IHNA 4GF5A 5ES3A 1XWWA 3L06A 3QNUA 4HH4A 3PRKE 2RH5A 4RL4A 1P5RA 5ISMA 1Z6GA 2AHOA 2EQAA 2HM7A 2Q6IA 3DFMA 5C8XA 1Q0LA 4Y8VA 3PXCX 4XJXA 4M8KA 3ZY2A 1WHSA 4KQHA 5ITZB 1R4ZA 1W85A 1PQYA 4FFSA 4HGZA 4XJTA 4YHBA 3II6X 3QEKA 1CBUA 2NXNA 4M88A 5HXAA 4DXDA 3SQXA 4D26A 1EBBA 2WI8A 1RPTA 3EIHA 2BL4A 2REXB 3LBNA 2VNHA 2FEPA 1MC8A 3THSA 4EHDA 4HH1A 1IY9A 1PGPA 1FMTA 1UMDB 1RJFA 4UEOA 2D4HA 3FUVA 4UU8A 1VP3A 2BEVB 2EHDA 2DH6A 4IKPA 5IHPA 3F7TA 3T5GA 2EJBA 1T3ZA 2XNKA 2XYQA 3DBHB 3N59A 3KWJA 4MRMB 1TRKA 5IKOA 1G8SA 1ML4A 2VK2A 5CNKA 4XR9A 5B58T 1G21B 1KTVA 2CE7A 4E11A 2F55A 4PSCA 2HJRA 2JFXA 1NAHA 3DF9A 5DM60 3MT7A 1IAQA 5ED0A 5SYMA 3W1VA 1E5QA 2HMVA 1SB8A 1UBCA 1XRNA 1JJFA 5BYAA 3FE2A 4P2BA 4HN2A 4WN9B 2HHHB 1YQ9A 1G6KA 3D8NA 1OYOA 2Z5LA 2AG0A 3DZ8A 5AW2A 2A84A 3K09A 5DW3A 3ZCPA 3M6LA 1YA4A 4PLGA 1QGDA 2BUAA 3OZDA 4WLVA 1K5HA 2BMAA 5LYJA 2QG6A 3VR5D 2C3UA 3OOHA 4ZHQA 3FHOA 2HJWA 2HRCA 3BTSA 2PRKA 3DMGA 2ZSDA 1L7XA 3ESBA 3NWBA 4IXDA 1NASA 4UHFA 3ZDFA 5JMOA 1AA6A 3V9AA 4F5YA 4Y1RB 3VYWA 2DLCX 1GOTA 4ZCTA 4NCNA 1P9RA 3C3YA 4YDRA 5CTJA 1U2GA 1PWEA 2A0FA 2G1UA 4HCJA 2CHUA 2YS6A 4RF4A 3B2EA 3AQIA 1GGVA 3HJAA 2VG8A 5E7IA 4D7AA 1PL8A 2HX1A 2ORYA 3ORRA 4GBMA 2K4MA 3T3MB 2IBTA 4HLCA 4WESA 5KPDA 3SHVA 3E9RA 1ETHA 1WBDA 1YTUA 4EWLA 2WFZA 1OH5A 1RXYA 2QD2A 1ZCAA 1IXSB 3UJPA 2J0UA 3NX4A 4R2WA 2OTCA 1Z06A 2FMXA 2WK1A 1R9NA 2FPGB 1QH0A 4PPQA 2BJWA 4I9NA 3RS0A 2CV0A 5I7HA 5JJBA 4X1KA 2I6FA 2QRMA 1KZ4A 3KQKA 2ZJ6A 4L22A 4BJHB 1MABA 1KVSA 2WEKA 2ZAGA 3IBSA 3QPWA 4Q7KA 4D92A 4XVQA 4WZAB 3QG5A 1MTZA 4JUIA 3ON5A 3LXMA 1Q0HA 3G0GA