2G5ZA

Structure of s65g y66s gfp variant after spontaneous peptide hydrolysis and decarboxylation
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Understanding GFP Posttranslational Chemistry: Structures of Designed Variants that Achieve Backbone Fragmentation, Hydrolysis, and Decarboxylation.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2006-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.40 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2g5zA00
2A50A 2G5ZA 2A54A 2G2SA 3CFAL 2GW4A 3LF4A 2A53A 5EXCA 2G16A 3CFFL 2A56A 3CFHL 2A52A 2G3DA
chains in the Genus database with same CATH superfamily
2A88A 4MUKA 1N2HA 1MOPA 4EF6A 4G5YA 2A53A 3MXTA 3LE8A 4G5FA 2OGFA 3CFHL 3UA0A 2RETA 3IVCA 4MUGA 2A50A 3ISJA 2A54A 2G2SA 2LMEA 3CFAL 1N2BA 4MUHA 3IUEA 2EJCA 4EFKA 3IOBA 1N2EA 2G16A 5G2FA 3N8HA 2A7XA 3Q12A 3IVXA 1N2OA 1N2JA 1V8FA 5BW0B 3AG6A 2A84A 4DDMA 3HL6A 5HG0A 2GR8A 4FZJA 3UK2A 2GW4A 3IODA 4MUFA 2GR7A 4DDKA 2X3FA 3IOEA 2A56A 3CI0K 3COZA 3CFIA 4DDHA 3IUBA 3IMEA 1UFVA 3COYA 3IVGA 3COWA 3UY4A 4IXJA 5EXCA 3IMGA 2G5ZA 1N2GA 4MUJA 1IHOA 2A86A 4MUEA 1N2IA 3CI0I 3IOCA 2G3DA 2I52A 3INNA 4MULA 3LF4A 5KWVA 3COVA 3Q10A 4MUNA 3AG5A 4MUIA 3IMCA 3CFFL 3MUEA 2IECA 2A52A 4BHRA 4DE5A 4MQ6A 3EMOA 3QTTA
chains in the Genus database with same CATH topology
2A88A 4MUKA 1N2HA 1MOPA 4EF6A 4G5YA 2A53A 3MXTA 3LE8A 4G5FA 3CFHL 3UA0A 3IVCA 4MUGA 2A50A 2A54A 2G2SA 3ISJA 3CFAL 1N2BA 4MUHA 3IUEA 2EJCA 4EFKA 3IOBA 1N2EA 2G16A 5G2FA 3N8HA 2A7XA 3Q12A 3IVXA 1N2OA 1N2JA 1V8FA 3AG6A 2A84A 4DDMA 3HL6A 5HG0A 4FZJA 3UK2A 2GW4A 3IODA 4MUFA 4DDKA 2X3FA 3IOEA 2A56A 3COZA 4DDHA 3IUBA 3IMEA 1UFVA 3COYA 3IVGA 3COWA 3UY4A 4IXJA 5EXCA 3IMGA 2G5ZA 1N2GA 4MUJA 1IHOA 2A86A 4MUEA 1N2IA 3IOCA 2G3DA 3INNA 4MULA 3LF4A 5KWVA 3COVA 3Q10A 4MUNA 3AG5A 4MUIA 3IMCA 3CFFL 3MUEA 2A52A 4BHRA 4DE5A 4MQ6A 3QTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A50 A;  2G5Z A;  2A54 A;  2G2S A;  3CFA L;  2GW4 A;  3LF4 A;  2A53 A;  5EXC A;  2G16 A;  3CFF L;  2A56 A;  3CFH L;  2A52 A;  2G3D A; 
#chains in the Genus database with same CATH topology
 2A88 A;  4MUK A;  1N2H A;  1MOP A;  4EF6 A;  4G5Y A;  2A53 A;  3MXT A;  3LE8 A;  4G5F A;  2OGF A;  3CFH L;  3UA0 A;  2RET A;  3IVC A;  4MUG A;  2A50 A;  3ISJ A;  2A54 A;  2G2S A;  2LME A;  3CFA L;  1N2B A;  4MUH A;  3IUE A;  2EJC A;  4EFK A;  3IOB A;  1N2E A;  2G16 A;  5G2F A;  3N8H A;  2A7X A;  3Q12 A;  3IVX A;  1N2O A;  1N2J A;  1V8F A;  5BW0 B;  3AG6 A;  2A84 A;  4DDM A;  3HL6 A;  5HG0 A;  2GR8 A;  4FZJ A;  3UK2 A;  2GW4 A;  3IOD A;  4MUF A;  2GR7 A;  4DDK A;  2X3F A;  3IOE A;  2A56 A;  3CI0 K;  3COZ A;  3CFI A;  4DDH A;  3IUB A;  3IME A;  1UFV A;  3COY A;  3IVG A;  3COW A;  3UY4 A;  4IXJ A;  5EXC A;  3IMG A;  2G5Z A;  1N2G A;  4MUJ A;  1IHO A;  2A86 A;  4MUE A;  1N2I A;  3CI0 I;  3IOC A;  2G3D A;  2I52 A;  3INN A;  4MUL A;  3LF4 A;  5KWV A;  3COV A;  3Q10 A;  4MUN A;  3AG5 A;  4MUI A;  3IMC A;  3CFF L;  3MUE A;  2IEC A;  2A52 A;  4BHR A;  4DE5 A;  4MQ6 A;  3EMO A;  3QTT A; 
#chains in the Genus database with same CATH homology
 2A88 A;  4MUK A;  1N2H A;  1MOP A;  4EF6 A;  4G5Y A;  2A53 A;  3MXT A;  3LE8 A;  4G5F A;  3CFH L;  3UA0 A;  3IVC A;  4MUG A;  2A50 A;  2A54 A;  2G2S A;  3ISJ A;  3CFA L;  1N2B A;  4MUH A;  3IUE A;  2EJC A;  4EFK A;  3IOB A;  1N2E A;  2G16 A;  5G2F A;  3N8H A;  2A7X A;  3Q12 A;  3IVX A;  1N2O A;  1N2J A;  1V8F A;  3AG6 A;  2A84 A;  4DDM A;  3HL6 A;  5HG0 A;  4FZJ A;  3UK2 A;  2GW4 A;  3IOD A;  4MUF A;  4DDK A;  2X3F A;  3IOE A;  2A56 A;  3COZ A;  4DDH A;  3IUB A;  3IME A;  1UFV A;  3COY A;  3IVG A;  3COW A;  3UY4 A;  4IXJ A;  5EXC A;  3IMG A;  2G5Z A;  1N2G A;  4MUJ A;  1IHO A;  2A86 A;  4MUE A;  1N2I A;  3IOC A;  2G3D A;  3INN A;  4MUL A;  3LF4 A;  5KWV A;  3COV A;  3Q10 A;  4MUN A;  3AG5 A;  4MUI A;  3IMC A;  3CFF L;  3MUE A;  2A52 A;  4BHR A;  4DE5 A;  4MQ6 A;  3QTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...