4DDHA

Pantothenate synthetase in complex with 6-methoxy-1-benzofuran-3-yl acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 97
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ddhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ddhA01
2HGZA 1R6TA 4ARCA 1O94C 3K9WA 1MAWA 4DJAA 2A1TS 1O0BA 4WSOA 5LFAA 2GM3A 1O96A 2IELA 1F7UA 4JXZA 1JIJA 1NUQA 2YY5A 3MMXA 1KORA 1O97C 2GOYA 1YIDA 2NSYA 1PFUA 2Z08A 2AKEA 3IUEA 2TS1A 3LE8A 1WQ4A 1M8GA 2WQ7A 5KWVA 1U7DA 3SZGA 3ZJVA 4JYZA 1JECA 1EJ2A 4Q16A 1JZQA 4TS1A 1QU3A 1XNHA 2AZXA 3KT8A 3UK2A 3N05A 4MWBA 1WZ2A 1I6LA 3CVWA 3IOCA 1PG0A 2J5BA 1KH3A 5H16A 1N2EA 1O95D 1PG2A 2ZP1A 2CUZA 1WXIA 3KT0A 3Q4GA 3UY4A 1T9GS 3AG6A 1XNJA 3M5WA 4R0NA 5LM3A 4DDMA 2A84A 3DV2A 1ULHA 4KPUB 1J70A 4NX2A 3SEQA 4KPUA 5DB4A 2E18A 3AG5A 1KQOA 3FH0A 5K0SA 1IFXA 3NBAA 5FNZA 5TGTA 2V0CA 4MUIA 2CSXA 4EG5A 1IQUA 2QJTA 1ZH6A 5TS2A 3IODA 3CVYA 1J1ZA 2IP1A 5HUHA 4CQNA 3ND5A 2CV2A 1KAMA 1G8FA 1VL2A 3CA8A 1JGTA 1TQ8A 4UZFA 2JANA 1NZJA 3Q12A 1HYBA 3CR8A 3FDXA 3IMCA 3JXEA 4ZT3A 1MAUA 3DLAA 4MAFA 3Q10A 3PNYA 5BNZA 1N2GA 1IH8A 4DNXA 4HK4A 2CFOA 2QUJA 3TNJA 2QUKA 4NAHA 1LW7A 1GLNA 4GRIA 2QJOA 1GAXA 4X0EA 2JA2A 4YP5A 4MUKA 2DERA 1KR2A 1GZUA 1M8PA 1JEEA 4DDKA 3KT3A 4MUEA 1N2JA 4EGAA 4R2MA 1OWPA 1OBHA 2WB2A 1GTRA 1ZUNA 4GU5A 3S3TA 3CLUD 2BYTA 1I2DA 3X1KA 4WNYA 1K97A 1OWLA 4U63A 3ZJTA 4OUDB 4ZCSA 3AFHA 1TFUA 2R5WA 4OUDA 4U8HA 2PZAA 2OQ2A 1QRTA 4MW7A 3IVCA 4EG8A 4G5FA 3H05A 3ZJUA 1G8HA 3KT6A 3UOWA 5DK4A 3INNA 3IVXA 4ZT5A 4G6ZA 3IMEA 1V8FA 4U7JA 3QTBA 4P2BA 1JMVA 4ND7A 1NYLA 1VBKA 4ZT6A 4FZJA 4MW1A 1T6YA 5KCMA 4MW4A 4MW2A 1Q19A 4NDAA 1H3EA 3AIIA 1U0BB 2GKSA 5TEVA 3H97A 1GPMA 5KHAA 3PXUA 3FETA 3FHJA 3G5AA 3FOCA 5AHWA 3RK0A 3ZGZA 4Q93A 1JILA 1KH1A 1ILEA 1M83A 1UFVA 2BTEA 3VGJA 2X0KA 3A4IA 2RE8A 2O8VA 4HJXA 4ARIA 1G59A 3CLSD 1N1DA 1DNPA 3CVVA 1QJCA 3LCJA 1IQRA 4ZCPA 3UMVA 2DR2A 2ZUFA 3H99A 3P0HA 1IQ0A 3D6VA 2I1LA 2XRZA 2HMAA 3ILVA 1LI5A 3BL5A 3HFJA 4MW9A 1J1UA 1N75A 2E0IA 5K0TA 1Q11A 3ZXIA 1WXEA 3PRHA 4A91A 2PG3A 1T6ZA 3RHSA 1D2RA 3HGMA 2YXNA 2A1UB 1N77A 4EFKA 1T6XA 4QREA 2DETA 1WOYA 3N9IA 2WQ6A 1KP3A 1P7PA 4DE5A 3HMQA 4G5YA 2B7LA 1IHOA 1BS2A 5J58A 1OD6A 4QBTA 1OBCA 3RFFA 2V0GA 4YMIA 1EXDA 1PFWA 3KFLA 4JFAA 5IJXA 4DDHA 3QTTA 1TYDE 2CYCA 3HL4A 2PZ8A 1FFYA 3H9BA 3NBKA 2QJFA 2RD2A 1OWMA 1X8XA 4MWDA 1YIAA 4ZCTA 3NV7A 1TYBE 4HPWA 4PBRA 4E1AA 3P52A 4ZCRA 1JHDA 3ND6A 1MOPA 1NUUA 4K03A 4KR9A 3LOQA 4EF6A 1SURA 4MW6A 2E89A 2DEUA 1O5TA 1EFPB 3P0IA 5TEWA 2O5RA 1RQGA 2QTNA 3F3MA 2C5SA 1EFPA 1WQ3A 5LLTA 1XJQA 4HJRA 4EG7A 3X1JA 3TZEA 3N2YA 4R2LA 4DLPA 1PFVA 2XRYA 1V47A 2PXHA 3G59A 3CLRD 1NI5A 2J4DA 1H3FA 4F4HA 2QUHA 1EFVB 3OTWA 1Q77A 1COZA 4RPIA 4ZT4A 1EFVA 3FWKA 4EG6A 3A2KA 1R6UA 2X1MA 1S4MA 3MXTA 1J21A 2D5BA 1Q15A 5IHXA 4F3RA 3CLTD 4MVYA 3COZA 2OV4A 1QU2A 1WXGA 3CLUC 4J75A 2J07A 3IUBA 4MVWA 1YULA 1M8FA 4BWVA 4JZYA 1K4KA 4PBTA 1MB2A 3L93A 3K32A 1NP7A 2PFSA 1K4MA 4YBRA 1J09A 3VU8A 5JBNA 1ZH0A 4MUHA 1YUNA 3DO8A 3P0JA 1JZSA 3X1MA 2YWCA 5DEOA 4MUNA 1EE1A 1EUYA 1X6VA 1NUSA 1MJHA 4EG1A 4YP6A 3GMIA 4XFJA 4AS1A 3CVXA 3A04A 3GLVA 3PNVA 1JIKA 1O94D 2CYBA 2HZ7A 3MLAA 4J76A 2ZUEA 3SP1A 4H3SA 3TQIA 1YI8A 3FIUA 3A05A 1MBZA 1YUMA 4MLPA 1FYDA 4PBSA 1WXHA 1QRSA 2VTBB 3ZXSA 4MW5A 1U7XA 2D13A 4EG3A 2VTBA 4CDMA 1O0CA 1O97D 1N78A 2VXOA 1J20A 1JIIA 2NZ2A 4CDNA 3CLSC 1O96B 2WSIA 3L92A 2QUIA 3HV0A 1QTQA 1NURA 2QTRA 3IOBA 1N2IA 4MVCA 1KAQA 1R6XA 4S1OA 2DLCX 1A8HA 1IRXA 4MVXA 5HG0A 1KKUA 2CT8A 2H2AA 1H1TA 4UZEA 2A1UA 3N8HA 4I6JA 5H7XA 2J08A 4KKVA 5HUJA 2CYAA 1NSYA 4I6GA 3I05A 1O95C 1PFYA 2AG6A 4MW0A 3HZRA 3COYA 1OWNA 3RBAA 3IH5A 3UC5A 3OP1A 4NZPA 1XNGA 2JAXA 4NATA 3ZUGA 4KR7A 3FNRA 3E27A 1OWOA 1KQNA 4MQ6A 1MC1A 2YWBA 2Z3VA 3ISJA 3MUEA 1G8GA 4MWCA 1M8JA 5J5AA 1M8KA 2CV0A 2PIDA 3TZLA 1QRUA 2EJCA 3IVGA 3RK1A 3ND7A 1TEZA 4EG4A 4ND6A 3MLBA 2IJGX 2J09A 4MUGA 2H29A 2CV1A 1O6BA 2X1LA 2Z09A 3RJZA 1N2BA 3SDBA 1WY5A 4PY2A 1IVSA 3IDFA 3IOEA 1N3LA 1F4LA 1NUTA 1TYAE 3TS1A 3C8ZA 1CT9A 1MRZA 2QTMA 4ZT2A 1F7VA 3SZ3A 4I6EA 1KQPA 4MUFA 1VBMA 1MB9A 2A1TR 2D54A 3D6UA 2PZBA 1I6MA 1JEDA 1WXFA 2DUMA 3AL0C 5DASA 1B6TA 3CLRC 3SYTA 4K0RA 1NUPA 4OJMX 2DXIA 2A88A 1K92A 1EUQA 4L2IB 4CT0A 4KR6A 1WKBA 1U3CA 2DPLA 4L2IA 4YP7A 4QRDA 2A86A 1N2HA 1QNFA 5FO0A 1ZJWA 3COVA 4MUJA 1VLHA 3TQOA 1TYCA 3ELBA 2EL7A 1QQTA 3CLTC 2A7XA 2A4MA 2G36A 4XFDA 4MWEA 1U3DA 3QE4A 4RUKA 1KP2A 4XSVA 1GTSA 1WJGA 4ZT7A 3FG9A 3GUZA 1LI7A 1N2OA 1GN8A 1Y42X 3FI0A 4ZCQA 4NAUA 1M1ZA 3COWA 1I6KA 1T9GR 3IMGA 1VBNA 3PNBA 1KH2A 3DPIA 3CVUA 4JXXA 3ZIUA 3VRHA 5J59A 1H3NA 3H9CA 3FY4A 3U1VA 3G6KA 5F23A 5EKDA 3AKZA 1F9AA 5FO1A 2E21A 3SEZA 4MULA 4AQ7A 2X3FA
chains in the Genus database with same CATH superfamily
4X1KA 4OHOA 5EKUA 4NZMA 1GV0A 3DL2A 4I55F 4EHNA 4DSAA 5CA0B 1ATZA 3P4XA 3R7LA 3GFGA 1D0SA 1DV1A 4WJZA 4WSOA 2FDCA 1ABBA 3JX9A 3GK3A 1N5LA 1E9BA 1M6HA 3GLQA 4GZLA 4NCIA 1F7UA 1FS6A 4UHBA 3JZMA 4XJTA 1I5OA 2XLBA 3MFYA 5KYTA 4V0LA 3VJMA 3ZCTA 4PG8A 2NO1A 2WTNA 5BNFA 2V97A 3IVRA 2ZRBA 4II7A 2B8TA 2VJOA 2X23A 5IG2A 2G8LA 4HSGA 1XPOA 1Y5LA 2NU7A 2REQB 4E5SA 3GEEA 3PPVA 1YH3A 3RIGA 1WBDA 3IIJA 2HA6A 2OENG 4MA4A 3C3KA 4MLZA 2VPPA 1SHJA 5AMXA 3FKJA 3LGAA 2PUWA 2A53A 2W58A 3MWJA 4ND8A 4CEJA 3W5UA 3KT8A 4DEXA 2H1SA 1HLDA 1KY4A 1M2NA 3H5WA 3HFSA 5CBKA 1L7EA 2AHOA 3LUAA 4LSMA 3UK6A 2QBYB 2ZJFA 3T3OA 2QI9C 5BOSA 1SVNA 3LNCA 2OHHA 4Q3DA 1QIEA 4YRGA 4OK6A 2VYQA 4IINA 4WXHA 2I3BA 1ZH2A 1W49A 1N2EA 4WK4B 2X9NA 4KQ2A 1Y5MA 4B35A 4C76A 2EFEB 3IMKA 2ZBQA 5IZCA 1SXIA 2HU8A 1RP1A 2PXAA 5BOVA 2BRUC 3JTEA 1DQYA 1TFRA 5K05A 3DMYA 1FRVA 1WR8A 4TZKA 2Z3WA 2J9YB 4IH4A 1QBGA 1SCBA 2I34A 2N9UA 1T24A 4F3YA 1D2CA 3RSSA 2COEA 2V7VA 3F2IA 3HSYA 3QVGB 4P4TA 2ET6A 2I8AA 5C37A 4LYYA 1K2WA 4ZOLB 4JMLA 1E3WA 3CX6A 1Q91A 4Q1AA 1DADA 4H35A 3CB2A 5J63A 3HJHA 4E4TA 4BUJA 1H1LB 4QUJA 1DU4A 2WVGA 2VCEA 3EVDA 1M6EX 1ZIOA 1GNVA 4N8SA 5DH9A 3TNFA 2BV3A 1LEHA 3G2JA 4BKQA 4FYWA 3UAYA 2YVLA 3EXHC 4OQYA 4AY2A 2HTFA 2FSVA 3ZV6A 4YYZA 3KBOA 4M88A 5CEFA 1EFAA 2A8YA 2HIMA 3CA8A 4E33A 4R68A 5L6MB 3UXEA 4MYTA 3ZV7A 3ZN2A 3AILA 1QIGA 4XWGA 3NEYA 3VSCA 2CJWA 2PDAA 4L8GA 5EGNA 1V3QE 3QW2A 3BB1A 3N6RA 5JMPA 3DLAA 3C41J 5BNZA 1BMFA 1IY1A 6REQB 3LMKA 1C29B 2C20A 1NIJA 3PNPA 4FB5A 1VKOA 4YA6A 3A70A 3L8EA 2ZUBA 4QPDA 2ORVA 2Q3MA 5MGNA 1GAXA 2VSQA 4LJSA 4YMSA 5C8VA 3V7WA 1UXOA 3LDFA 4OXRA 1Q44A 3VBEA 3DZFA 1HLPA 1QO7A 4PFKA 2O59A 2A78A 1VSUA 4JVSB 3FSRA 2XCLA 5SZIA 3UVEA 2UUBB 2AJTA 2QORA 5DULA 5TGZA 4TUYB 4MB2A 2G07A 1N2JA 3ESQA 5FKJA 4DMFA 3MWEA 4EMTA 1M1NB 1QDEA 2IPOA 4OGFA 3VJLA 4B71A 1ULZA 1DTWB 5K5EA 2ZT8A 1E0KA 4ZARA 3ENQA 3T9AA 3L7OA 3UUWA 5I8WA 4CEIA 3CF6R 3DVSX 2XXAB 5JMOA 4IS3A 1FFSA 4WNYA 3L82B 3PC6A 5ICMA 1EX6A 2VNJA 2W2TA 1Q20A 5FAXA 4GYKA 4EX7A 5LDHA 1QH1B 5H02A 4HQKA 2PIAA 2R86A 3CKLA 4OUDA 4R83A 2ZPAA 1YQEA 2A3RA 4U8HA 3WL5A 3ZS9A 3HZHA 4GIBA 2ZS7A 5L9AA 2AL7A 4EABA 3U44B 4OFBA 4E94A 3KT6A 5AK3A 5CB0A 1Q6YA 4ZV4A 2C7VA 4PYKA 4C0BA 1KC1A 4GYYA 2VH2A 4H9GA 4OHVA 4RDHA 2INGX 4HQ6A 3SQLA 3W1EA 1QLWA 1YRLA 2WYVA 3G2NA 4CTNA 3LUFA 1ADJA 1PK8A 3GP5A 1U98A 1PLLA 1YD7A 2OXCA 1WXDA 4PZAA 4QJ4A 1MTZA 3L7KA 4EGCB 4ZAXA 4NDAA 4F06A 1IHPA 1H3EA 5JC8A 4ENWA 1YS1X 3BHNA 1C3XA 3GFSA 3NNDA 4B6EA 3HI4A 4HAYA 3NP7A 3MWLA 4Q4LA 3TLGB 3DV9A 4JBGA 4Y18A 2C4VA 3SE7A 3W5SA 4ENRA 5JNSA 1KQFA 5JEDA 3QXGA 1H66A 1YB4A 2VDMB 3M4ZA 4Y2PA 4NJOA 2IHVA 2PWZA 4ED9A 5JS7A 2FPLA 2QMQA 3T3NA 2XNSA 3IE1A 2OYCA 1XMSA 2P9EA 3Q3VA 2AC2A 3WAGA 2C2XA 4RMNA 5BV1A 2DKOA 2DHEA 1GL3A 1YHZA 2WAMA 1IQRA 3DDWA 5F3DA 5FADA 4YRPA 2HV8A 2QTBA 3RM3A 3RIYA 1APBA 3V4PB 3W2TA 2VJAA 3JAMA 3TZQA 1Z6XA 4U7HA 5I9NA 1BZYA 1QC5A 4RPKA 3J7TA 3OQHA 2EKLA 4FDLA 3RS4A 3AOGA 4NMMA 1G42A 3UJDA 1NBEA 3OCWA 5DNVA 1LI5A 2X13A 3A11A 4MW9A 6GPBA 5I4IA 1V5IA 4I4NA 5FD8A 2J9FB 1Z5NA 1VZ3A 3SFVA 4EW6A 5K0TA 1XKQA 4H18A 2V7EA 2PG3A 1ATIA 1NW3A 4DPMA 3UBMA 1HA3A 1U4SA 2M98A 1ZCZA 2HCJB 3N5CA 4Y2JA 5ALEA 3TK1A 3HUFA 3TZKA 4CG0A 2DETA 4UE2A 1IUNA 3UB2A 4Q01A 7REQB 4NONA 3V1TC 3BXHA 5C80A 5CNKA 4DREA 1YS9A 1IXRC 4WACA 4ZC1A 3DVAB 3IXQA 3NHKA 5AHOA 1BCRB 1U7ZA 4AKSA 4NHEA 5JOQA 2G8NA 2NPOA 2Q5HA 3W5AA 5I9IA 3GRPA 1QJ4A 1C1DA 1LNSA 2LR0A 4S1WA 1U9IA 2YXBA 2P11A 3K16A 3O94A 4EKDA 1TIKA 2QIOA 1M2WA 4DDHA 4CF5A 3MQFA 4TV8A 5KTOA 4MA0A 1IN1A 2P7IA 3HFGA 1H8ED 1FRNA 1Z8DA 1NXQA 2YIVX 1AU9A 4AMBA 1GAJA 3QPVA 4NE9A 2AYZA 3HC7A 3D7KA 2BOVA 3S1LA 3SEAA 3NV7A 3KR1A 3VX4A 1BE0A 1MPTA 3EVTA 2RGAA 3PENA 4PBRA 4AUNA 3P52A 1NX6A 1CRQA 2MMGA 3ZTWA 4ITVA 5BN4B 4WZ6A 3Q98A 2F67A 1MOPA 2XDQB 5AKGA 2P77A 5AXBA 2PQ2A 2UXBB 1POWA 2E89A 4N76A 4XXHA 2DEUA 1E2GA 2VQEB 4HH4A 2FGKA 1P31A 2ZE7A 2BGTA 4X5OA 1RZUA 4L75A 1YTUA 2G7MC 1L1QA 1II8A 3BSFA 2HPVA 3OOWA 1AZLA 3L2OB 5AI6A 4Y2HA 1E3TA 3OE7A 2BVNA 1ZBDA 1MAAA 3SJ7A 3EGEA 1U0OC 4Z1OA 3TZEA 4C87A 2PH5A 4B4WA 5HIAA 4N40A 4WKGA 1YVRA 2FETA 2AQHA 5KNBH 2C1EA 4TMZA 1KVRA 4US1R 3U13A 3TFWA 1PQ4A 4MX8A 3M1AA 2GR8A 2IOHA 3L4JA 3WLTA 4LKRA 4JP2A 3GN1A 3RUIA 3EOBI 3FJOA 4JLBA 4K40A 4RZ3A 3L01A 1IUKA 4UULA 5FBHA 2HRQA 2Y9MB 3VAAA 4QJBA 4KAJA 3TB6A 4C0SA 4BJ1A 4TT3D 4MI3A 1XDBA 3BMNA 2ENWA 3QE0A 4PO9A 5F9FA 1XROA 4X54A 1E9CA 3ZE2B 5EPOA 3G68A 4MRAA 4CR7A 4I66A 5F51A 1XNQB 4DZZA 2EEPA 2PTGA 4MROA 3AEUA 4TKUA 2OC4A 2B4TO 3BD9A 4KDRA 4IFBA 2D1FA 2Y27A 3SDSA 4FXOA 4J49A 4QFDA 4ZO6A 3GJ4A 4UARA 4W8OA 1YULA 1Z7YA 4O02B 4DVJA 4PBTA 4AMGA 2G3DA 1U8AA 4EYSA 1MB2A 2BP7B 1U9JA 2PMBA 2UDPA 4I55B 4PSKA 4W6ZA 4AYWA 4BKOA 1OKKD 3K9GA 1HXHA 1LXCA 2P5TB 1S5PA 3HG7A 3QYAA 2WOJA 2Q6OA 2XCIA 2BEVB 4IHAA 1A72A 4RQBA 4FDTA 5DN6D 1BDIA 3A2NA 4KQGA 4BVFA 1U63A 1ZH0A 3TX6A 1M1YB 1OROA 3DDHA 4C5CA 1TKRA 2WU3A 1Z0AA 2FE1A 1XCBA 1NC1A 1GCUA 3HKEA 5LBTA 3BD8A 2RAFA 5AW8A 1L7OA 2NVUA 3KUXA 5DLDA 2RK3A 2IX3A 3FFXA 1QBKC 5CT5A 5K9ZA 1UQRA 3FRHA 1WCIA 3PNVA 3TEFA 2YOGA 1GKLA 2CL6X 2HZ7A 3O92A 4H3SA 3PJEA 1TD1A 2ZIXB 3DXFA 3KTOA 4CQLA 1CZRA 4FFDA 1KYZA 1E63A 2OCKA 4WCFA 3SC2A 2I2WA 4EFMA 4DWJA 3HM9A 1QLJA 2C5LA 2Y1OA 3QPUA 2VDUE 2AEJA 2QX7A 1P9WA 1O97D 1KEZA 2ZSAA 1U1IA 2RG1A 3PQ2A 5JU6A 2Z95A 1OA1A 2NIPA 3LQQA 3K0KA 3MZ0A 1L1FA 2CBGA 2FF5A 2ZQZA 2PH3A 1AS3A 2IA5A 3LDUA 2ZATA 4HTFB 5AXDA 2QF7A 3U3OA 2PUFA 1IWPB 3LYAA 5B1DA 3AVWA 5EWLA 4CIBA 4OLJA 1EQAA 5K0LA 1XDUA 1Y5RA 1GNSA 2F9FA 1D9XA 3TSZA 4TTVA 5FLXA 4U9HS 4F4DA 3K15A 2V8BA 1T1SA 2ZTLA 1Z7GA 3A9VA 3DDUA 1B42A 3CFHL 1FJHA 2G08A 1RBMA 3JQAD 3E70C 2FN9A 4M1QA 1FYFA 2B8WA 4P4LA 2H7XA 4PAMA 9GPBA 1CWUA 4C7JA 4AIRA 2JEOA 3JATA 3CUWA 4ML3A 3E5NA 4WD3A 5DYYA 1X3LA 1NLUA 4XTRA 1PS9A 2AG6A 3C3WA 4WZZA 5DRTA 2I9KA 2ZIUB 1EDDA 4XCVA 3FPBA 4PYOA 2JAXA 4R7GA 5E6SA 5LZ9A 1JEAA 3LY7A 1OX4B 4TXHA 3DGFC 3V4OA 3DE3X 2I4OA 3PFWO 2R2AA 3KOOA 1RBQA 4OKNA 5LQKA 2B6HA 4A1FA 1C3LA 1DAHA 5K8UA 4X44A 3EGXB 3CRZA 4MKIA 2WPNA 4PWZA 4BB6A 4MZDA 1BQ3A 5JRJA 1D5WA 2XXJA 1T26A 7YASA 4FMDB 1V16A 5ESDA 5DIZA 5LD2C 3ZHZA 1DBVO 3KWFA 1Y6GA 3O83A 5JEEA 4YRRA 2WSMA 1DFIA 3KJNA 2ZWAA 3NHLA 4EI8A 3BH6A 4FK8A 1OQAA 4PZPA 4IHQA 2ZPUA 4WMLA 5J47A 3TG8A 4RSGA 1AA6A 3QP9A 2HYIC 2RB4A 3PPWA 1XCLA 4JBXA 4WA7A 2IBTA 5ER9A 4C01A 1EVLA 4OHKA 3FNBA 4G5QA 3WLJA 1R4MA 3AEKA 4V3BA 1IONA 3V00A 3MAGA 3ZI7A 4MRMA 3GVIA 2ZSEA 2XT6A 5AR1A 2FSPA 3C15C 4RXUA 1PFKA 3IP3A 1AKVA 4II3A 4ZAFA 1KMQA 3ZCPA 2XUGA 5EHXA 5ENZA 1P1HA 1R0CA 1XCGB 4IDHA 2OBXA 5ALFA 1NJ5A 1WULS 1IEQA 4JT2A 1P62B 3WQBA 1P0CA 3ED5A 5EJMA 1N1GA 3FPGA 1I6MA 4R8MA 1X1TA 5TPWA 2JFVA 2B4RO 4J0CA 1GSHA 2ZJ3A 3M70A 1VKRA 3Q3JB 3L1IA 3HDTA 4L4YA 2OB1A 3VHLB 3CLRC 1PQUA 3L1HA 1RVV1 1S2NA 4L2IB 4FDAA 1VE3A 1X19A 1GUZA 2CHUA 4RNDB 2DSNA 1DDOA 4K26A 5AJYA 4NFLA 2V7QD 2A86A 1SC4A 1D2EA 3B7PA 4H4CA 3T3MB 5G02A 2CUKA 3CLKA 4K6FA 1A2KC 3UKOA 1E64A 2CFRA 4PLTA 1ECLA 2EL7A 2X6TA 1J5PA 4B82A 3D3WA 3TCXB 4BRUA 1ZUD1 2EJVA 2FFAA 2QW1A 3AQ4A 5JNRA 3CTPA 4MWEA 4CMEC 1N5KA 5KYKA 1G5TA 1KYIA 3K9BA 4YRJA 3RVOA 5KTTA 4RUKA 3RFUA 1FP4A 4KQHA 1T1GA 2WYWA 1TVKB 3U62A 3B3GA 4N01A 3JPWA 3GH3A 4HQFA 1LI7A 3THSA 5I7AA 5H3CA 2AYYA 4TQGA 3K9FC 2OV8A 3UK1A 1ZMTA 3LP8A 3TPCA 1I4TD 1GN8A 4HAXA 4KV9A 3DQQA 4G9BA 1YRYE 4WZAB 1YZGA 3TFQA 1ADGA 3UJBA 3GAAA 1DO0A 1O58A 3FROA 3NW9A 3NAZA 3FBWA 5JWHA 4OGGA 3WIBA 3L8CA 1RHMA 3DAHA 4P4UA 3EXIA 4H4DA 1H9AA 2W2PA 1E2BA 2XF2A 2WKWA 2DFLA 2ODPA 3M9XA 5G4LA 4Z2AA 4F91B 4QBFA 3WGTA 3NTVA 1JDNA 4OL0A 2HMUA 1RCUA 4Y67A 2CVPA 1QKIA 3RQIA 2PUJA 1YC5A 3ZQJA 2C5BA 4DTIA 1G3MA 1JBKA 1PN3A 2GVNA 4EVSA 4LUCA 5BW5A 3F4BA 1R0XA 1IJBA 2HGZA 2LBPA 2WE7A 3CW9A 3G82C 4L9SA 4EFNA 5IXYA 3GCGA 1EPUA 1XU4A 4HQ0A 3OUZA 5LB4A 1UC5B 1GTJ1 3PEWA 4N5LA 3SVLA 4U2CA 2AEEA 2FP4B 2ZI7A 1RXYA 3AJRA 3HLTA 5JSQA 2XSZD 3D3QA 4BMNA 5B3KA 1E2QA 2JGMA 3K92A 1QYRA 2O3JA 3KX2A 3HBMA 4HX5A 2ISCA 4EUSA 2W2LA 3PUIA 3HWRA 1C1HA 3H87A 3VYSB 4R8VA 1HM5A 5LVAA 3R7DA 1FSZA 1TJNA 3AUTA 2BI8A 4NP6A 3EOAI 1ZESA 3SHTA 2A57A 5LYJB 1KPGA 3AUXA 2GZRA 3LAWA 3PG5A 5CX4A 3SMVA 1YA6A 3WJ1A 3W7VA 4TRNA 1Q1ZA 4I19A 1FDRA 1ZO8A 1XVAA 2YVQA 2ZYUX 4FX5A 2YRFA 4HXFB 2JCVA 2O3RA 2J6BA 1E20A 5EJ4A 2WOOA 2GCPA 4TM8A 1JTFA 2JVJA 1W59A 1QU3A 3DEZA 2GLUA 3S29A 3SZOA 1YK1A 4DUGD 2NYVA 2PN1A 2X9GA 4F3KA 4UFPA 4AKHA 4ACAA 2H06A 1SH7A 2OGTA 4E2XA 1WDLA 1CZNA 3QEJA 4YUXA 1JU3A 5KJ6A 5LP6F 5BSTA 3MT0A 4MWTA 1KH3A 4KH1A 1XZKA 2NU9A 2XMDA 2Q7DA 3C6QA 3MLEA 1UK9A 2R6CA 1R3DA 3GP3A 3HCDA 4ZA2A 4BFVA 4L74A 3IDSA 3AG6A 1RAGA 3LK6A 3WP0A 1KJ8A 2WG0A 1I9CA 2CHQA 1F2UB 1QF9A 1LS1A 3HDHA 4Q3BA 4UATA 1UK7A 2FFQA 2I2DA 1CUYA 1L4GA 2J3KA 1BW9B 1RU3A 2R7MA 3IQWA 4QOFA 4D25A 1BROA 1U3WA 1TGVA 3SEQA 3AJ9A 3SZUA 4YUWA 5DB4A 3L79A 1QDUA 1XLTA 2BONA 5KEIA 4UUNA 3A3YA 1YAHA 3QOYA 5AJTA 2GZAA 4TX1A 1NBHA 3OKCA 3WWZA 2WWGA 1H2YA 4KRXA 4HEHA 1D2NA 2V0CA 3OH8A 1DRVA 1CZOA 2VWQA 1J8DA 1XKXA 2JJMA 3U31A 1AGPA 3EZLA 5EQDA 3NQ41 4GVLA 1U31A 2X7JA 2CHFA 4NOMA 4MV8A 1ZR2A 1K6MA 4KQKA 1TJ3A 1VRCA 1NUHA 3DD1A 4R40A 1VL2A 2C99A 4BBJA 1THGA 5CH3A 3A0RB 1FFAA 4QGFA 2GKOA 1E6CA 4PIMA 1YVDA 3M82A 4TSKA 4UBMA 4WESB 4CKYA 1SKAA 3NGLA 2NO7A 3DMRA 1LBHA 4P58A 2PKQP 3OZBA 3OE1A 1N2GA 3P4UA 4D57A 2O8FB 1CQJB 2YHUA 2CFOA 3LDGA 1NU8A 2YJ6A 4XYGA 4C4SA 4KFSA 4H7PA 1QHIA 2X8JA 3ICCA 2GBFA 4X0EA 1HL7A 2JA2A 3IBFA 1PVVA 4MK4A 3TL3A 1RM3A 5BQ3A 5A3QA 1I2BA 2V7XA 4LTNA 5MFZA 1ODTC 3PRYA 1K66A 1XCPA 4EKIA 1W44A 4JP3A 1H8HA 1MUUA 5C1DA 3H5TA 1U9CA 3RU9A 2J7PD 3DVQX 1OBHA 2IYAA 3VR3D 3DBHB 2OGZA 2BT4A 1IHXA 1VGQA 3CLUD 5BSMA 4FFLA 3ADBA 4B2IA 4JBWA 4EHLA 3X1KA 1OWLA 2CDAA 4LK3A 4M1MA 4C05A 4C06A 4CIYA 4CKZA 4AECA 1Y89A 5BSWA 1Z6AA 1I4WA 3A6GA 1T29A 3MC1A 1LDBA 1W7AA 1CVLA 1U8CB 4UUQA 1G18A 3L0YA 4XOUA 1ZMRA 3AP2A 2R4QA 4FEYA 1ZU5A 2IZ5A 1IIRA 2JJ2A 2ZBVA 4RIHA 4YJGB 4G5FA 1ULTA 4MQUA 4Y1GA 3PC8A 1V7CA 4KH0A 3V9PA 4CM6A 3IUSA 2ZJ5A 4YX9A 2BHRA 1MIOA 4IDGA 3CUSA 4QKQA 1ZGAA 4L5BA 3IMEA 3ZLUA 4BO3A 5AI8A 3TIIA 4EJMA 2C8JA 2BMEA 1UP6A 1AMNA 1K8RA 5G0UA 1VJ0A 2JFFA 3RRFA 2VRCA 3LT5A 3LPNA 1I7SB 4RVOA 1JDSA 3DOFA 2R85A 2PGOA 3GMDA 3QF7A 4NDNE 4G63A 4CUKA 1L7XA 5AHXA 3C39A 2I7XA 3CQ9A 3PUKA 1R6DA 2AN1A 2G67A 3H97A 4QYWA 1T0IA 2G3YA 5BNTA 3TYXA 5CGZA 1CS0B 1SWVA 2CNLA 1MGPA 2V0NA 3KOXA 1UXJA 1VMDA 3JD3A 4NOLA 2FQXA 2HNBA 1SD2A 4TWJA 3NDPA 1OLXB 1M83A 4IDOA 2M2IA 4U2BA 1EK2A 5FBZA 4R69A 2OZEA 1J2RA 2O1SA 4Q3CA 1OFVA 4FYVA 5J4YA 1BMQA 3N8GA 1CVIA 3QX7A 1WCYA 5IXJA 5C8DA 3BT7A 4TLLB 3F6SA 1M5UA 2XMPA 4PE5B 4UMDA 4B34A 1T3ZA 3EY9A 3UGTA 4YV1A 1W4AA 5HIJA 4N6GA 2PQ6A 3FLAA 4KI7A 1OT5A 2JZCA 3AWDA 4YAGA 3KJEA 1WZCA 1JJVA 3WJ7A 4RK0A 3UAGA 4HQLA 5BT8A 4WGFA 3MINA 2P91A 5GZ3A 4CN9A 1KFCB 2OD7A 2XR1A 3A1WA 1BXKA 3T0FA 3E84A 3FUTA 2MOKA 4M89A 2HK6A 1J0BA 4YMUA 7GPBA 3ADDA 3TAUA 4F6LA 1KJNA 3GEMA 1FVHA 4CMIB 4JI4B 1SEPA 3LRXA 1DEXA 5I45A 2NOAA 1XTQA 3LYHA 3SF0A 4CLDA 5BN3A 3AB7A 3DLPX 1NRWA 1OREA 3B6KA 3LU1A 3JWHA 4L78A 2BFEB 2BZSA 4AP5A 2XOKD 4IIJA 4BMSA 5JS6A 4KCGA 1T4CA 2Q1YA 3TL2A 5A3RA 2IEIA 1ZM4A 3HYSA 1UKBA 2WK1A 3BKWA 4CLOA 4F0JA 5HKKD 3J7AC 1BS2A 2CLOB 3HPRA 3L7BA 2ZAGA 2XZPA 1QYVA 1Y7PA 3A6DA 2R6HA 1AKTA 4NSNA 5HPYB 4RGBA 4XD7D 4DQLA 2I65A 5K8JB 1TYDE 4BU0A 2VT3A 4D44A 3RFTA 3DZCA 1FFYA 4UJ5A 2QRMA 1OH7A 1JMKC 1DEAA 1UBUS 2FUG6 2FG6C 1GPYA 1X8XA 2OGSA 4MUXA 3OUUA 5LMNB 3NVAA 1ZM3A 4AURA 5IC5A 1PL6A 5K6AA 1NGSA 3EEBA 1TU0A 4J0QA 3O4JA 4GWLA 3SBDA 1HWYA 1JU9A 2B61A 2ZRHA 4PSDA 3UMRA 1RBZA 2UUPA 2CFIA 4AQYB 3F6CA 1KI8A 1I1HA 4YR9A 4Z9XA 3AETB 1BE8A 3P0IA 3IOYA 2Q7OE 3WRXC 1EIWA 1Y34E 4U7PB 1P74A 4NNOA 4LE2A 3W5DA 4GICA 3WKBA 1TPYA 1A9ZA 1JLMA 1SXJE 1P1FA 4KBGA 1UT6A 4GOOD 1ZCBA 1LDEA 4DV4B 1PYOA 1DWQA 2I1VB 1G8SA 2VT6A 1S8AA 1JIVA 4YI3A 1M75A 2ZRPA 2EHJA 5EXXA 1YJ8A 1V26A 2BFNA 4PRZA 3WGIA 3EHDA 4YJ3A 3WGOA 2ZE8A 3EVNA 4IDPA 1Y8CA 2XMZA 4GBGA 5G0SA 1YB2A 1S7GA 1R0KA 2DFPA 2WF5A 3KR9A 2WTMA 221PA 5K3AA 3AF1A 3E9NA 1SXGA 1RKUA 1LC0A 5E3HA 4BQFA 1KFKB 3N8KA 2O5CA 1KI6B 3AY3A 4AJKA 1MO4A 1R6UA 3KKZA 1J21A 1Y6JA 1Y6QA 3TPZA 4RZUA 3TGPA 1FIUA 5JRZA 2WG2A 3VZRA 3HVIA 3PR2B 4LDPA 1XU9A 4XDZA 1Q0QA 1C2TA 4V03A 1YR3A 2DH5A 1OV4A 4R6XA 1JSXA 4YJHB 4JLUA 4NMXB 1W0JD 1WTCA 3ST7A 3WFIA 4UCFA 1U80A 4M8SA 4QBGB 4IV0A 4QJ3A 5DNYB 1XVVA 5KNLA 1C7IA 3BQNB 3HM2A 3YASA 3X2EA 4YWHA 2IHNA 1BC5A 2W2MA 5DNAA 3L0SA 4X71A 5DLQC 7AT1A 4OQ4A 1CJBA 2PX0A 2Q49A 2XA2A 4DIFA 2J46A 1JX6A 1YQDA 2F9MA 3DMDA 3DTYA 4WDQA 5TS3A 2PZFA 3ZNPA 5ICEA 1ZR4A 3GVHA 1VA4A 3RRJA 2HPHA 5CVJA 1ZONA 2Q41A 3MTAA 2ATEA 3QWIA 1SHLA 4K8RB 4LY9A 4NYJR 4WOKA 5I7EA 1MJHA 3OAAA 4F1JA 3IDZA 5FYQA 3AEQB 3C98A 2I2XB 4YP6A 2IWHA 4LVOA 5E4JA 4MS1A 4KTVE 1UQTA 3SBEA 2W71A 3WGQA 1RI5A 4PX5A 3PFNA 2PE5A 4YCCA 1JJAA 2PXCA 2ZRQA 4H3VA 2O54A 2EL9A 3EZYA 4ZVVA 3HYNA 3UW1A 3EWNA 5DCUA 3ZBPA 1TQDA 2AUMA 2VSNA 4Y2GA 3TRIA 3VHXB 1Z0KA 2ZCUA 3AHHA 3PFHA 5EEGA 2WHQA 2A5YB 4LOKA 1Q0LA 1QCCA 1VG1A 5H9VA 2R84A 4W8HA 4YV7A 4UOEA 4F93B 4TTAA 4KREA 2EEZA 2J9XB 2HH9A 3S28A 3BRSA 1DLJA 1XO1A 2PX5A 3EMBA 1Q12A 3L6DA 4TTTS 3WZMA 4MITA 3RRXA 3L40A 3DTVD 2I4MA 4Q9DA 4A16A 3OUTA 3F78A 1RE0A 1TT5A 1HMYA 2E87A 3GPDG 1R88A 4DMLA 2PBLA 1IRXA 3G2PA 5FOTA 3NTRA 1VMEA 4HYQA 2CB9A 5G53C 4BPRA 2HL6A 3QBTA 1M2VA 4HDMB 1PJSA 4ISBA 5EP4A 3BE4A 1SUIA 2W6NA 5GOZA 3UM9A 2PO7A 5HSGA 2BFAA 2R66A 3I04A 4TN1A 3N8HA 4IO0A 2XAAA 4RTRA 1R6VA 3ZY2A 2O8BB 3QVWA 1JKJA 2C8LA 2XVXA 2JVIA 4GPBA 4XCXA 3DDZX 2CYAA 2RBGA 4RD1A 3FR7A 1J9EA 2HSJA 1YDFA 3G5TA 3LLSA 4AZTA 2JD1A 5EWMA 1P8JA 4MW0A 3NEAA 4IFIA 1LSUA 3ZQ6A 1G20A 1NG1A 1Q2UA 4LZPA 4PSUA 3I9MA 4LMAA 4Q3NA 5AW9A 4F5ZA 5C32A 4NATA 4D4MA 5EFZA 1F0PA 1PL7A 4TVBA 5HEKA 2QQ5A 2CXRA 4G1FA 4WGGA 4IQ0A 4BMYA 2AIRA 6ABPA 1ENPA 1NA5A 4LOLA 1KQNA 4FHZA 3PB3A 3FHLA 4FBGA 2O4CA 2VVTA 5GWXA 4EHDA 1L4YA 3GRVA 4FHFA 2IHZA 5CG1A 4JSYA 5HFJA 4HL6A 2IS6A 1P2GA 1KY3A 3TZLA 1QRUA 3WLLA 4L51A 2EJCA 4PR0A 3ZZMA 1P5HA 1TAQA 2DHDA 3GRZA 5H8WA 3OJLA 1ZJ6A 3FPEA 3OJEA 5AKZA 5BP7A 1HNXB 2CLEB 1EHIA 4Q34A 3OQ1A 3W8DA 4EG4A 5BQOA 4BTVA 2J09A 3ICVA 3QPAA 2FQ1A 1KMIY 3SQDA 5F12A 3ZKWA 3VR5A 2EAUA 2WINI 3EFBA 5HYVA 1ODFA 3VC2A 3E5MA 4DA8A 3FOBA 2UV8A 3GCZA 3D59A 1RZRD 2ZUSA 2C0QA 3QPCA 5HP4A 4C5AA 4WL0A 5EIOA 1E96A 2G4LA 2F3SA 3QUTA 2AVNA 4B6RA 4EW1A 4GM4A 4QDUA 3ND9A 3JQ7A 1PT5A 2J3DA 4MUFA 1MB9A 2C5GA 4RJKA 4KNVA 1ZUWA 4LXXA 1VJGA 3W5BA 2I52A 4PIVA 4XYLA 1KBOA 3PHJA 4Q7EA 4BFSA 2BN4A 2IP2A 2WABA 5J2TA 4JJEA 4QDXA 1L4MA 5A05A 2H16A 2IGTA 3WQQA 1DEKA 2MSLA 1OH6A 1GR1A 3T7IA 1J4AA 3TDMA 2QR5A 3JQ9C 4IQGA 3NO4A 4N48A 4RVSA 1SBTA 1LFAA 4M9ZA 4N54A 1BDHA 3D3EA 2ZXEA 3PVZA 4JN6B 1EM6A 5P21A 3S8EA 4DR5B 2CMKA 2HA3A 5DCLA 3IEKA 4MUJA 3FWZA 4HEA6 1D6SA 4NCBA 1NAHA 2VP4A 3CNBA 3ODGA 4Y0VA 5CP8A 3VVCA 2IYFA 3E0XA 3QKIA 4DCUA 2ZVQX 4C4RA 1T2AA 1KETA 1U4NA 1U8ZA 1Z26A 2HC9A 3DZKA 4HD8A 4BX3A 3MD9A 4WVFA 3EVEA 2A9VA 4O4LA 4L0CA 5AK6A 4J7XA 5AOVA 4W5RA 1WJGA 1GU7A 1QGYA 2OB2A 2QSZA 3OJCA 2EU8A 4RHUA 4UASA 1W48A 3O7MA 4UVHA 4FYHA 1Y1LA 4F9GA 3SD7A 5JXHA 5ALMA 4IX1A 2WD8A 1PR4A 3K5HA 3H9JA 1R8YA 3RFXA 3FI0A 2P2SA 1C9YA 4FYXA 4AJEA 1SZPA 1YQTA 5AIAA 3WISA 2QTTA 1ZH8A 3GLSA 4RZXA 4G1MB 3R9WA 1V45E 4B32A 2F1KA 1SBQA 5FQNA 4FYYA 4M36A 5BR1A 2HFJA 4FBMA 1J99A 3BL6A 5TQJA 3ZE9A 3V42A 5JZMA 4PVDA 5JBQA 4LBZA 4MRVA 5BSVA 3B6JA 3EZGA 1GG8A 2XNCA 2P90A 5JXWA 4OBBA 4RGQA 1NKTA 1CP2A 2FI1A 2AHRA 3TEMA 1KQ3A 4TZ6A 3T52A 3D3NA 2LDBA 5DN9A 3MPUA 2ZBPA 2AXPA 1IATA 3E4CA 4C0LA 1Z0DA 2AD5A 4CCAA 2FPGB 2QZJA 1OVMA 2WQZA 2MTBA 4COOA 5KHOC 1KTIA 4DARA 3OX4A 1O96A 3KYDB 4FX2A 4LMPA 2FH5B 3FPJA 3PC2A 3OWOA 4LC9A 2Z2KA 5DM4A 4WOBA 5H1YA 3K1AB 2C96A 4KQXA 1US8A 3MILA 3I5UA 4W7IA 1HY3A 2BSAA 5FNVF 5AUNB 3NM4A 1BVHA 4UE3S 1EK0A 3NKVA 4ZFNA 5C35A 4LYGA 4DTCA 4Q3KA 3CVJA 2AKEA 4CIVA 4M0PA 5J1SB 1G2OA 3LE8A 3L0PA 1KIAA 1R64A 2OHVA 4I5IA 3UXMA 1LBQA 4RY9A 2GK4A 1XZJA 2J3IA 1VGRA 4M1YA 5I7WA 4AJ4A 1HFEL 3R3WA 4EITA 4MGEA 3TLJA 3TTYA 3PFIA 1UDBA 3HEBA 6YASA 2VUTA 5DM60 5EZ6B 3LPAA 5KNBA 1T9ZA 1EWRA 2ZBRA 5DHSA 3UICA 3ZQUA 5EXEA 3FSGA 2W00A 2I6GA 2ZYRA 2BF7A 3G9QA 3NYWA 4FFSA 2XNDD 3WWPA 3D4PA 2OPHA 5FV4A 2V9ZA 5TJHA 2QRVA 1DBRA 2QB5A 4NLLA 2GFQA 1NBME 2W42A 1BVRA 2XMBA 3HL0A 1UWCA 4ZODA 5IBPA 3SYRA 2VP0A 2NO9A 3GBVA 2W2XA 2A84A 1RIIA 2DU8A 1V4NA 1J70A 1DJMA 2MSEB 1T5OA 3HJTA 1CUHA 3DG9A 1XK6A 2OHIA 4RFLA 2I66A 4RNCA 2A0FA 2WFAA 2B1IA 4E15A 3M4XA 2WB4A 4F60A 2R62A 4ARCA 4JP5A 1Z28A 4L0DA 1ZVKA 5CB6A 4AZ0B 2CSXA 1GGEA 3JQRA 2WTXA 1ONOA 3HBNA 5EXPA 2ODAA 4YUVA 1GQOA 4HFMA 2O6HA 4QVKA 3DLBA 4K05A 2CF6A 4KLZA 4B5KA 2IP1A 1XAGA 2P5YA 3B1JA 4CQNA 5FBQB 2CV2A 5F2EA 3CI0I 1DUSA 3NM6B 1OC2A 3CZ9A 2AKAB 5KJFA 1COWA 3L8HA 4R2HA 4KXWA 3IL2A 4NL4H 2GYUA 4MO2A 1UKVY 3F7OA 1NR5A 4UREA 1DC4A 3CJTA 4CL3A 4Y3UA 4RDIA 1PTJA 2C9DA 1C30A 4BFLA 2X77A 1VPTA 3NV9A 1A5ZA 4CCYA 1DXOA 1Z63A 3WGYA 1Z16A 2AV6A 1LRJA 3GLHB 4YREA 2WIDA 5AJWA 4DW8A 3PQCA 4MH0R 2J5QA 3W2IA 4BO5A 1UDRA 2R8ZA 3HEMA 3OETA 3PQDA 3UWOA 3VNRA 1MFPA 3GC6A 2IIBA 3OZUA 3PR3A 4UHHA 5DI9A 2BFDB 3VHQA 1RLTA 4NBNA 1P5JA 1JE1A 2ZR9A 3LD9A 5FORA 4RD0A 2DR0A 1R0SA 2B8EA 1BTOA 1TCVA 1Y3CE 2GYYA 1PNQA 3LT0A 2EYUA 3NHRA 3SHQA 2QW0X 3C8MA 4ALMA 4DMRA 3G7UA 5K1ZA 2WUEA 5AJZA 1PWXA 5ITVA 2QRQA 4JGIA 4K9MA 4TT8A 4YJ2B 2C8KA 4ZQGA 1AZWA 2V55B 4FWBA 4RFSA 2HX1A 4MLCA 3GZNB 2DRIA 4JUIA 1IM2A 3AHCA 3RU2A 3OQBA 1C3OA 1X7YA 5A4FS 2COKA 1XJ5A 5A4MS 3VOBA 4CQMA 5A6SA 4FWTA 1K6IA 2V6JA 2ZDQA 3IVCA 3CN7A 4F6RB 1X14A 4R3NA 4EY8A 2DFVA 1XTRA 3INNA 4O5AA 3WADA 3B52X 1RJ9A 1PE0A 2C31A 3JALA 4I3HA 1BMFD 4IQ8A 4P54A 1HE2A 1FBTA 4RJ2A 1C0KA 1X1EA 2MR6A 3PXDA 4F45A 4AKTA 1JMVA 1X94A 4LZZA 1C9MA 4AWBA 2BLNA 4PGFA 1BJTA 1MVLA 1U8EA 1E3MA 4MW1A 1UFKA 3O8OA 2KI5A 4EJ0A 2VDOB 3JV7A 2B3TA 4IXJA 1VKHA 1DPGA 4PCAA 3KQNA 5HJEA 5J2UF 3UH1A 1ENYA 2PBZA 4QNMA 5H68A 3C3BA 4PYMA 3NCHA 1FFGA 2F8LA 2W70A 3TSCA 5LU9A 3FI9A 1SCAA 3ISVA 3K4PA 1HV8A 4FKBA 3WVNA 4CDGA 1P9NA 1VA5A 4Q93A 3RTGA 4S35A 4YLGA 1U1DA 1Q1BA 3A4IA 1C9DB 2GESA 5JALA 2FTKE 2GWHA 2R00A 3KPYA 5IJWA 4HMQA 4PZLA 3GCWA 4ZVOA 2VDVE 3GBPA 3ZE1B 4WLNA 1DNPA 3ETNA 1DAEA 3F96A 3QE2A 1FYEA 3KSAC 1UJ5A 2WWIA 4ZVUA 2PR2A 1MB4A 5JD3A 2KLHA 2XB6A 1JHZA 5K01A 4KACA 2BR3A 1J1IA 4OFZA 4HDSB 3D0OA 1X1SA 1B1CA 4G56A 3THXA 4CLRB 2NT3A 3ILVA 4J2OA 4HWSA 1HDGO 4QYXA 3REQB 5KOJB 3QBVA 3V8MA 4I1UA 2FXVA 3RKUA 1HURA 1ZJYA 2PLFA 3KWJA 3N0WA 2OGWA 1RRFA 4LOIA 5EI5A 1T6ZA 5BN5B 4HN9A 3PU6A 4Y6PA 1DBQA 1G21E 2QL5A 4DYDA 4F9TA 3LUCA 1IEXA 3LC1O 3Q7IA 2Y4NA 4X91A 4L57A 4RVDA 1DLIA 3P9RA 3Q5EA 2QD1A 1A1SA 3RRMA 3ZIAD 1U2PA 5EHZA 2Q5OA 1MORA 2H6EA 1XAHA 2NV6A 3ABOB 1S7CA 4AJIA 1NXOA 3IP1A 4W9NC 5J58A 3I61A 1SBNE 4WXRA 5EP1A 1WRBA 1JFFB 4EF5A 1XYVA 3PUZA 1WXXA 4GXQA 4Q9KA 3RFFA 4D4JA 4OH1A 1TYZA 1ILWA 3CPSA 3T1QA 3TRFA 2VK1A 2IQ5A 3TW6A 1QQ6A 3KOYA 2DTEA 3GELA 4CHTA 4DUYB 3CISA 2O8EB 4GUAA 4NAVA 4DHWA 1GTL1 3H9BA 1E8MA 2WUVA 3C8UA 3IGFA 3PIDA 5E7JA 4Z2YA 4Z49A 1SVKA 1YIAA 4ZCTA 4MJLA 3MCWA 2ZB8A 1X7DA 1RWWA 2JAQA 1KYWA 1FTYA 2HHJA 3EFOA 4IUDS 3ZI4A 1H5QA 3ND6A 3ESYA 3L04A 3LI2A 1V7QA 4Q47A 5LQAA 1C80A 1V96A 1QXSA 4EF6A 3B82A 4ADSG 4C43A 2A7QA 3UIEA 4KLRA 1IU9A 3GVPA 1EFPB 3I6IA 3SSNA 1W8IA 1NE2A 1NI3A 1OX5A 4QT0A 4UPVA 2JI4A 1XVTA 4OHUA 5LLTA 1XJQA 3NHMA 5C81A 4GXTA 3HY3A 4ZOEA 2LDXA 4JGGA 4R16A 4GEKA 4IVQA 3KALA 1VMKA 2OVBA 2IH5A 3OJXA 4BP8A 3Q6NA 1WZIA 1QH9A 3MIIA 2ZT7A 3N2YA 4JI5B 2GZHA 1XRPA 4MEAA 2E4AA 3F7TA 1WUTA 2MYUA 4IL5A 4L07A 3N28A 1BFDA 4LXHA 5DRYA 1PR3A 3FAKA 3L8DA 5F7OA 4LWOA 2ZTUA 3DM9B 4YT5A 4ALJA 4NJMA 3DZDA 2PPLA 1JWBB 2EZUA 2I33A 3H0CA 5DSZA 5C3UA 3P97A 3STWA 2VP9A 2LCIA 4Z9BA 4F4HA 2J59A 4JODA 5BQ5A 1F6WA 3KOWA 4BRSA 1IIBA 4M37A 2X0RA 1N6PA 2ZS9A 3R7NA 4DNOA 2F55A 4Z6KA 1BOFA 1II0A 1EFVA 2RHTA 4NCJA 1NMSA 2H2DA 4H3HB 5E95A 4CKBA 4WY5A 1ENZA 4ZVPA 2BFFB 2X1MA 4LGMA 3MXTA 3PS9A 1TADA 1P29A 1O6CA 4IPTA 1TJPB 2IEYA 2A9PA 3U7EB 3UV3A 3RC3A 4BNIA 1NP3A 1ZNQO 2O6LA 3UAWA 3SSAA 2QT9A 5PGMA 5DHAA 2FLVA 5TX7A 4ZO9A 3PQEA 1V8PA 1USVA 4W8GA 4D3YA 4PNPA 4BWVA 1LNZA 3UMFA 1I2ZA 1VYHA 3V2GA 2YW2A 3ETDA 4UVDA 1O8BA 3SN6A 1GDTA 3EUFA 3GDOA 3PFKA 4ARUA 3Q7RA 4V1CA 3HVHA 3E05A 4F7DA 4Q1EA 1P75A 1USWA 1W1UA 5BW6B 1KF0A 5FNVB 5BORA 3CJRA 3HGTA 4BN4A 1XXHE 3BAZA 3WBBA 1EUYA 5CXUA 3PFGA 2YV3A 3BG5A 5B7NA 2A9KA 2Q6LA 3EAQA 4LV6A 4NC9A 2EZ4A 1GYQA 4G8JA 4H08A 5D3MB 3V3KA 3Q3EA 3Q41A 3B78A 3DB2A 5F73A 1LPAB 4X6YA 1AGNA 3DAYA 1AC5A 2RAVA 3QYPA 3WSWA 4AWXA 2J0VA 4YB8A 4BNJA 3KB8A 4EA8A 2JFNA 2NYAA 3CSSA 1EBFA 4OBEA 4OHCA 1J2EA 3PF9A 3LQKA 4FONA 3SEFA 3ZGVA 1SFRA 1PV2A 1E8DA 1WHSB 4CDMA 1O54A 4MWOA 3F5FA 4K2HA 3NOVA 4L9WA 1FSFA 2G9ZA 3TDNA 3QV2A 4CDNA 2YXEA 3KEMA 1P18A 4HPJB 4NK5A 5IJ0B 5LJIA 3L92A 3OEHA 3QJYA 4RH0A 4DN6A 2QE7D 1P0QA 3KFVA 3I8SA 3N5KA 5AVYA 3OLZA 3HBFA 2PUHA 3M6VA 1I10A 2BHNA 3EIWA 4MVXA 1V5GA 3DHYA 2WU4A 5KPDA 5IM4F 1FP6A 3F98A 2X19A 1Z0IA 2XVAA 1AQUA 3KP1A 5A0TA 4YCMA 2H2AA 1H1TA 2WKQA 3IALA 3PDCA 5GONF 3WIVA 1R5BA 3MOIA 3AVTA 2I87A 4HXEB 4Y2YA 3CMMA 3K2IA 1MXFA 1O6ZA 2CK3A 4LCJA 4RCVA 2JH9A 1JDUA 1R8XA 5HUJA 3FOAA 2CBZA 3F97A 3M5CA 1QCZA 1XKTA 1RAAA 3W3AH 1VPLA 4A6PA 3ZW8A 1W2HA 4RK7A 4K2AA 3H5OA 5EPUA 1ODJA 5FUXA 5CFLA 5JNUA 1XNGA 2RHRA 3BRWD 1G64A 4EFLA 3D4LA 1T8TA 4G5RA 3UPDA 1DJLA 1CHNA 4N7RA 4ZXFA 3E27A 3Q3HA 3LIIA 3UNXA 4D9GA 3I5XA 1A98A 1P4RA 1CDOA 4BJ5A 1UBKS 4HDNA 5ARCA 1E7SA 3G0CA 2Q3CA 3LQ1A 1FZTA 1YVUA 2JHAA 5FDFA 3LCMA 4JQOA 1D1SA 2PIDA 1XF9A 3MJCA 4ZAYA 1CX9B 1SRQA 3EEYA 3WAKA 3ZWKA 4YRNA 2WDZA 4K9RA 5AM0A 1M7GA 1L4FA 5BN1A 5BV8A 4M53A 3H9EO 3WC4A 3UKJA 3GRCA 3LSYA 4JJZA 5CH8A 2BMWA 2YN0A 4ND1A 3K6SA 2XQKA 4IKPA 5G40A 3N7TA 3O03A 3MGCA 1XQWA 5T8KC 1T91A 3BYZA 2EBFX 2WSLA 3W5IA 2Z6VA 3GT7A 4LC1A 3SDBA 3ZGLA 5I4KA 4Z4GA 4JV5B 4DEVA 2ZS8A 1VKNA 2YYAA 1TA9A 3NOOA 1NUTA 4CMGA 4M0DA 2CDRA 4X6LA 3FZQA 2OR3A 4TV8F 1YR6A 3OPYI 2IYPA 3P2OA 3QZUA 4P7KA 4PPGA 4UVIA 3EJWA 3L07A 3IAM6 4Y2VA 4C7MA 1YQGA 3MCAA 1DIHA 1EUCA 3D6UA 3QFSA 3SIWA 3QVSA 1DEHA 1UAGA 1JEDA 2QP3A 2D7CA 2SCUB 2TMDA 2W22A 3RBZA 3DCNA 4JITA 4EPVA 5HJ7A 3AUJB 3EFHA 2BZGA 3PIRA 4QGAA 5BYKA 1J2JA 1SPXA 1TXGA 3DWIA 2WM8A 3KB1A 1WO8A 1F5NA 1ODKA 5IJ9B 3WHLA 1U5BA 5E38A 1ZLYA 1A2BA 1GT6A 1MR3F 2BI4A 1VXOA 2VDRB 3IULA 4RK1A 4KR6A 5E2BA 2HA0A 1EIZA 4BATA 3HJGA 3RS7A 2I1WA 4EP1A 4AJJA 1M6VA 3OIUA 1JJFA 5IEBA 5F7XA 1X38A 1YE5A 4NS4A 2L2QA 5DM0A 4C6TB 2NXWA 3W9BA 5JSUA 3DBOB 5CCXA 5KNCH 5J2UB 2DBRA 1VFPA 1R10A 1DINA 3H2HA 2YWEA 1IUOA 4HLDA 4JEMA 1EG7A 1HDOA 1HFJA 1JU4A 3T7JA 2UZ1A 2JLAA 2V65A 1EFKA 3LLMA 4EMSA 4YAFA 1OIWA 3T5AA 4KQ9A 2I29A 1UPCA 3AIOA 3OMLA 2XWQA 1ZIYA 5AVKA 1D3AA 3N2EA 4I50A 4WASA 1Y9AA 2Q0HA 4KODA 3RTAA 3CR3C 3OHSX 2NNLD 1BFKA 4FFOA 5LN1A 2DFKB 4BX8A 4UBLA 5B57C 4HAVA 1JNYA 3QUBA 4LA4A 1SO8A 2HSZA 1NOIA 3OQ6A 3W4JA 4D8YA 5AM3A 5C8YF 3PK0A 4M46A 5BXYA 3CX8A 3B3FA 3DKKA 3HA7A 1KK1A 3LC2O 3IEPA 3OFND 1JQ5A 2B30A 4QBHA 4DOMA 5KMGA 1I3LA 3GGOA 1FFEA 1B43A 2G1JA 3BMQB 4QUEA 2Y4OA 1JEQA 1ZH4A 2YICA 3QSGA 1SA0A 4HDCA 1RPZA 1E9FA 3MJFA 3FYUC 2PKQO 3VPCA 3PDHA 3I6QA 4OYLA 1E0JA 4X1KB 4IFTA 4KWCA 4E11A 2Y9PB 1RPNA 2DG2A 2H18A 1CUUA 1MAWA 2NWQA 4N6NA 1CQZA 1GZHB 3DVRX 3E9EA 3FTFA 5B2FA 1RJGA 4WH0A 3QBDA 2OSBA 5EC8A 5CJPA 1IOVA 1EGHA 1SCNE 2IELA 2IXDA 1FQWA 2ZUUA 3E53A 4MPTA 3TQSA 4J2HA 2ZZMA 3AUSA 1U9YA 1QFSA 2J30A 1Q0TA 1C81A 5EAIA 4Q9HA 3VVMA 5P8WA 1O97C 1GGHA 2ERXA 3U7HB 4AY5A 1CVRA 2NU7B 2ZAIA 3QW4B 3O3NB 1MF7A 2FB9A 2TS1A 3L18A 2EJWA 1GDDA 1ZOPA 1GUFA 1M8GA 2HMYB 3HN2A 3MBKA 5EEHA 2Q0QA 3ZVRA 5HUQA 1IG0A 1FDIA 4ZD6A 2B1QA 3LIPA 4BFCA 4ZEXA 4OH7A 5DT2A 1YA4A 4K86A 4JYZA 4CEJB 4F3TA 4ND8B 4I8IA 3QVMA 2ID9A 5BRAA 1CJVC 4L5YA 5GADl 1G21B 4XWYA 1J5XA 2ON6A 3HN7A 4H15A 4TS1A 2XKBA 4FYMA 2GKGA 2IYUA 1KE1A 1Z4MA 4Z9FA 5BOSB 2BFPA 2R7KA 1X8KA 1K7FB 4FMCB 3RGGA 3A06A 3VXKA 1SCUA 3DMTC 5MGBA 3IOCA 1DKLA 3VSDA 5LU8A 2QG4A 5TT1A 5HS4A 2ETXA 3OZVA 3MUOA 2E4YA 3KR0A 2GILA 2OQIA 1UF9A 5JI2E 1ONPA 1RCTE 1WVMA 1ZK1A 2IODA 3R7SA 1RC0A 3RIHA 2X58A 4FGSA 4QXMA 3K1ZA 3TOZA 2GK7A 2W2LD 1HRKA 4G24A 1ZK0A 1E3WB 3E7XA 3P7MA 4KLAA 5B58T 5KTSA 5ISMA 4ID3A 1GL6A 3PSAA 4K7JA 1D6NA 1EWYA 1V37A 5LP6C 4GC9A 1KDVA 3IKVA 4EB6A 3D1JA 5TGTA 3OO1A 4URXR 1XXLA 4CG3A 1G5FA 1H6AA 4Z86A 3PT9A 3ZJ5A 5CNMA 2EWWA 4HQNA 2FZCA 1GRNA 1OIXA 4GOND 1AT1A 2RAUA 3FYHA 3FPHA 2YVAA 4F1KA 5AW1A 4KPGA 3GRUA 3IV6A 1R7RA 2VDPB 1XN1A 2DBYA 2CJWB 4IY1A 2NUTA 2Q1UA 3NKLA 3W2EA 2ZREA 4R1NA 4YRSA 2VBFA 3FDXA 3IMCA 1OFIA 2HMTA 4RCZA 1LDYA 2NAFA 1ORIA 2WUDA 2ZUDA 4CIDA 5BRJA 4XR9A 2XMRA 3OMWA 1N1MA 4EW3A 1UJMA 1P4SA 4NBWA 5AI0A 3S7ZA 1FTSA 1ZMOA 2QN7A 4YP5A 5EWJA 5DM70 1N7GA 3AKEA 1FPQA 4KR3A 1I1QB 4YXWA 4EZIA 3NDRA 1VG8A 2FX2A 3MWEB 4FW8A 3OESA 4BTLA 1PLKA 2LVBA 5CEJA 1UJ2A 4P36A 3T7RA 1HT2E 5LZ7A 4BLQA 4TSFA 1W88A 2KPOA 3H2GA 4BP3A 3WOHA 1NRIA 4ECAA 5C1PA 3SY8A 1ZUNA 3ZY6A 3L06A 2PGIA 4EQZA 2BYTA 2CLSA 4UNSA 1B3RA 3EUWA 2PKWA 1UBJS 3HJCA 4L02A 4NBVA 5A6VA 4OUDB 1MLDA 1TNDA 1FDWA 1KDTA 1T9DA 3LGXA 1OUMA 5JHHB 3FPLA 4Z51A 1TFUA 4N0DA 4B6OA 1LCIA 1S3SA 3HCRA 2PZAA 3DKPA 3ZCRA 1LSOA 4HGQA 1NJ8A 3OP4A 1X7ZA 3Q7TA 4EHHA 1A7KA 4LMRA 1N0UA 2H1IA 3DL0A 4ARZB 3EOZA 1IM8A 3A0UA 1VCOA 1A8SA 4IGFA 1D07A 3PXEA 4ZVNA 2OHGA 2FKAA 2GCNA 1KI1A 2WJZB 4CFYA 3E3OA 2OFFA 4AG3A 5JCJD 1E1QA 4ZT6A 5MHTA 1SGWA 1I33A 3L49A 2CCKA 1ZOSA 4GI2A 2QTLA 2QAGC 2VK4A 2ZIWB 3OBIA 2HPZA 4FOSA 4IMJB 2PSEA 4QFBA 2DHRA 2NM0A 5IULC 2ANCA 1VPWA 1N9GA 2WC1A 1PR0A 4R8KA 2EDCA 3Q9UA 1TUBA 3H19A 2PEYA 3UHOA 2Z56A 2GZDA 2RKBA 1H8HD 4L72A 5HE8A 1EP3B 1NSTA 2FCAA 5KSPA 1DI0A 2X7HA 3FOCA 4JLDA 4NZNA 1GKIA 2UYYA 3A2MA 1JEYA 2R47A 4J0FA 2BTEA 2BR4A 3PUVA 2PSHA 4QRIA 5EZYA 2JLUA 1TC2A 3CLSD 4WINA 4ARIA 1C7QA 3PTAA 2JFQA 3VNAA 4FKZA 3PFFA 2QVXX 2QNRA 3MSCA 4B6FA 2R1TB 4ZCPA 3JRWA 5K3DA 1YNOA 2DR2A 1TQ4A 1QZXA 2Q1TA 5EIWA 1I80A 1FF9A 1I0ZA 1R9JA 1SOVA 1TIPA 5FWXA 7ABPA 2F17A 3NIWA 2IYNA 4S12A 1ZGZA 1P5FA 1MRSA 4ZHQF 2COUA 3VU3A 5KZMB 1KHHA 3OMXA 4JKOA 2G6TA 5DVZA 1ZRMA 1JHQA 1X74A 3P19A 5LIPA 2VEDA 1T6XA 4C4TA 5K0FA 2IXAA 3UGQA 3DFKA 5CCEA 1DQZA 4KHPB 2IYYA 1KPIA 2WMNB 1KWKA 1H22A 5AKLA 3ZX4A 4B9EA 1C1DB 1O57A 1DVRA 4HUQA 3WXMA 3BE8A 3IKMB 4ZWNA 5CLJA 1FXWA 1EFUA 2XUIA 1H2EA 3OVMA 3PZBA 1R0WA 4QBTA 2IYRA 4AW9A 1MJFA 3MJTA 1ZYUA 3LYUA 1JQEA 2ZZNA 1Y6FA 3QFRA 4P22A 1TVCA 3HL4A 3WLIA 4R1QA 4NBSA 3ENKA 2HQSA 4DLVA 4D4LA 2UYCA 2LV8A 3GO4A 5BQPA 1ECBA 3HBLA 1M1XB 1N5DA 3P5SA 4JCOA 1RC1A 2X4GA 5HOEA 2X6RA 2EBWA 1YRBA 4GD3Q 3LHFA 3NIGB 3BXFA 5HNKA 1E0SA 3P2IA 1KGSA 1K6XA 1LPSA 3FE2A 5HF9A 3E82A 2VZ9A 4G1VA 3BXGA 4BQRA 1OLUA 1SURA 4PLVA 3E7FA 1W8DA 1YIOA 4MV0A 2LCFA 3CU5A 1I2AA 3NRJA 4BX2A 4E70A 2UYHA 3TVTA 4RV9A 3OEYA 1E1MA 2IHJA 3GGSA 5TIIA 4ZQHA 3T38A 2CJPA 2QVYX 4X1YA 5EJAA 1JFRA 3C3JA 3SKVA 1NI4A 2GF2A 5AJXA 1Z7WA 4MDYA 5HWSA 4RD6A 1D9ZA 1UBFA 5KDLA 3EZ9A 3G59A 3ZBUA 4CI9A 4HEQA 1QS0B 2HHLA 4BGUA 3F2VA 2O2GA 3H83A 1YZ3A 2UYGA 2OILA 4FJ1A 1I30A 3E61A 3NUZA 3RBXA 4Q7LA 2HCFA 1HDZA 4ZYLA 1YRQA 1K8XB 4TZ0A 3UJ7A 3BVPA 2CXUA 2FPRA 2IGBA 3BMNB 4ZVRA 421PA 4BQIA 3OTOB 5CYFA 5DKFA 1VHLA 2D5BA 3B5IA 3NB0A 2PZEA 4WFIA 4D0LB 3SYLA 4E5DA 1GG9A 2QA5A 4QGBA 3DOJA 2AI3A 4TKUB 4PICA 3VJRA 3DWEX 2CCJA 1DAKA 2Q29A 2WSSA 4UHCA 1S2MA 4W1QA 4ER6A 2IUSA 4JLVA 1C1XB 3UT5A 3DDSA 1YB6A 3CLUC 2DPHA 3F3SA 5ECYA 4BZWA 3IBCA 1GRVA 1L4LA 1VRWA 2ECPA 2GXSA 2P27A 1T8UA 5BWLA 1U81A 2QDXA 1EJ0A 3HO8A 1SKMA 2GNAA 4FFBA 4LOAA 4UPDA 1GQRA 1UDWA 1NP7A 2PQMA 3QJGA 1FVXA 4P38A 3ZC3A 4A2WA 2JLZA 4YQYA 2R25B 2R8PA 3ZLBA 4F2GA 4PFQA 4HVCA 1O9HA 2OO5A 4EY6A 3HKEB 1LA2A 3OZAA 4U9IS 4BZXA 3GZ4A 5FI3A 3ZTYA 5AUPB 4D9CA 4YH1A 2NVUB 2PNFA 1C9JA 3GLGA 4PYLA 2IYSA 5SZKB 3D4NA 1R37A 1Z4NA 4JKIA 1KJQA 1WCIB 3IKJA 5H80A 1QH8A 3SX2A 2E4ZA 3FLBA 4C7KA 4CM8A 4CQLB 3DWFA 3QTLA 5F5NA 3RU3A 2B1RA 3VDXA 1QF6A 2VXYA 3NG1A 2RKWA 1WKVA 2FW7A 3SC2B 4WCFB 1KE2A 3TD6A 4E2FA 4L76A 4BFUA 5C7LO 1YUMA 1ABFA 5IVDA 4A5SA 3ZHQA 3LWZA 2QRGA 4GC5A 3W77A 1QRSA 5EE1A 3RT1A 4EJSA 3TOSA 3QVOA 3FCOA 1SK9A 2A9JA 3EC2A 3OEWA 1XKLA 4ICIA 1TO2E 3T9EA 3ABZA 3IXMA 2WF8A 4G8DA 4NOJA 4E12A 4GP7A 1J42A 4N82A 2P0EA 4BLVA 2I6SA 2QUIA 4TKVA 1DZIA 3FXAA 5EWLB 4JI3B 2P4SA 4R0VA 5B2ZA 3WJAA 1NW9B 4HNUA 1VJCA 5DGIA 3LA6A 5CHEA 5HRUA 1BYIA 6ADHA 5UKDA 3NDIA 2JGNA 1B8UA 4UAJA 4A5OA 3S8MA 3LLUA 4D4IA 4XSHA 5LLDA 2A1IA 3R9XA 1F20A 3K1TA 2W6IA 2VR1A 4QOHA 4L3OA 4PGAA 4XVUA 1KZYC 5DNCA 2PH7A 3GF4A 4WUVA 2Q28A 2O2HA 3JATB 4MPDA 1JR3D 1MEJA 2JJ1A 5H7XA 4EI9A 1F3LA 3OAAD 3WRXA 3ELUA 3WBFA 1C7RA 2G6BA 4AJOA 2WHRA 3F4KA 3VO2A 1KEPA 1Q7EA 2AF3C 4QYIA 5H70A 1Y98A 521PA 1ZKDA 3HZRA 3CNLA 5E6SB 3OQIA 1DO2A 3IH5A 3MT9A 3VZBA 2AXEA 3WQHA 1GZ3A 4EKYA 4GDFA 1P72A 1J33A 1PYDA 3D8BA 5F78A 5ALNA 4IHKA 2VAWA 4HN2A 2YQ4A 4DBLC 1GXSA 2C5AA 1R18A 3EEQA 4OREX 3WLMA 4BLRA 4XM1A 4TTQA 4I81A 1WLSA 5TNXA 1V16B 2GO7A 2NXCA 2Z3VA 4CM7A 3STHA 3VO8A 3KYBA 2RH9B 3BCHA 3ECAA 1XCJA 5FHQA 1E61A 1O08A 3OIDA 4UNRA 2Z9BA 4HLNA 1H2AS 3Q2KA 1YZQA 2YQZA 4IIJF 3RK1A 1XV5A 3M7IA 2PVPA 5IKPA 4G0OA 3Q7QA 1SXHA 1P2UA 5J4VA 1A8QA 3TVYA 1HDXA 1R4MB 3AEKB 1TAUA 5FT9A 3ODPA 1XQVA 2FEPA 3OCVA 5F64A 2WVHA 3TW0A 3FMVA 4IZHA 4MRMB 3RYFB 5B7GA 4JAVC 4IJWA 3W5CA 1Y1SA 3ADPA 1NU6A 4FZ3A 5IRCD 1QRDA 2FDXA 1NQXA 2GH1A 3V80A 3TS1A 3WK9A 1PJRA 1RHQA 5AUOB 1CT9A 1IAQA 4UQOA 3EIXA 4S0XA 1U0RA 3OG9A 1LV7A 1UAYA 2EJUA 4HWKA 3TSWA 4FOPA 16PKA 3UAVA 4AZ3B 5TPWB 4M76B 3ZOZA 1VBMA 2O2IA 1G1AA 3ZU5A 1AXGA 4ZCMA 1A4UA 1JQJC 5BUQA 3T1HB 1NVAA 4KZKA 1WXFA 4YJDA 5KAPA 3IUQA 3HB4X 2I2BA 1SVSA 4PZDA 3PUXA 3AL0C 2OESA 4PYIA 4BGEA 3VMMA 1J0EA 1KARA 3DUWA 2P69A 5HJ5A 5BWCA 4IXWA 3LWDA 3DNPA 3E1SA 1JLLA 3U3RA 1K5DA 1OSNA 3PGJA 3U3XA 2R97A 3NTOA 1QNFA 1U0JA 1IBCA 3GJXC 2PYDA 3RC8A 1I3OA 2MHCA 5B2EA 3K09C 5M29A 1FS4A 3T1VA 2WIFA 3D3WB 3MAAC 5CH5A 5KB3A 3MFQA 2C5EA 2NZUG 4LQCA 3ZTTA 1RYMA 2YHSA 4L6CA 1L5HB 4Q4HA 4XFDA 3UJ6A 3WL3A 2QGFA 1FP4B 4Y1RA 2PCJA 4YJ3F 4KNYA 2VA8A 2I6UA 3BHJA 1TB4A 2FUG1 2ZUWA 3IEUA 1E9RA 2NSJA 2QXTA 3UEOA 3R0ZA 3BK7A 5KTRA 2CLFB 2N3ZA 1P7ZA 2DUWA 3KDSE 1T4GA 4G0YA 3IP8A 2CEAA 5EL0A 5G3YA 3GCXA 1YWGO 4L73A 2JIZA 2AMYA 2BGLA 1GPKA 1NM5C 3IMGA 1KZ9A 2ORIA 1KH2A 3EXIB 2WIGA 1I4OA 1ZNWA 2CY0A 3DPIA 3QHPA 4L3WA 4RHXA 5CTAA 1QYDA 2V58A 3ZWQA 2AG1A 2P40A 3G23A 1EDBA 3IFSA 1NQOA 4S1PA 4D9MA 4ZK6A 1SUFA 3MA0A 3C3MA 3O8NA 1JXOA 5GJBA 1OHHA 1I7LA 4L8VA 2G1PA 4JSTA 1GWNA 1VG9B 4G4SP 2OBNA 1EM8A 3DV0B 3G6KA 4IJ6A 5D5QA 3H2IA 3ENZA 3KK0A 4KG7A 2QZZA 2BZ1A 1KDZA 1J8VA 3ETJA 3EIUA 3Q3CA 3X1XA 4F96A 3AL2A 5JE8A 2OCDA 2FWNA 2XCUA 1F0KA 2NVBA 1XVUA 2WIKA 4ZYTA 1P2BA 2A1TS 2Z5FA 3A1UA 1UKEA 4K6MA 4F3NA 3DBLA 4OKSA 1Z4LA 3IQXA 3TRJA 3WBKA 2V7UA 4QBKA 4F6CA 3ELYA 2M6KA 4QGGA 1PO7A 2EQ5A 4KIJA 3WSVA 1EINA 3X1WA 5K20A 1P1IA 4CXMA 5KYYA 1DTEA 1IBSA 4FGWA 2G9QA 4MTCA 4Z0TA 2PRSA 2Z83A 3H6HA 3I1JA 1WQ4A 4PCVA 3UQZA 2QN6A 4ZYWA 2C54A 3LV8A 3VJKA 4IJUA 1TCAA 3UWSA 1WB5A 3DE1X 2GPJA 1AKQA 2Q4DA 1Z6TA 1R5NA 3Q6MA 4K9NA 4OMUA 1OZHA 2Z1DA 4LWQA 4UNIA 4Q16A 1LD3A 2A14A 2YFQA 1VHQA 3CRW1 4JBYA 1BKSB 4OMCA 1WD5A 3C1AA 4X20B 5DNUA 4BGDA 4HBZA 2YR0A 1E79A 3UK2A 3A36A 3GWZA 1XEWY 3I3OA 4HWPA 4N0PA 1GPWB 2YJTD 2AJDA 1Y8RA 3HZOA 4MI9A 5DI3A 3W34A 3DEFA 3T3GA 5BQXA 3CVWA 2NU9B 4JIMA 3PQ4A 3VPGA 1I13A 3ZE7A 1THTA 2DFDA 3UWDA 5DGXA 4U2GA 3VDRA 1G20E 3S2SA 4AJNA 5JMWA 2QZ9A 1EVKA 2QD4A 4OP1A 3UY4A 4PLHA 4MV3A 1D4FA 2IXFA 3FYCA 4JBHA 5CR9A 4HFNA 3WLRA 4OOEA 4BE7B 5LM3A 1GUAA 3I9JA 2OP1A 1D04A 1P9OA 1PZMA 1T9HA 3MWGA 3QMVA 4OBWA 1WEHA 3QWAA 1AHIA 4U7WA 3OU7A 2FR8C 2GVDC 1QORA 4M7OA 2F3TA 3U61B 4AX8A 1GU0A 4RF4A 3JQ9A 3AG5A 2PR7A 1TZ2A 4LXTA 1ZUHA 4QGHA 4A9AA 2RK4A 3QSYA 4Q15A 2F8SA 5K8VA 5CDFA 5L8VA 4OLAA 2GR9A 5A0FA 1S89A 2PH1A 2OVFA 3S27A 1L5GB 1P7WA 1KJJA 1FRFS 3N8IA 2ZRMA 1HMPA 1I2MA 3IODA 2J3LA 2CFCA 2DAPA 4LW8A 4OSEA 1I14A 1X87A 2E85A 2XYGA 5CT8A 3PV0A 2YHAA 1M5TA 3VKGA 2NYUA 4ZPJA 3S1AB 2OMKA 1TL7C 5KNBD 1GOTA 4PHFA 2XGMA 4BVGA 3H2YA 4MCIA 4OAOA 3IJ5A 2GEFA 4GL4A 4CTMA 3CX7A 1W29A 4G85A 1GO2A 1K27A 3GT4A 4H2DA 2QV7A 2RHMA 3FWNA 2X8JB 2FSIA 2IUEA 3UO8B 3D2BA 4DCMA 5GMOA 2QUKA 1R1DA 1IMJA 3WRVA 2P9JA 2X7XA 2QJOA 1D03A 1KQGA 5A9TA 2FN8A 3G0HA 3BIJA 1DDGA 2Q6KA 2WEKA 2CNBA 4KQWA 1IHUA 5IAKA 3RVDA 1XLWA 3MWDA 2I4IA 3LVRE 3WLFA 4AM8A 4ZGWA 2ZRIA 5JI3E 4DUZB 3HR7A 2W48A 3KU4A 2G7ZA 4OB7A 3PQ6A 1QHGA 1SM4A 2GHTA 2H0QA 1RWQA 3ASUA 1DBIA 1IRIA 3ERCA 3GRFA 1IZ9A 3KR2A 1SXQA 1G5QA 3DW3X 3O8CA 4EO7A 3X2SA 3DFUA 3C5WP 1A9TA 2BHTA 4UW9A 3G3EA 3E9RA 2PWYA 4FCTA 2CLKB 4RTOA 1V39A 3IRVA 4MS4A 4JENA 4MR9B 4YRDA 4CR8A 3NWPA 4JVNA 4KO2S 2XMSA 3I72A 2VN8A 3QELA 1NNEA 4FP9A 1CQIB 1U99A 1X7WA 4WDRA 1R9MA 4GWKA 3VU9A 2GPTA 1COWD 4WKCA 4BB9A 1BN6A 2FOXA 3AF4A 3QE9Y 3ZJUA 2IYLD 1G8HA 1MIOB 2QHXA 1GPUA 4R98A 1GNTA 4RMGA 1ZXXA 5BRNA 3UOWA 3K8YA 4IIDA 1EK1A 1ORDA 1M0EA 3S0JA 4QDKA 3TLZA 5EN4A 1Q0ZA 4EELA 1RFGE 4CT4B 1R4NA 1B41A 4FM9A 4K6HA 4DUPA 2VJKA 1EU1A 4P4NA 4ZEOA 1KVSA 1T4MA 2B36A 4ND7A 4RIGA 5BR8B 3URMA 4FZJA 1ZHOA 1GUDA 3VNQA 1GFZA 4R7TA 1ISMA 5JNLA 1T1RA 3RSHA 1UBNA 3M1YA 3R23A 2FKNA 3JYHA 1GEGA 2JLSA 1CY4A 3AYXB 4FNGA 4OUKX 3D2CA 5DK6A 1TKCA 1ISIA 4O4LF 4IYRA 2VJLA 4URWR 5EVJA 2ANBA 4GMXA 1T25A 4TS4A 4XQCA 2ZTHA 3AF6A 1R50A 1V8BA 1ZRNA 5E9AA 5LOVB 2QPTA 2W6QA 2X0KA 2VYND 4JLJA 4LVUA 4NCKA 2X42A 3Q0EA 4RGVA 1DG1G 1ADBA 3RODA 2F4VB 2E5WA 4WCDA 4R1PA 3EW9A 4ND2A 2ZIGA 4XZ3A 1OXTA 5CUQA 3T54A 4YMGA 2QIPA 1K9VF 2V5VA 3BFJA 4ILKA 4CQMD 1XBTA 1WUKS 1RYYA 3H99A 3UUGA 3GLFE 3AKYA 1LDMA 1HF3A 4XX0B 3KQSA 2H2GA 4JX8A 4M8NE 4DQXA 3M2TA 4HEA1 4Q6BA 3O2JA 5IF3A 1A9YA 1FMLA 2XI4A 4S05A 2DM6A 1WD7A 2GYVA 5BN3B 3NTUA 1QGED 4P34A 4N4AA 5ALYA 3UOAB 1UPTA 1A5SB 1TIBA 2B7CA 2TSYB 1URPA 2W6ZA 2V6GA 4JL5A 4WCVA 2NLOA 4XYMA 4RDXA 2JLXA 2FX5A 3URKA 3L7LA 3LKZA 4IIJB 3GNLA 1AGRA 1T4CB 1EH5A 1U8XX 2ACKA 3H2BA 4G2TA 4YRMA 4ENUA 2ENUA 4A6DA 1WW2A 1GTMA 3L8MA 2B7LA 2ZSIA 3EF3A 1F8FA 1QX4A 2D59A 4MUMA 5CLIA 4BHTA 4POAA 1GR0A 3HDYA 4JD5A 4H4EA 5JTTA 4YRIA 5HFNA 1NW6A 1OD6A 3C6XA 1TZMA 1PFQA 3HCAA 3B38A 3IQZA 4FILA 3KQWA 4UOQA 1E9EA 2V0GA 3TEJA 5JJCA 3G5UA 3GNTA 2K2WA 1XC7A 4IV8A 3DO6A 1EE9A 1TTQB 1E2LA 4RHEA 3ZDRA 5JLAA 3ZD7A 2Y1LA 5INTA 3STUA 3DYIA 1CEYA 3FSEA 1DQNA 1YZUA 3EEIA 3N07A 1UMCB 3DEHA 4PHCA 5IFLA 2NVWA 1VLJA 2XCTB 1JHDA 1SUCA 5BYBA 5CVTA 2WV7A 2BTOA 5KQMA 2GEVA 2G2SA 4EHAA 3SQMA 5IKOA 3F4LA 4QL3A 4GMGA 4B33A 4EA7A 4ARVA 4P3PA 1P3Y1 3QLTA 3TFOA 4RORA 2H5LA 1M5RA 4E4RA 1QHXA 2JJYA 4XM2A 3EULA 4COKA 4D92A 3TBKA 5ICGA 4UEJA 4HJRA 2DBVO 2IC5A 3IHKA 5TV2A 3U16A 1OVGA 1AH2A 3I9FA 3O8RA 2RIPA 3ZWWA 1X7XA 4RANA 4R2LA 1IAVA 4DV3B 1T1JA 1I7NA 4TZTA 1SOAA 4LY6A 1UT8A 2RI0A 4YJ3B 3ZWMA 3H4MA 5LBIA 4FU0A 4HDQB 1Q95A 2X76A 5KYGA 2G4CA 2PVCA 3ZHXA 4RD3A 3EXG2 1FJ2A 2IIVA 4FCCA 4S2UA 4Z5XA 5IZCC 4HGZA 1WETA 3RYTC 5HVNA 1MRNA 4IDFA 1ZW1A 3N74A 4UQPA 4Z3KA 4YPVA 3AH8A 5L3QA 4LJKA 3ICEA 2X0EA 1YQUA 3VPSA 1X3SA 4RPIA 1UOQA 4UMVA 4F84A 1UWKA 1LJUA 2PZMA 2GF0A 3U7FB 4NEGA 3NUGA 4HH1A 5EE3A 3UYKA 3OE4A 5D1NA 3VDMA 3ZVKA 2ZBGA 3RSFA 2CHVA 2QRZA 3AR3A 3GJYA 3BGWA 5EIBD 2H1HA 3PVCA 4JL8A 1ZSNA 3G9TA 1RI2A 4CEHA 4V2UA 2W0MA 1Z5WA 4YFVA 3ET5A 4JYCA 4OXIA 1LTKA 4G4IA 4Y6SA 1OV6A 1JA1A 1H6DA 2QZSA 1AY0A 3KSUA 2H4ZA 3C6MA 1GRCA 4MVJH 5K4GA 4Y9RA 4K46A 4HT3B 3JQ8A 1QIDA 3DULA 3KUUA 4QPJC 4FQ7A 4ZEWA 4I2VA 3WIUA 1H2HA 4LZJA 4QNRA 1Z88A 3A1EA 2XDYA 4PPNA 2PBFA 4LOHA 2ZI3A 1J09A 1OGJA 1S8OA 3QU2A 4A8HA 2HK8A 3ZD9A 1YUBA 3AR5A 4W82A 1JAYA 1G0NA 3HLKA 1E3EA 4GDMA 2BD0A 2C2ZA 1G8AA 4W9RA 5DWQA 1W581 2EJBA 1LS6A 1G6OA 1N2SA 3AI1A 3DDOA 1YI1A 2P4UA 1FVFA 3HADA 2ZANA 2PWBA 1TYEB 3PKZA 1HZJA 3E6AA 3N0RA 1LI4A 2XUZA 4BN0A 3JTMA 5C0OE 2DUNA 4GR9A 2IZ6A 3TQIA 3OJWA 4X64B 3FYSA 1R8QA 4IDEA 1Q7GA 1M74A 3KB2A 1WNTA 3WE7A 2D7JA 2F7SA 1BJKA 5LR6A 3B5JA 4WOJA 3H1FA 1ZI9A 1IZ0A 5E1BA 4EAAA 1FZQA 4UJ3A 4C7OB 1WMFA 1VSVA 2LGJA 3G49A 5JXIA 1SPBS 4JVOA 3V1LA <