4DDHA

Pantothenate synthetase in complex with 6-methoxy-1-benzofuran-3-yl acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 97
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ddhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ddhA01
1PFYA 4FZJA 3ZJUA 1V47A 1FYDA 4QBTA 1X6VA 4MUGA 1S4MA 3A05A 1JECA 1M8KA 1XNHA 4R2MA 1Q15A 1OWPA 1K4MA 1J21A 1MJHA 3TQIA 2I1LA 3FHJA 3FDXA 2R5WA 3IOBA 3N9IA 1R6XA 4K03A 1NSYA 3ZIUA 1J1UA 2VTBB 2JA2A 3SDBA 2RD2A 2QJFA 1M8GA 2QTNA 3CLSD 2DERA 5JBNA 3I05A 3X1MA 3AL0C 2ZUEA 1KAQA 1O95C 3FNRA 1JIIA 1Q19A 1N2IA 4YMIA 1OBCA 3A04A 5TGTA 1EFVA 5H16A 1GPMA 5KHAA 2JANA 1VBNA 2DXIA 3K32A 1K4KA 2A84A 1MAWA 4R0NA 1NI5A 1O94C 1BS2A 3LCJA 4XFDA 3RFFA 1N75A 1EUQA 3QTTA 1J20A 4XFJA 4MULA 5LM3A 1KQPA 2CFOA 2AKEA 4NZPA 1JEEA 3D6UA 2D54A 1OWOA 3GLVA 3IDFA 3CLUD 3DPIA 4PBTA 5FNZA 3SYTA 2PXHA 3TS1A 1KH3A 1U7DA 1WOYA 1O97C 3IVCA 3CLTD 4DJAA 2E89A 3QE4A 1R6TA 4YP6A 1QRTA 4ZCTA 4Q16A 1F7VA 1H3FA 1O96B 3G6KA 3CVWA 4EG7A 1OWLA 2BYTA 1TQ8A 3FY4A 4MUIA 3RK1A 1I6KA 1NUPA 4I6GA 4PBRA 4G5YA 1FFYA 2D5BA 3HL4A 1LI7A 2H29A 2PZAA 3P52A 1TYDE 1O6BA 5TEVA 1HYBA 3X1JA 1MRZA 4RPIA 1PFWA 3IMGA 3UY4A 1DNPA 2DETA 3RJZA 4F3RA 2AZXA 4NAUA 2NSYA 2Z08A 3RK0A 1TYBE 3L92A 4ND6A 4MUEA 1EJ2A 4G6ZA 4MWEA 2DPLA 2A1UA 5DASA 4MW9A 4YP5A 1OWNA 1NURA 1WXIA 4I6EA 3CVYA 2VXOA 4UZFA 3ELBA 3UC5A 2A88A 1JGTA 2CYCA 1MB2A 3KT8A 4J76A 3OP1A 1QNFA 3P0JA 4RUKA 1N3LA 4KPUA 2A1TR 2HZ7A 3N8HA 2J09A 1QU2A 3PNBA 2DLCX 1QU3A 5DK4A 1O0BA 1YIAA 1IQRA 1T9GR 1OBHA 2A1UB 4ZT6A 4EF6A 5HG0A 2QJOA 3RHSA 1KP2A 4EG6A 1N2OA 4R2LA 2RE8A 1VBMA 1N78A 3INNA 4HPWA 1EXDA 1JZQA 1G8FA 4TS1A 4DLPA 2VTBA 1WKBA 3AG5A 4G5FA 1M8PA 1MOPA 4NATA 2YXNA 3IVGA 3E27A 4DDMA 3SP1A 4JZYA 1U7XA 4DDKA 3FETA 1YUMA 4HK4A 3TQOA 1G59A 4H3SA 2XRZA 1QJCA 4EG8A 4MWBA 2CV0A 1V8FA 1N77A 3COYA 2E18A 3ND6A 3ZXIA 1ULHA 3LE8A 3ZGZA 3HMQA 3IUBA 3FG9A 4ZT3A 1K92A 4E1AA 3UOWA 5F23A 2X3FA 2G36A 4S1OA 4DDHA 4MVWA 1J70A 2A4MA 2CUZA 1GLNA 1TYAE 2OQ2A 1H3NA 1N2BA 3H9CA 4MVYA 3CLSC 2EJCA 1A8HA 3DLAA 2PFSA 4CQNA 4KR7A 4MUFA 1NUTA 3NBAA 4A91A 3IVXA 1NUQA 4YP7A 1P7PA 4J75A 1GAXA 2HMAA 4UZEA 2CV2A 1O96A 2D13A 1M8FA 3H9BA 5KWVA 3ILVA 1UFVA 1VBKA 3DO8A 3FH0A 4L2IB 1OD6A 4NDAA 5IHXA 4MVCA 2WSIA 2QJTA 2E0IA 2X0KA 2DR2A 3K9WA 1QRSA 2DEUA 1T6ZA 1PG0A 1LI5A 3CLUC 3LOQA 3P0IA 2YWCA 4BWVA 5KCMA 4KKVA 2X1LA 3Q10A 5J5AA 1WXHA 4MW1A 3ND7A 2WQ6A 3CLTC 4JFAA 1U0BB 3RBAA 4ZT4A 1ZUNA 2EL7A 5FO0A 1NUUA 1MC1A 1KP3A 1EUYA 3SEZA 1NZJA 3S3TA 3JXEA 3A4IA 4MWCA 5K0SA 3L93A 4MUNA 1IQUA 1NP7A 1WQ3A 4U63A 4MW7A 5IJXA 5DEOA 2CV1A 1M83A 2QUKA 2J08A 3IOCA 3PNVA 3CA8A 4MW2A 2QTMA 1KORA 1IRXA 1GN8A 1ILEA 1JZSA 1MB9A 2O8VA 4AQ7A 1I6LA 3SZGA 4WSOA 2BTEA 2QUIA 1TFUA 4ZCPA 3MLAA 3IMCA 1T6YA 4CDMA 3ZUGA 4MW6A 3CLRD 1ZH6A 2Z3VA 2PG3A 1KH2A 5BNZA 4QRDA 1WY5A 4JYZA 3CVUA 1G8GA 3KFLA 3SZ3A 1GTRA 4GRIA 3D6VA 4MLPA 1JIKA 1U3DA 1CT9A 3IUEA 2J4DA 2ZP1A 1I6MA 1N2HA 1ZH0A 1WZ2A 4MW0A 2CYAA 3N05A 1ZJWA 3AIIA 3UK2A 4JXXA 3GMIA 1B6TA 1WQ4A 1F4LA 1O5TA 4ZT7A 3SEQA 2V0CA 2YWBA 2GM3A 2AG6A 3G5AA 1YUNA 3IODA 4EG4A 5EKDA 1H1TA 3TNJA 1KR2A 1WJGA 3CR8A 3HGMA 2CT8A 1D2RA 1RQGA 2NZ2A 2GKSA 2CYBA 2Z09A 1XNGA 3GUZA 2WQ7A 1MAUA 1YIDA 1COZA 4OUDB 3IMEA 4MUJA 1T6XA 4CT0A 1LW7A 3ISJA 3FI0A 3PRHA 1KAMA 1GTSA 4EFKA 3NBKA 1JIJA 2X1MA 1MBZA 5AHWA 4MUHA 3FOCA 1J09A 3FWKA 4PBSA 2B7LA 3MLBA 3ZXSA 3N2YA 5HUJA 2DUMA 4YBRA 3HFJA 2A1TS 1WXGA 4I6JA 3H97A 3CVXA 4Q93A 1M8JA 1QQTA 1T9GS 4L2IA 2YY5A 1JHDA 4MWDA 3AFHA 3COVA 1JEDA 1O95D 4HJXA 2V0GA 3VGJA 1F9AA 4NX2A 4HJRA 3HV0A 4F4HA 3VU8A 2IELA 4QREA 1G8HA 3X1KA 5J58A 1TYCA 4NAHA 3MMXA 5FO1A 3VRHA 4MW5A 4KR9A 1M1ZA 4ZCQA 3ZJTA 1WXFA 1K97A 1O94D 1PFVA 1X8XA 1QTQA 3COZA 5J59A 1Y42X 3KT3A 1IFXA 2HGZA 3DV2A 1YULA 2IJGX 4MVXA 5TEWA 2TS1A 1PG2A 1JMVA 3H99A 4GU5A 5LFAA 1IVSA 1NYLA 4EG5A 2GOYA 3A2KA 2JAXA 3AG6A 1F7UA 1O97D 2WB2A 3ZJVA 1N2GA 3KT0A 4U8HA 1IHOA 2IP1A 5HUHA 3BL5A 4X0EA 1YI8A 1EFVB 1N2JA 4XSVA 4CDNA 1O0CA 1NUSA 4ZCSA 4U7JA 5H7XA 3FIUA 4DNXA 1PFUA 4MQ6A 1R6UA 2ZUFA 1N1DA 1SURA 2E21A 1H3EA 3MUEA 2H2AA 1KKUA 3OTWA 3KT6A 4ND7A 1KQOA 4EGAA 2PZ8A 4MUKA 1EE1A 3Q12A 2OV4A 1KQNA 3IOEA 1XNJA 4EG3A 3TZEA 2A7XA 3P0HA 1J1ZA 3UMVA 4ZCRA 2O5RA 4WNYA 5DB4A 3CVVA 1N2EA 4ZT2A 1VLHA 3M5WA 4EG1A 1I2DA 1EFPA 3TZLA 1KH1A 3AKZA 2QUJA 3Q4GA 2A86A 3CLRC 1IQ0A 2QUHA 1QRUA 4KR6A 3QTBA 3G59A 5TS2A 1U3CA 3PNYA 5LLTA 3PXUA 4MW4A 3C8ZA 2PZBA 2XRYA 1Q11A 1EFPB 4JXZA 4OUDA 4K0RA 1VL2A 3U1VA 3H05A 4ARCA 3COWA 1IH8A 1TEZA 4AS1A 3HZRA 1WXEA 3ND5A 2CSXA 4MAFA 2J07A 4ARIA 1Q77A 2QTRA 3IH5A 1JILA 4DE5A 1GZUA 2J5BA 3F3MA 4KPUB 4OJMX 4P2BA 3NV7A 4ZT5A 3MXTA 1XJQA 1OWMA 2C5SA 2PIDA 5K0TA 4PY2A
chains in the Genus database with same CATH superfamily
3EYWA 1A9OA 2QTGA 2VLBA 3HGTA 3VHLB 1Z74A 3U7EB 2NVWA 3VAZA 5B7QA 3L02A 1H1DA 3PI7A 1BDJA 2VNHA 1XNHA 1Y6RA 1FVXA 1F2VA 2G71A 3EAGA 3SJCA 1EIZA 3B8EA 1KMMA 2B69A 2PS3A 4OHMA 4UVHA 4XGRA 5HF6A 3S40A 4EHFA 5JRJA 1BVHA 5JIBA 1OKKA 4HX5A 3KTFA 4PM4A 3UMFA 2R5WA 4AF6A 4MJ3A 4B7AA 1SQGA 2QX8A 3TW8B 5C5EA 5D5PA 1DQPA 4WLNA 4UNQA 5CFRA 4Q3NA 4DRXB 2N3ZA 3B38A 2X0IA 4F60A 2PKQP 3ZHVA 2H1LA 4NBNA 3EIFA 4LY3A 4QSHA 1RP1A 3ETEA 5HFNA 2R65A 3NBQA 4YXWD 2G1UA 2HKIA 3DWEX 5T7BA 2GJSA 2WEKA 4GFDA 1JYEA 5H83A 3QYPA 4F84A 3AL0C 3OQHA 3Q8KA 4YX9A 2H59A 2R1ZA 2JAWA 2YOHA 3R5TA 1VXOA 4B3IA 2OFXA 1VJGA 3BQMB 2CHUA 3DV9A 4FZ5A 3U7QA 1ZU5A 4S12A 1CUYA 5HTKA 4ZMRA 4F6RA 2CHVA 3K4QA 3T9FA 3GLHA 3AP2A 1JFLA 5CJJA 4DA7A 4RTKA 1UM9A 4DMMA 4XWOA 16PKA 2JZOA 2NTJA 2VA9A 3DHVA 4GR4A 1YZGA 1S7CA 1Z25A 3LCJA 1L5OA 3PXEA 4NL4H 2X5JO 5AHKA 1Z2NX 3OX3A 2AOUB 1MPTA 1Y6JA 3WRXA 1NVKA 4NI5A 1XP5A 4UKDA 4ZYLA 5E3JA 1PZNA 2EJWA 2ZIUB 3VKWA 1TMGE 4JUFA 4AECA 4BMNA 1BWPA 1X92A 2JH9A 1KH3A 2XQJA 4XUEA 5DKFA 3PHCA 1WOYA 2HNBA 4ZMSA 3LY7A 5FTLA 4WK4B 3ZJ5A 1CX9B 2P9FA 4FBMA 3L1KA 4XE5A 3ESCA 3QX3A 1JJIA 4KB5A 3UICA 1H3FA 4BBPA 3OD1A 1NMZA 2WP0A 3H11B 5HP4A 3COJA 1EFRA 2OV6A 2CD9A 4HDMB 4WEQA 3WKDA 5FWXB 5DHTA 5DX1A 3KAKA 2NIPA 5LD2C 3LF4A 1SRRA 3RSOA 3EAQA 4QDTA 3W78A 3KD3A 4O33A 1Z2CA 2D5BA 1MT3A 2ZI6A 3TD2A 5KREA 4D9GA 3LLUA 3HFSA 4UBLA 4WASA 3E9EA 1SXHA 5M7EA 3F78A 1TYDE 1OHHD 3FLMA 2IOHA 2JVKA 4GZLA 3W2HA 2YZNA 2G72A 1WXWA 4LYYA 2BKAA 2SCUB 3KKMA 1NW7A 3IMGA 3QMPA 1FDTA 4R8RA 2JJYA 4XX0B 4N0PA 3E7PA 2A8YA 1HK7A 2FPRA 3QYJA 3HB7A 4ZFNA 3IMFA 3EQ9A 1TXGA 1LRJA 2BC9A 4FS8A 1ISJA 3HA7A 1O6ZA 2Q07A 4QNRA 4TRRA 5TPWA 1QVAA 4MR9B 2BP7A 2PXXA 5FI3A 2HHCA 2IUYA 4DEXA 2HF2A 2YJ3A 4MW9A 3JR3A 2OE2A 1O6CA 3NJRA 2OHGA 4ZYWA 3PDIA 1P4HA 1SXGA 3LVBA 2WD7A 2Z5GA 4K86A 5ALNA 2X4LA 5KKCA 1AM4D 2Q2QA 1WCIA 3I83A 4M9SA 3OP1A 3WWPA 4EPWA 3P0JA 1P9LA 1MUUA 4EB6B 1CIJA 1RKUA 2HZ7A 4NECA 3F5MA 1BOFA 1ZGCA 4K8OA 5DYTA 2VEDA 4X7PA 4EFDA 5J1SB 1BD3A 2QHXA 1IQRA 1BS9A 1JE1A 2WVHA 2XRFA 5DO9A 3RQSA 3VDQA 5HZMA 4YJHB 1GFIA 1HE8B 2A9KA 1W88B 5AJWA 5ADHA 2JH3A 1KP2A 1KJQA 3G2OA 3H5AA 1CY2A 3E53A 3I6ZA 5LYJA 3DZCA 1QOPB 1J49A 2XD4A 3AI1A 4DIDA 1P5RA 4HH0A 1YJ8A 2FZGA 4X64B 4DIBA 2AE2A 4F46A 1QFMA 1ZXLA 2VF8A 2J48A 2DBZA 2D2FA 2EZTA 1W4AA 2PGDA 1FPMA 1GYRA 4FIZA 4E11A 4GD3Q 3ZYZA 4H6WA 2JLVA 1FP2A 3STVA 1WKBA 1XEWY 2O8CA 2ZM5A 1SVSA 1MOPA 3KKKA 4G0NA 2AUNA 3ROZA 3R7SA 1RPAA 4I3FA 1UMBB 2ZS9A 3EXEA 3W6PA 3WGKA 5IVKA 1IM5A 4C0WA 4KBYA 5AI5A 2OXFA 2PGJA 2Q5JA 2Z8XA 4GR9A 4AYWA 4IEIA 4YCSA 4D26A 2Z4RA 4LTMA 3UN1A 2EL9A 2IDKA 1HBJA 3NDPA 2N47A 2W7TA 4FHZA 5SY6A 1WNFA 5LP6C 1C9JA 3ZV4A 4RTSA 3ADDA 4S05A 1EEHA 3MWYW 1JJAA 2ZXEA 3QX9A 2Q5QA 3R5KA 3ZK7A 2QT0A 4ZEMA 2JIQA 1M67A 3MRTA 2Q1WA 2IQ5A 2XZPA 2ATEA 1L7BA 3OWOA 4QXMA 1IIBA 4HSEA 1LEHA 1WKCA 2O2HA 4DREA 3JYLA 1I33A 1UJ4A 1JSXA 1ZVKA 3UOWA 1QWSA 3HM2A 1Q7GA 2QXYA 2ZRKA 3OLXA 1JSRA 3FLEA 1GRCA 1PX2A 4GSLA 1KJZA 4MVWA 3SEFA 5DNEA 3FTQA 1DCMA 4WXYB 1QCYA 2VLIA 3S1AB 1JQBA 1RZUA 3AR9A 1IYZA 3NALA 1YAJA 3U49A 3EQ2A 4UQLA 5F2NA 2PFSA 5CDTA 1LWNA 4RE5A 4PWYA 2D1QA 4QAQA 5DBFA 4ASUD 4DG8A 5EZSA 2REBA 3GDFA 4FOSA 4S2EA 4FFWA 3QPAA 4KXQA 5EPUA 4RQUA 4J2HA 4FFPA 4A2CA 1YJXA 1DC3A 2P1ZA 3W05A 3I6IA 5HTOA 1NOIA 1ZGAA 2GCIA 2ON6A 1TVKB 5AOBA 3KQHA 3LAWA 4EEXA 2IYUA 1GPJA 3IE0A 2WJVA 1R0XA 2VF2A 1HURA 4ROSA 3C5EA 1KZ6A 3ST7A 2DCMA 4A10A 1GD1O 2F8TA 2OGUA 4NQZA 3ZE6A 3LUFA 4NDAA 3Q40A 4O8ZA 3V2UA 2BMEA 3OY7A 3SS9X 1HETA 3OJXA 3WK9A 1XDZA 2JI7A 3TZCA 1W5BA 1USUA 2X0KA 3KKQA 4JXKA 4K05A 4DR6B 5CLHA 2OCIA 2K2WA 3R4CA 5C8YF 3L6DA 4AJPA 1H05A 4YT5A 1ND5A 4B83A 4YV1A 1ZW6A 1IXZA 2VRWA 2QQGA 2DBVO 4JB2A 2IU3A 5KAPA 3WDKA 5JALA 3HO1A 1FP6A 5EJIA 4DMUB 3QW2A 2HLPA 5JUWA 5G0UA 3RYHA 3KUDA 4ILKA 4HNAA 1JHAA 3UXEA 4BQQA 2WWFA 2QLJA 4H4EA 1ZESA 4IILA 3ZWWA 1MABA 2VZ8A 1JHOA 1AQYA 5BVHB 1U0JA 3GEHA 4N01A 2AFVA 3VQTA 3U6BA 4MW7A 2G1JA 3TD6A 3TJRA 1QGOA 1X9HA 5F5XA 1AKNA 4EHJA 1EUZA 3IIMA 3DFUA 3AEQB 3A1EA 3WZLA 1M34E 4HH3C 4ID3A 1PBTA 1MKYA 3PE3A 3ZOZA 4MWOA 4CL2A 4NK5A 1PWEA 1U63A 1E9CA 3DD5A 4HN4B 4EIWA 2IUSA 4NYMQ 3CEHA 1IPEA 3USES 1GN8A 2ZR7A 4DBLC 1QGYA 3V7UA 2HOQA 5DIFA 3SVLA 4F91B 4I3GA 3B60A 4G0ZA 5IZ4A 5E7MA 1THMA 1T2VA 3WRYA 1RBZA 1T0PA 2Y92A 3OAAA 1TJ4A 2YFYA 2J8ZA 3RB8A 2Q5IA 3NBZC 2FZCA 1CQJB 3M3HA 2Q1UA 5LN1A 2EVWX 1MQSA 1IN8A 1UCFA 1KI1A 2ZDGA 2DFPA 3OM1A 1VLJA 1SPXA 2PG3A 4QBGB 4KXXA 2R96A 2BRUC 5DGCA 4BNYA 3MD0A 3IT0A 4EPRA 5B30A 3T41A 1RYEA 1GGKA 2F9LA 3TINA 1OF1A 2I5PO 1PS9A 4KSBA 1CIPA 3LXXA 3MGGA 3RQIA 1P4GA 4A3SA 4YRSA 4CKCA 2IS2A 1QFXA 4HOYA 1OPXA 1U3DA 2C42A 5JYBA 1H42A 4HYTA 2VJYA 2WT8A 3BE4A 4YRLA 5HJ5A 3OE7D 1WCV1 1ZIOA 1RT9A 2WAMA 3V3TA 2XMQA 1PD0A 1YA6A 2RB4A 2WTXA 1WWKA 1IOLA 3AVOA 1GAEO 1JSZA 2ZRMA 3KSZO 3QOYA 4FGZA 4H31A 4WVLA 4Z9YA 3RJMA 4CNBA 4IHJB 5JXGA 1ENOA 1NXQA 3V97A 2BFDA 4IM7A 2PAFA 2ZI7A 5DF1A 1Z6TA 2ZSEA 4FBLA 2EIHA 2RK3A 4F38A 1RPZA 2EZ4A 4QYIB 3H6HA 1LVUA 2ZBUA 3ZV7A 1AIPA 2AG6A 1ZBDA 4N47A 4EA8A 2BDTA 3RE1A 1M1NA 3DEAA 4MOWA 3HBMA 1GZVA 1NVXQ 4UHKA 5AQEA 3UG6A 5ILQA 3LCUA 5EKDA 3HN2A 4MUYA 1SK9A 3RAGA 1PRYA 2QLLA 1KR2A 3B51X 4GNKA 5CTAA 3DCNA 1C0IA 3C3BA 4R0MA 2C84A 1BFUA 2F48A 4PZ9A 5ELMA 3CWCA 2ORYA 3W4JA 3MAGA 2B3TA 5FBKA 2HXYA 3RBXA 3O83A 1W4BA 5FPYA 4YDRA 1JWLA 4O4LF 2D0DA 3DDCA 5CGQB 3VSEA 4C7XA 3FMVA 3KALA 3W2IA 4EQZA 2BGIA 4GVXA 4F71A 2R8ZA 3O8BA 1XE3A 1XDDA 3ONFA 1RXYA 1Y3CE 3KOUA 3ICEA 3H2BA 4RGQA 2GAIA 1D0IA 4NZMA 1GZHB 1I2ZA 2IU0A 3NNSA 5BP7A 5L3QA 1MDFA 4GOKA 4L0QA 3AR2A 1YI0A 3R7AA 2FRDA 1Y80A 4H2DA 4KV7A 1GHTA 4JUIA 2ZXUA 1Z9BA 1E69A 2PT7A 1Y4UA 1U5BA 2JJ1D 3GP3A 4R84A 4Y0NA 2G4LA 4ER5A 2EFCB 1YR9A 3AI3A 1JHDA 1M2VA 2BCJQ 4HS4A 4E5YA 3FAZA 4M0PA 4TTTS 4DJJA 4BGDA 4BUCA 1Y7IA 1IZYA 2WWTA 4GLFA 4ZTBA 1F9AA 2Q9AA 5KTOA 3LZDA 4F5YA 3CGWA 4Q02A 2QVXX 2XW6A 2FXVA 3G8DA 4M1YA 3KAPA 4Z3DA 3ZXYA 4CEIB 4E22A 4TMZA 4E5MA 1EVEA 2YNMD 4Q4AB 3RAPR 1ZCFA 3BD8A 4R1TA 3QW4B 4BMCA 3ABZA 2OD2A 1H5UA 5C1IA 4EMSA 1QPZA 4K1LA 4PSVA 4MARA 4KE7A 4UU0A 2OAP1 2YBDA 3IPRA 2CCKA 1ZAKA 3TTXA 2UYGA 4RKQA 4MVJI 2YKGA 4YJFB 1YHYA 2X9GA 4EM6A 3AQ4A 1QIFA 4M9CA 4DSTA 1YQWA 3G1UA 3ITKA 3NKFA 3LF1A 4Y7CA 5KHOC 2FZVA 3BHJA 2W43A 2YC4C 1QGED 2DUJA 5D1HA 1VYTA 4D9NA 2YXLA 1PT8A 3BQ9A 3RWOA 2P27A 1GGMA 1XMSA 4KWEA 2ZRAA 2O3QA 3QP9A 4ZAWA 2OPHA 4NDZA 2BV3A 4PYNA 4UBIA 4D3XA 4A92A 1Y7PA 1MO4A 3DZHA 5JNRA 3VSCA 4QUEA 1LJUA 3QKRB 3W0LB 3LECA 4UJ3A 2E3JA 3FPBA 3QLJA 2BTQA 4QDJA 4ZAZA 4ZIRA 1O0CA 3EUAA 2HFJA 4FSHA 5AVOA 2QXUA 1AGYA 1H5QA 3IT2A 5EJ9A 4AB1A 3KEGA 4A03A 1R6UA 3D5TA 3RGWS 5F1OA 3KQKA 3FUUA 2Y1GA 2YICA 1OAOC 3CI0I 2D8AA 2X76A 4PPYA 1RS0A 2P6MA 5DISB 4J29A 1MRNA 1QLJA 2OZVA 1HDZA 1NF8A 3EDRA 2RCYA 3HXTA 2V7BA 1OFGA 3ZVMA 4L28A 3HY4A 4FKBA 2AHOA 1U2DC 3G17A 3AM3A 5ISMA 1SBIA 1XVLA 2EFDB 1JDBC 2KLHA 1RRKA 1CUGA 2XQKA 5AIBA 3KOYA 1QLHA 4BTVA 2BISA 2Y99A 4D41A 1FXWF 4JOCA 4N0EA 4BKOA 5C5DA 1LNQA 4LDRA 3WLPA 4IIEA 3LSTA 1FU8A 2FWNA 3I9V1 1YNSA 2JASA 2ZIVB 4LA4A 1XX6A 2ERYA 4Q1CA 1F20A 3P45A 3EBLA 1BW9A 5CGZA 4ECEA 1UXIA 1A3CA 3SXUA 5A05A 2EKZA 3OY2A 4TT3D 2WKSA 3IBFA 3CE9A 4M53A 4QM7A 4R1QA 3PENA 5COBA 3STWA 2HHAA 1AKWA 2I6TA 5B1IA 2X6TA 5EMKA 2I4LA 3ROTA 2FFRA 5IT0A 2YVLA 3EFOA 3QBJA 4YMVA 2V97A 2JI8A 2B2NA 4LGCA 4PZZA 4TXNA 3JTEA 1BOOA 4RZ2A 4J7UA 3G49A 4PAMA 3V1YA 2GZDA 4P31A 1P7VA 1V8BA 4IUDS 4YDQA 1IAVA 2WG0A 2WT4A 3HKEB 5DBOA 2YYAA 5HBGA 2GESA 2IYLD 1Y3IA 2XQIA 5E1MA 2NU8A 3E9YA 3GXBA 4RIFA 3UWDA 4I4TF 4IIVA 2E82A 1T15A 3U3DA 2REQB 3RIGA 1NA5A 3ZI0A 5BUSA 1IBCA 4AS1A 2ZWAA 3R1IA 2X5KO 1KJ9A 1A72A 4LZWA 2R6R1 3ND5A 5I7AA 2JJ8A 2BFFA 2WY2D 4YRQA 2Z56A 4PZDA 2XQVA 3LL4A 3NTRA 1E0AA 1SBTA 2VHQA 4IOJA 1XTSA 3UB4A 2FPSA 3H5IA 3WB9A 1DC6A 4INZA 1AKTA 4DE5A 2CWDA 4Z9AA 1HGXA 4TSFD 4B4UA 1W73A 4Z1MA 2XVAA 3MWDB 4KI0A 3QG1A 4LC9A 1G8KA 3FPCA 4YIKA 3TTWA 4WHMA 3TW8A 2AT1A 2PANA 1ODCA 4HPJB 3QYAA 1YBHA 2G9NA 2RGRA 1I2BA 5AW1A 3AKEA 4DRXA 4Y18A 4NABA 1CHNA 3S28A 3CF4G 2WTMA 4Q1BA 2PJZA 2G70A 3WMFA 3W3ZB 1X6VA 1EVQA 1UFRA 4BP3A 1Z75A 2L2QA 1PYGA 3FPSA 4KFUA 2QAIA 1YZHA 3GH1A 1E3JA 2PEZA 2VAWA 4R2MA 5ALMA 5JQGB 3I5XA 3BA6A 5EE0A 5BOVA 1QTNA 2OOKA 2QY6A 2YWXA 3FHJA 3FTNA 4IMJB 4HGNA 4UDOA 1K9VF 5DU2A 4YN3A 1F14A 1THGA 4K5QA 1W52X 5BW4A 4FMBB 3WK4A 4LXUA 4GW3A 3U80A 3CH4B 3S4YA 3DR5A 1TU0A 2Y9MB 1QOZA 4HS9A 5JTUA 2AL7A 2BGMA 1VIVA 4TPKA 4HYYA 5JJLA 3ESXA 2BKLA 2QJFA 3C39A 2VAVA 3DE0X 3DEZA 1CQIA 2XE6A 1QRDA 1VHTA 4IO0A 2YVKA 5J2UF 2R60A 4QVKA 2FCAA 2QLNA 1QYRA 2AOUA 3OPYB 1LPMA 3WLEA 4MGKR 1XTVA 1YB6A 3V8RA 1EB9A 2VPQA 3VVMA 2QP3A 3AW9A 4HFRA 1WD7A 5B7PA 2R6FA 2WJIA 3SLGA 5LR6A 3F2IA 4FYVA 4EUFA 3RVDA 1MAWA 1WF6A 2NN3C 3HWRA 2IV2X 1UEJA 4DBVO 1P31A 1C3VA 2XHEA 3SR0A 5JY1A 4N3NA 2HJGA 2ZDHA 3N07A 4URFA 4C0XA 4F5ZA 3PQEA 4LE0A 4R1NA 3H11A 1E5DA 1FF9A 4RM2A 1S8NA 5IRCD 3TG2A 5HQJA 4FT4A 3BRCA 3LVFO 5KYUB 1DXQA 1B0UA 1IN7A 1OWOA 3GR6A 4B3JA 1U8AA 5CP8A 4CU5A 2FI1A 1XCLA 1H0SA 1J8VA 2Q4OA 2O07A 3IUPA 1U7DA 3LVQE 5REQA 4FFNA 1XJ5A 3M1AA 3OT5A 3UAVA 1KHTA 3UC9A 4Y1RA 1TPYA 2YS7A 5BNWA 3QE4A 2QPOA 3NW9A 2QTAA 1UKBA 1L9KA 2C0CA 3OP4A 4EKGA 3IURA 4LXIA 3WIVA 1Z6PA 1NF9A 1IHYA 3GLUA 4TVBA 4Y6QA 2J9XB 4NZ9A 4X92A 3B3JA 4WCFB 4NEHB 1N5OX 4DIFA 3H2YA 4XGQA 3DE1X 4UEQA 4HLUA 4X3PA 4XX0A 1VFPA 3U1TA 3VU0A 1SU6A 5ITZB 2O06A 2GYYA 3KZ1E 4MZDA 3MRSA 1WDTA 3DEIA 4JLWA 2VBFA 1MHTA 3INYA 4YUWA 1XQXA 4MR9A 3RV3A 3U4GA 3UBTA 2G63A 3LOPA 1I7PA 3U7HB 5ENZA 1WSAA 3WXMA 3M5CA 3WK5A 2HSEA 1TZJA 1CHDA 2J9ZB 2QW0X 4JK3A 4N5LA 1NW5A 1O8CA 3ETDA 5L51A 1XVAA 4TMXA 8AT1A 4QELA 1JHVA 4OP2A 3ZY6A 4RH0A 4ARZB 2OV1A 2GCEA 1LBIA 2ZJ2A 3HFRA 4TLAA 2IV7A 2AZXA 4XTRA 3EEIA 4BRZA 3HB0A 4CL3A 5B2EA 2OCBA 4FJ1A 1D6JA 4TV9A 4G6ZA 3AF2A 4XWKA 5JV5A 4A0RA 3I0NA 3U9TA 3O8OB 4O59O 1TMOA 1KI2A 3FX2A 1J8QA 2DULA 3RRXA 4ZJYA 3SQDA 4JMLA 2HJSA 3BIOA 4HRAA 5ITWA 2Q5EA 2XYRA 4X71A 1XVIA 4JVSB 1MQ8B 1NP6A 1V8OA 4V03A 2OXCA 3LBNA 3UHFA 3ZY4A 4R4JA 5DM2A 3FF1A 5A3JA 4U2GA 1BSVA 3RRNA 3EIEA 4EKIA 3F5DA 3HJFA 1OTHA 4J1TC 4D2IA 4UVIA 5DM70 4BZXA 4N7BA 4EEZA 1I3LA 1PL6A 2XWSA 2ZTUA 3KUCA 3LSYA 4DLVA 3DT8A 2VHUA 2EYUA 1DX4A 5CDFA 3DC7A 4QGBA 3U40A 2AYXA 2QJOA 2VZLA 3L1UA 1UMBA 1HRDA 4RVSA 1CR2A 1PGOA 1YTLA 3KKOA 2J5QA 4LY6A 3H75A 4PNPA 3L8FA 5TMPA 1Z5VA 3OA0A 1JALA 5H81A 1OXUA 5FTNA 4W6QA 3JRXA 2WVJA 3DMHA 1RAGA 1RCUA 4RSMA 4A2PA 4MRRA 3K09C 4JOSA 4F4CA 2XUPA 1J2TA 1PK9A 5AXBA 3GPBA 1E7SA 1GILA 3DZKA 3ZHZA 1AGXA 1W47A 3UK7A 3R5XA 1RKXA 3WZ2A 3H2SA 3OIDA 4LOLA 1FUYB 3TUJC 5KVVA 2H5JA 4LJ8A 3D8NA 2ZJYA 5KTPA 3D4IA 4IIGA 2FPGB 4PHCA 2ENWA 3JTMA 3PUXA 4A6EA 4ETMA 3S1AA 3HJTA 4B71A 2R7AA 3ICQB 3CQ9A 3Q2OA 2XB9A 1LDGA 1E2DA 2O3RA 4D9CA 2J3KA 2FMTA 3EOZA 1BA3A 2NM0A 3IQDB 1EI9A 2XA2A 3Q2KA 4FDTA 4JKYA 2I76A 1ULHA 4MS1B 4P80A 4W63A 5GY7A 4D3FA 3IUBA 2ECKA 3EC7A 3FB4A 1V7ZA 1KC3A 1EK0A 2PS0A 4LJ6A 3ZX5A 1U3VA 3TAUA 3WWCA 1Z0AA 3LX4A 4FHCA 4JYCA 3LGAA 2C5EA 1XCPA 4KXWA 1UBGA 4Q21A 4DUGA 3GLFA 3C7CB 3NVMB 1U9IA 1RRVA 2XAUA 4U7TB 3GROA 3KIPA 3HXKA 4J0DA 3ZEIA 1URPA 3ZHCA 1Z35A 2P9HA 4Z3KA 5IX8A 3GDHA 4PSKA 4WNCA 1TF5A 1M2KA 5TARA 2Q3BA 2QMEA 5ALEA 3CWZA 4EAAA 3VDXA 3IEVA 1N6KA 1N9ZA 5FBWB 3B8HA 1IEWA 3WL4A 4CETA 5ABPA 4WMLA 3KKNA 1Z45A 3MJDA 1RVDA 2HMAA 1WOMA 4U5QA 9GPBA 2XVMA 2O8BB 4G2TA 2GFHA 5LQJA 1G8MA 2H18A 1D7AA 3N8DA 2C7RA 3L4BA 5BQFA 5LUBA 2ZAOA 3PXCX 5M5BA 1Y7TA 1HDCA 3FH0A 4UNSA 1BFKA 5B4VA 5GAJA 1T5BA 2WSIA 4JQCA 8MHTA 4BMXA 1B15A 1CUCA 1MORA 2FRVA 1C9EA 1NXTA 2FZ5A 3LF2A 1DKQA 2AFIE 1XZBA 2RBEA 1T6ZA 4FYKA 4L95C 3Q0IA 2AQKA 2WAYA 4IV0A 3S2ZA 4FSXA 4QZVA 1X2BA 1VMIA 2Q4EA 1CQXA 2EG5A 2Q6LA 1XRQA 1PJAA 2CNBA 3AEQA 4AQYB 2PUCA 1U0FA 4QUKA 2I65A 4LFAB 3SF0A 5LJLA 2HADA 2QZZA 4BP1A 3UMYA 3R20A 3TB6A 2VT2A 4AS2A 4F11A 5BOSB 3ZDCA 3CJQA 5JTTA 5A4FS 1QX4A 4IFBA 4KO4S 2G5GX 2QSJA 3MGAA 1UL1X 3L6RA 3QUCA 5ES4B 5EWMB 3II6X 5A2GA 2CB0A 4AN4A 3WV4A 2I4TA 1SWWA 5EKTA 3NTVA 3HB5X 5EQFA 2WSYB 1CQJA 2RI6A 1L5SA 3FBGA 3D7NA 1OE0A 1Z4MA 4RY8A 1RXWA 1KFKB 3MK31 1V48A 4GYKA 3GZNB 3RVLA 4ND5A 3G82C 1VL0A 1DRVA 1RZVA 2J3HA 4ZAVA 4BNKA 1BXGB 2GEFA 3D3KA 1EB8A 4YJ2B 1EAYA 4YNBA 1BX3A 4EJSA 2Y93A 4DCTA 1UBSB 2RAVA 1ZD5A 2ZBEA 2ZTSA 3V8EA 1GL9B 2BJWA 4Y2XA 1UMDA 1XROA 3R9IA 2OCLA 4NCKA 1JUDA 3UJPA 2RHCA 2NTNA 3M4NA 2NPIA 4FGJA 1FS5A 2WAXA 4O1MA 5A7GA 3RT9A 4ZCPA 5G40A 1NUHA 4MW6A 3C3XA 4M46A 1PO7A 4L73A 1EQUA 1VG0B 1ULZA 3GLRA 1N0VC 1RHRA 1XHEA 2H54A 3QE2A 3I8XA 5K09A 1RD4A 2O8EA 1GPH1 1BVYF 3MQ4A 3OZFA 4H77A 4HB3A 5EE1A 2UYYA 2P65A 1JB9A 1XEFA 3K31A 3BFVA 1WZEA 1E9EA 4E31A 5BRJA 3VX3A 5DNCA 1ZJZA 4AJIA 1NNEA 4B3XA 2XB8A 3IEIA 4P4TA 1MEJA 2F1RA 4KXYA 2TRSB 4AP5A 4A73A 3AB8A 3OPQA 1Z4LA 2FPKA 3ORFA 4KQHA 3VR0A 2ZM6B 1Y4DE 3BRQA 4KQIA 4ZT7A 4RFSB 5ALVA 1MP0A 4Q4JB 3T5AA 1LBHA 5EXPA 2B4QA 4O4HB 1RWWA 1F1JA 1T4CB 2AFRA 2PS9A 3AIMA 5FTMA 1YGYA 1XEXB 4B4WA 3M6IA 1XA0A 1EP1B 3T61A 4BEVA 2QD2A 2B1JA 1QBGA 3WL6A 2IYSA 2IXEA 5SYAA 3WQSB 1CUZA 3PQCA 1LNZA 2CYBA 2RJOA 5EQJB 4OK3A 4Q4HB 5FI5A 4BVKA 1D4AA 3ROMA 2WQ7A 5BPFA 2IPOA 3HJHA 4WJKB 5FUVA 3EFEA 1MAAA 3TG8A 4WXRA 3IMEA 4MUJA 1DWQA 1RKQA 4K3VA 3VU9B 3FI0A 4ABYA 1U4OA 2RK4A 1YBMA 4WKNA 1KAGA 2G82A 5DCWA 2GXAA 1OTYA 1MBZA 2C4TA 3RIYA 2GA9A 4DNQA 1GNRA 1RE0A 2UXBB 5I8WA 4N1AA 5IN4A 3OTHA 1KFJB 4WBNA 3O4JA 4MR8B 1ZWKA 4Q4AA 1WXGA 5B5SA 3H97A 2QTBA 2Q3HA 3B2NA 2EERA 3OMLA 2H5EA 4IH9A 3UV6A 1C0PA 1EQAA 2X3UA 3N8NA 1ZEJA 3GLQA 1M5TA 4WA7A 2AQIA 4ZJPA 3GJRA 5KQRA 3MBKA 3KDAA 2QG9A 3D4PA 3LUBA 4Q01A 4WK6A 4QUIA 5IK2A 3VNBA 3BH0A 2FPUA 4RHFA 3FKSD 1ZHFA 2IELA 1T2NA 4QPPA 1YL5A 2C31A 3L7KA 2PL5A 2V65A 1GNSA 1TYCA 2ZRBA 4WJZA 1EYZA 2HMWA 1SHLA 3PCTA 2B21A 2J3DA 3B1XA 3IEKA 2Z98A 1W8IA 3D9QX 3OPYI 3VTKA 4FR5A 3O9VA 3K6SA 4RPJA 2IZ0A 2P9GA 2QR5A 5FAKA 1QUEA 1Q0SA 3BWXA 2W71A 3S1SA 4BBZA 4Y1EA 2QM3A 3I4FA 4TL8A 5TXGA 3P4YA 5CLIA 4PLTA 1A9QA 2WHXA 2TS1A 4MTLA 4Y0AA 3F4LA 1CR1A 3HB1A 1B2LA 3T3NA 3BGWA 2R86A 5EXXA 5G0SA 2JAXA 3OKPA 3B5IA 2NYRA 1E5VA 4RKFA 1NXXA 1K75A 1IMOA 2C95A 1WB6A 2JBAB 1I1NA 2BHSA 2FH5B 2VYFA 3AETB 3IBTA 1RYZA 4G0VA 1T1GA 2YDYA 4X0EA 1YZLA 3A9TA 1XA3A 1EFVB 4C7OB 2GB4A 4OL0A 3OOWA 4DRYA 5F98A 5IW8A 1H0KA 4R98A 3RU7A 2PUJA 4CDNA 4DA4A 2GCNA 1IOZA 4U7JA 2ET6A 1QC5B 1SAYA 1K66A 2XCUA 4I55B 4DCPA 1IY0A 3LL7A 1GRQA 1ZPDA 1J23A 4Z7NB 3GA7A 5H4HA 3SHFA 1TO6A 4F6CA 2WWRA 5KTTA 1Q2XA 3KZKA 3FMIA 4UMDA 1H23A 4H15A 1M2OA 3RUHA 4C6TA 4C5AA 4AO6A 1AVTA 3T7CA 3LPDA 4RAQA 5AM0A 3AHFA 3F9IA 1DFIA 3T6KA 4KQKA 2FEAA 2ZZMA 4X44A 1RI4A 1TMKA 2VJLA 2GILA 4YAWA 5DCUA 5B1DA 1F4VA 3FN4A 1VL6A 1M2JA 3WG9A 3FMOB 4LVOA 3RAFC 5DI3A 1P74A 2VTKA 3NBYC 5BYJA 1N6RA 4P4GA 1BMFD 5CYPA 4BGUA 2BFWA 3CNOA 1UBRS 3HKEA 4H35A 2C9DA 4TMKA 2P41A 3M5WA 3HYSA 1NVWQ 2PAAA 5K05A 4FGKA 3GGJA 2A0KA 4YCAA 4YRZA 2QUJA 4RTJA 4QE3A 1SCAA 3GVIA 2UYQA 4CIDA 3RAEC 1LF0A 4LF6B 2GBIA 1AT1A 4P83A 4ZOEA 1RJDA 1IHPA 3N2GB 2XOEA 3NG1A 5ALYA 2GEVA 3QVVA 4RF5A 3BIFA 3OVMA 1EG7A 4F9TA 3SNKA 3PUZA 2NV2B 3D02A 1HQCA 3CR3C 3IHWA 4I08A 5AVYA 3M3PA 1QBKC 4KXVA 5CRIA 3AVTA 1VRVA 2H92A 4H7JA 4Z4GA 1J8YF 1JF8A 2YXDA 3D6JA 3U1VA 3O1IC 3H05A 3HVHA 1KYWA 4HGQA 4ZODA 1WZUA 4ARCA 3U3RA 3KVVA 4WBXC 1MLDA 3ROKA 2OORA 1TJ3A 2PBFA 4QQNA 5H70A 5CH3A 3P27A 3T5CA 9ATCA 1W8DA 3N58A 1PR9A 4BHRA 3DAPA 2JD0A 4BPBA 1IY8A 4QOJA 5J2TF 5JY6A 4II3A 4LPKA 4YMLA 2CDAA 3OLCX 1KAHA 5ICMA 1X87A 4HWGA 1SOWA 4OKIA 5BMVB 1OBOA 3TUZC 1IZ8A 3U16A 1GZUA 4EECA 4KNWA 2XBMA 3UUEA 1JHXA 1F51E 3N5KA 1L5WA 4PG7A 3IVRA 2XSZA 5TC4A 3WJ2A 5K0BA 3V4RA 1U11A 1O0SA 4PGFA 3HDQA 2B20A 2QU7A 4WESB 1E8DA 4DQKA 3VJKA 5H4GA 4R7ZA 2DR3A 1Z83A 3KPVA 1K6JA 2DFNA 4HC4A 1I94B 1G60A 1HT1E 2PLRA 4KPYA 2FUKA 4CKWB 1L5LA 1S4MA 2W2MA 1XT6A 1M8KA 3FPKA 5DMHA 1YQEA 3EZLA 3FYDA 1Q3HA 4DVGA 2HCTA 3QWHA 2J3LA 3ESQA 4Q3AA 4CIYA 1SQ0A 2RHOA 3C6YA 4V39A 1W4LA 3RVKA 1ISSA 1CP2A 3OPYA 4CDGA 4ER3A 1CTQA 2AKAB 2HBRA 4O02B 1GFSA 4G4JA 1K7CA 1MC8A 2Q29A 5D6OA 5T4HA 3T15A 5GZ3A 4KOEC 1I6WA 3SLKA 2C7OA 1Z29A 2Q8PA 3C7TA 4KPEC 1S3FA 4DUPA 4MWZA 2FWAA 4JQOA 3NKVA 4XASA 3WSVA 2BF4A 3PQ2A 1G9SA 1ZL0A 3TXYA 2P6PA 1HNNA 4D0NA 4QKQA 1Q1BA 5CT9A 2W9XA 4CR6A 2YFHA 2I6UA 4ZI5A 3NYIA 3KYCB 1OH5A 1LDBA 2H4FA 2WU8A 3OCCA 4U0KA 4U7FA 4WINA 3O93A 5LOVF 5KYUA 4O4JB 1QE0A 5IMBA 2NXJA 2WU4A 4ZRDA 2P2CA 1U04A 1N0HA 2L19A 3OZWA 5KHAA 4MROA 1VBNA 4AKGA 1NQUA 2NU9A 3RODA 1UWKA 1K4KA 4ROTA 1E3DA 2GQ0A 3HCDA 4DA8A 1XMQB 4G5GA 2A5LA 1EK2A 1JSLA 3AF4A 4H3VA 4JBIA 3CIOA 3RROA 2XYVA 1QQAA 4FMCF 1OIWA 1QK5A 2QMYA 1K5HA 1XRNA 5JAQA 4KIUA 1KNXA 3BS4A 1SU4A 3L0IB 3ZXUB 4TKVB 1X3SA 5JFOA 3D7MA 2RIRA 3LP6A 1JDSA 5ESRA 5CIYA 3H19A 3O74A 5EHZA 4CEJB 1WUHS 2BEVA 2OHFA 3DBIA 4S1NA 5FUQA 4H7IA 3A0RB 3VC2A 2NSJA 2QVGA 1G6Q1 2CNWA 1I1OA 2WC1A 4HQ6A 2P91A 3KXLA 5HF9A 4LHWA 3ZE0B 4CM8B 5M04A 2AD1A 3HKDB 4NNPA 3ZW7A 3TX2A 3U31A 4RZXA 4XWWA 1AB6A 3DCIA 4W8HA 1A5TA 4BEBA 3JALA 5LU8A 2Z1NA 1RM3A 3LDFA 2A53A 1Y8RA 3HH8A 3ZCQA 2CL7X 3EULA 1JAXA 4FYHA 4DJFC 1LDMA 3LTEA 3PC7A 2A92A 3COPA 1X1CA 3JW8A 1NVMB 4Z9XA 4FDVA 1W2WB 4FPXA 4KAAA 4ARZA 3T3IA 1TTTA 2CNLA 4LN1A 2JLBA 4NE7A 3BK1A 2JDIA 4CBVA 1Z5WA 3CB2A 1A95A 2R62A 2FG7C 4OSOA 1GEGA 1NMEA 4HGYA 2BCEA 1E1YA 1XL0A 1UOEA 1KYXA 1VOTA 3O8OA 2WJAA 4L0DA 4PQFA 1VHJA 3EH1A 2VP3A 5FT9A 3WP0A 4ZDKA 4O3MA 4DV0B 2FSHA 2AOXA 1E79D 4AN0A 5F2KA 1PWZA 2GBPA 4UEOA 1CUWA 2VZ9A 3NHYA 4LQ4A 3RJZA 3GHYA 1YQTA 3R0ZA 3TW6A 2FSGA 1XOIA 1ZUNB 1GPDG 1VIMA 3G0DA 4FINA 5CBKA 4F93B 5J43A 1W44A 2BHTA 4AZTA 3RNOA 4R2WA 3K5IA 3UAOA 4ISBA 4ND6A 2IYAA 4A7PA 4KK4A 3VNRA 1PP4A 2DPLA 2VRNA 2GW4A 1PGQA 1JWBB 5AHRA 2QXTA 3AVYA 4C01A 1YR6A 2C20A 1O77A 3A9WA 1O2DA 4UZFA 3DLCA 4BFWA 5JXWA 3AL3A 2R4TA 1UBOS 1GITA 3B1WA 4B75A 5JAIA 3OM0A 1ZOOA 1HNXB 1N8KA 4FM9A 4F4IA 2C5HA 4N82A 3EQ6A 1EHCA 5LJIA 2ZYGA 3RS2A 1JQJC 1QFSA 2UVPB 2VUHB 5L95A 4ECAA 3K1YA 3P9IA 4UVDA 5F3WB 1N32B 4DQXA 1W96A 5K8TA 2VPYA 1IN6A 3IQHX 2IHVA 3E2MA 2ZRCA 1I4WA 3UMBA 1EQ2A 1ESEA 1N2OA 1SC6A 3A26A 3M6VA 3FFXA 4PAGA 4UHEA 4X60A 5CW2A 4DLKA 1D6SA 3INRA 2QI9C 2YJNA 2FPGA 3OHMA 3O8NA 3ONWA 4R6XA 4WGGA 1JG7A 4H18A 1V9SA 4EX7A 5AK5A 1Z56C 1AS3A 1WEHA 3KYJB 2AYZA 2D3TA 3LO5A 4FFLA 5CA0B 2OM2A 3FPHA 4NBSA 4YAKA 5CA1A 1G64A 2C2XA 4ZXPA 2Z5FA 1FX0A 2F3PA 1G98A 2IEYA 2JD1A 3ZGVA 4JC8A 3D7SA 2F59A 4AX4A 4KR3A 4FSDA 3Q0EA 4G1FA 4LF7B 2NZ8A 1JMKC 4DDKA 5CNMA 1YUMA 4KE9A 1U2SA 2VIIA 2ZWVA 2JLYA 4M7OA 2ERCA 4EYKA 3JSXA 4CQLA 2XRZA 2PSHA 4LJ9A 4FX2A 3N74A 4BFTA 1W6UA 1CS0B 1SBHA 3H4TA 3CM0A 3VJMA 1S2GA 2G0NA 1RWVA 3ESYA 4RDCA 2GZ3A 4L1KA 5AW0A 3ZS8A 2FAXA 5BWOA 4ZYXA 1Q1NA 5A3QA 4L6AA 2ZB3A 4GI2A 1BXZA 4M76B 1HEYA 3WFZA 3HMQA 1SZDA 3MINA 3NOVA 2IXBA 3HNRA 4WY2A 3WRWA 3EW7A 2FN7A 5JJ5A 1ZA1A 1H2RS 1TD9A 2G36A 3VR6A 4AP9A 2VKQA 3W8DA 5BW0B 2O8BA 2VSFA 2HDWA 1U28A 1TD1A 2W4QA 1TM7E 2P4EA 1TYAE 4NCNA 4YY3B 1G16A 2J3MA 5DWDA 3H9CA 4JVLA 1SQ5A 2GO1A 1BHSA 5J5VA 4ENPA 3IJ5A 3PXXA 1N7IA 2P30A 3AHEA 2GBCA 1B76A 1C9NA 2YINC 3DLAA 3MSXA 4FFRA 4G8BA 4HTFA 4NEGA 1JKXA 1LFAA 1QAMA 1WM1A 3B12A 3NBAA 3NJ4A 1KDYA 1WW3A 1T3LA 1MGPA 3TLYA 1GWNA 4LW8A 5BQOA 2Z5LA 3RVOA 2OFFA 3WNCA 3ZTYA 4A8TA 4BE9A 4C07A 1AURA 1YJAA 2AF4C 1JBEA 2WUEA 1O96A 1X1BA 2QX6A 1XZQA 3FCEA 1CVIA 3ILXA 4KLNA 3RVNA 3TLBA 3GEGA 1Y5NA 1SHUX 3WNVA 3EZ7A 4LWOA 3ZTTA 4BVFA 3QIAA 3ILVA 2LD4A 4R31A 4BJ5A 2SKEA 3ZQ6A 1X77A 5BOSA 3C4VA 2VJMB 3UCFA 3DO8A 5AKYA 2HDHA 1T36B 3GNSA 4QTXA 5KQSA 1Q0UA 4RVCA 1JLSA 4GDFA 5CAEB 1DT3A 2DR2A 5GONA 4IIJA 4PVDA 2RI0A 5AVKA 4MQFB 4ZYZA 3RTCA 1VHWA 3AIKA 3T7RA 1ISIA 1KSJA 1MO3A 4KKVA 1CUEA 2HJWA 3W5IA 4MP3A 1L6RA 2GAAA 2C1EA 1V16B 3AF0A 3BOSA 3C15C 4YMUA 5I4CA 4G36A 3RTGA 3EZ6A 2QJWA 3MTIA 4LQDA 3S3TA 4MV3A 1R4AA 1PL0A 3SEZA 4DIUA 5EJ7A 5KSZA 3W5CA 1ZMXA 1FFEA 5K0SA 5SZHB 4ESVA 1DEOA 4FEYA 2JVIA 2XBUA 3G8CA 1IE3A 1OT3A 1WMSA 3A14A 4U63A 1GCAA 2ZKIA 1SK8A 1JEQB 2CE2X 2XPCA 2R00C 4XQ9A 4JT2A 4MGZR 3TIXB 3EIQA 4QYWA 2Q4BA 4GMKA 3FDZB 5EJAA 2MMGA 2W6JD 2XNHA 2CNNA 3G2NA 3PNVA 4IKPA 1UZLA 4JLVA 4PONA 5EZQA 1OFUA 2I8CA 1AKYA 3LFUA 4Z0HO 4IZ6A 2IHNA 4UTNA 4HAOA 4I1YA 1ZM3A 2JI6A 2NQTA 4QX6A 3S8EA 5KJFA 1XZIA 3QUSA 4MGHA 1W5FA 5CNIA 1MIOB 1RWPA 1QE3A 3GLSA 1SM4A 5M3BA 3VPAA 3CFHL 3VV3A 1P3JA 2CXSA 3R6WA 1XSEA 4LWZA 1SOAA 2DF8A 4I81A 1H85A 4JOQA 4P32A 4UVGA 3M70A 1Z63A 1E2BA 3MCAA 4UXIA 5CM8B 3MHTA 1U2GC 3ETNA 3Q8WA 4YYEA 5TVKA 1ARZA 1RC0A 2PH5A 4QICA 3EJ6A 4Q4JA 3TCXB 3LUPA 2OO3A 2XT6A 4PFKA 4UJ5A 1AUVA 2LCFA 3IA2A 1VJ0A 2ZI4A 4G5HA 1ECBA 2ZP1A 5EHGA 1A7JA 1I6MA 1WW8A 2PTGA 4R05A 3T1NA 4EYQA 1BG6A 4MR7B 2ZSIA 4D7AA 4E12A 1C1YA 4QOGA 1MX3A 2BN4A 2VUTA 3KUUA 4FONA 4Q18A 4ABTA 1WUYA 4KH1A 2P9CA 4YUVA 5FBVB 2ENUA 2HQOA 1PK8A 2MMCA 3G2JA 4G26A 5D01A 3WV5A 1F4LA 4BJ3A 2D62A 3L41A 4RMNA 3ISTA 2AG5A 4HHEA 4OHRA 4OJYA 2YWEA 4EGCB 4KODA 2JAHA 3TGLA 3P9YA 1VP9A 3VZQA 4P4LA 3GDOA 3IPAA 1U0EA 1VKHA 4ZKEA 3GGGA 2FLWA 3R44A 1YDFA 3NTLA 4EH1A 1VL5A 3HGMA 4UE6A 5K8IA 2X5XA 2EFGA 2G9ZA 2GKSA 1XCBA 3A8TA 3A3YA 4IZIA 3QA9A 4MR8A 4TXLA 2V03A 4V38A 3RG2A 2XCTB 1E6UA 4I3HA 2I71A 3QVTA 2GCOB 4FLEA 4OLJA 4BO2A 2FGKA 3VOSA 3R77A 1I4EB 3I37X 3SJBA 4IOKA 4NHOA 4B6FA 1H2HA 5C9ZA 4CM4B 4KQJA 1LRKA 3VM6A 1NLYA 5K3CA 2AEEA 1OH7A 2AI3A 4TXHA 3OCXA 5FX2A 4WX2B 1VMDA 4PWZA 4TVOA 5AXDA 4AMBA 2QRNA 4GX1A 2A4KA 3BXGA 2D3WA 2FZKA 4Q1FA 4PBSA 2B7LA 2O0LA 3MTBA 3WB2A 3RHTA 1XJCA 1M73E 3C1UA 5LPNA 5K8VA 1UT5A 5A7FA 1GG9A 2ODEA 3GFPA 3OJFA 2QMZA 2PCLA 1G8AA 2HV8A 4GICA 3TPCA 1Y6QA 4LF4B 1UK9A 2NP7A 3QY9A 3D8SA 5LVAA 1H6DA 4W4TA 3ZW9A 1GKKA 4IGIA 2WTBA 1JYSA 3PNLA 1WXDA 3DFMA 3QFRA 2EW2A 2D2XA 1Z5OA 2OGZA 1WU8A 2RGWA 3FYSA 2DWCA 4US2R 5KDOA 5B6JA 2I2XB 2R0QC 3BXEA 1L7MA 2QRGA 4JBHA 1PS0A 4E1VA 4MW5A 5ADVA 2C94A 2JBAA 1ISHA 4II7A 2QLTA 5IN5A 3QLTA 4X7BA 1R16A 5B57C 2GHRA 3PL5A 5IXJA 2HBYA 3OQIA 4C7OA 4D8XA 2ES4A 3V6LA 3ESZA 3HBLA 1GQ2A 1ZUIA 3BSWA 4I55A 5TEWA 1PG2A 2A0UA 3EVFA 3PGMA 1D07A 3BSFA 1ISRA 3CI0K 1BMDA 5AI6A 3HZOA 5LLSA 3W5JA 1I9GA 1K7YA 2OXIA 1VI2A 4MB0A 2GJ4A 2F62A 3ZQ4A 1N2GA 3T9DA 2AZMA 1D2HA 4M1OA 2A0XA 2WYOA 2IHUA 3G0IA 4KGZA 1UZUA 1CE8B 2LKCA 3UMGA 4J8PA 3KJQA 2NVUB 1S8AA 1E9BA 1FRVA 4DB2A 1NUSA 3N86A 4ZCSA 5H7XA 1D3AA 1DO0A 4C0QC 1XPRA 4TUYB 3LT4A 4O0MA 2J3IA 4Q1EA 3V46A 1Y1LA 3B5EA 4K9LA 1IXRC 5F7OA 3VX4A 3I62A 1N1DA 1NBMD 3A4YA 1ODSA 2GF2A 5DNUA 3AX6A 1KKUA 3ZNNA 4ND7A 3DDWA 3O3CA 4NTZA 1NXPA 4O2LA 1JDJA 3UK0A 4BL5A 4D25A 1XRRA 2PZJA 3VPFA 2O1EA 3K6KA 3ML1A 3QXJA 4BNDA 4D42A 1T25A 4OREX 3OFJA 3IOEA 4DHEA 5EEGA 2VQEB 4B3HA 1S8OA 2Q6KA 4EGQA 1AKMA 1IONA 2CL6X 3N2GA 1QR6A 1W30A 2XVZA 5CVEA 2I6FA 5ALLA 5AVVA 2O19A 4EPXA 3B78A 1IEVA 1PJLA 1A5SB 4XLZA 5EHIA 3CVVA 4MB2A 5KPDA 1NOJA 5EE3A 4AZVA 3FVTA 1QMGA 1YFJA 4F3RA 4DRZA 5I9SA 1P0PA 1YB5A 4QD3A 3RJ9A 1H6CA 3K2EA 1KI8A 2GM5A 2GYUA 4HUJA 3SZOA 4MVJM 1OAAA 4X6UA 2AOVA 1HNZB 4LGYA 4ENQA 3X44A 4LE1A 3DXYA 3LMKA 4MW4A 3ET4A 2D0PB 1V7PC 3C8ZA 3VJLA 1I7LA 3GJ8A 4YAFA 1NZDA 5BMVA 1HUQA 2ZAYA 5I5GA 1A97A 3GJSA 5AVJA 1EFPB 4OJKA 2H5LA 2IUEA 3IAFA 2AXPA 1NVTA 1R0ZA 4GNRA 5T41A 1G4HA 4JR2A 1R5BA 3PWTA 4F4UA 4BB6A 1YR8A 2YDXA 1KVQA 4DZRA 1UXJA 4NMXB 5IAGA 4HEHA 3ZDXB 2UUCB 3AM4A 2ZIXB 1SN7A 2BEUB 4K2HA 4Q9NA 4Q3CA 1U02A 1WB5A 2QRKA 3VNVA 5JSUA 1EE9A 1ZI9A 4WFKA 1SVKA 1TC2A 5A0TA 1OLUA 1Q77A 4AZ0B 2GETA 4KTVE 2J7KA 2ZTMA 2JCSA 4QJ3A 3M3DA 4D5EA 2E4AA 3HZHA 3G5LA 2YHAA 1I24A 1JFTA 4N3CA 3JQ8A 1AUOA 2JFYA 3MWEA 3PITA 1IDOA 5GM1A 3I64A 4A15A 3EA5A 3C8DA 4P84A 3FM9A 3CV3A 4AJKA 5KX5F 2ZZNA 1PJ4A 4LJYA 5H02A 4GEGA 4XD7A 3FD8A 3IP5A 1U2ZA 2I91A 2BH9A 4PLWA 2XUKA 1GNVA 3PKJA 4JR1A 2ECFA 3BFKA 1WR8A 1R8YA 4KMRA 4XLLA 1IEXA 4YLEA 3TX6A 5C8XA 3KOMA 1QH1B 2LUOA 1K4MA 2NUAA 1ZJ4A 2VS1A 2ZBFA 4FBGA 2WI8A 4I5IA 5FA8A 2CLKB 4O4JA 4ENTA 2VO1A 1L0BA 2RKBA 2ZBRA 3L0OA 4H7KA 5LZ7A 2WJYA 1CKEA 3LQFA 4QJBA 4QO8A 3Q3JB 3N9IA 2HRDA 2HU5A 5DSXA 2JA2A 1AQIA 4GF5A 4X62B 5JMTA 4B3RB 4RK5A 1G3UA 3EXHB 4L5YA 4ZC1A 3ILYA 3DP7A 4CKEA 5CCBA 4HEJA 1Y1QA 2DERA 1OBFO 2QRJA 3FVWA 2R8PA 3T95A 4ID9A 3I39X 2C92A 4LI3X 3WL7A 4RTMA 1GL3A 2HRQA 4TRNA 4HSGA 4P4NA 3W9UA 3MJSA 1U2RA 3I8OA 1UC8A 5I9MA 4CLRB 4ENUA 5A4MS 4QGGA 4QQ8A 4X8HA 3EZGA 1U3WA 2JHAA 1IHXA 5E7QA 3SDZA 1S1CA 4E08A 1XI2A 2A84A 2OFPA 2Q3CA 1OLSB 2W93A 3GF4A 3QFCA 4QPJC 3T5TA 4EPYA 1WUTA 4ZTZB 4QJ5A 2XGJA 4FUQA 3C97A 1SOMA 4ZVRA 1Y8CA 2DOKA 4M8KA 3ZJTA 2YZ7A 4MULA 3TVYA 1KMCA 2I3GA 3MPUA 5HIKA 1RJ9B 2ODNA 5K8LA 5KYYB 2JCVA 2NNLD 1XZKA 3HNPA 1SCBA 2NZWA 3GLVA 4UMEA 5GWXA 1U1CA 4EZIA 2ZUBA 4OLHA 4L0CA 3RNLA 4TMFA 1DO2A 1SCNE 3LRTA 5KNBA 2B83A 3DQQA 3PHLA 1HYHA 1SVWA 4PLCA 1L8QA 3ZK8A 4LRXA 2E89A 2ZQZA 3CHYA 5IUJC 4W99A 4IDHA 4GL4A 3RIXA 2OFOA 3A6JA 4Q16A 1JZTA 4HDQB 3P9RA 2FY8A 1Y33E 3D2BA 3R6GA 4XQCA 4EVIA 5EP1A 4CQMB 4LTDA 4BBJA 2J0SA 3PRYA 3EUEA 4L6CA 4YRCA 4X95A 2IUUA 5HS4A 3EVNA 2O5VA 5JLJA 2I9KA 3IBSA 3NT4A 3GFBA 4RD1A 4YWHA 4AYXA 1T4MA 4B43A 3NFYA 1KETA 1B73A 3GCXA 1NUPA 1LX7A 5LWHA 4CF5A 1FQOA 2WSBA 3GOQA 1HLDA 2VRCD 4QTZA 3ZR4B 4F92B 1AQNA 2ECPA 3U4AA 2ZGVA 1E6MA 1Q7EA 3VR4A 5KQGA 4ZAXA 1ISPA 1QANA 4YAJA 1TECE 2HIGA 4UCXA 4MUBA 1Z4JA 2QENA 2QRZA 1JLLB 1HLGA 3U7FB 2PH7A 5A0VA 5DW3A 3VZBA 2XWBF 2P2LA 2PWYA 5EFZA 5AKLA 2W70A 3V1LA 1EJ2A 1SC4A 2C3PA 5C80A 3HYTA 2X40A 1B23P 1MB0A 2C9MA 2I3BA 4BO3A 3G3EA 3DVSX 5EWLA 4JL6A 1T2FA 3ZEAA 6REQB 1ORIA 1WXIA 3JYHA 3MYRA 2OKGA 4C7KA 4PO3X 2GN8A 1HSOA 2O2DA 2QVBA 2Z9DA 1NN3A 2ORVA 3BEDA 3BMOB 4UVEA 2H31A 3KT8A 3SHQA 1NHWA 3Q0TA 4HDNB 1YOBA 4EQ6B 2EGUA 5D3MB 1Z6ZA 4IGFA 2FU5C 3TSOA 3ID6C 3HZZA 3W77A 1QU2A 3KU1A 5CA0A 2CVZA 3AEZA 1TU4A 4R1SA 4RVHA 1BYIA 3S6JA 1BCRA 5DK4A 1OPRA 1KVUA 1B16A 1EJ0A 3BDIA 3TLAA 5JQWA 4DTIA 2CHEA 2Q5CA 3NO4A 4U9HS 2WP8J 4ACBA 3W79A 3BXPA 5EP4A 5TV2A 4R2LA 4R9UC 3SHWA 3P0RA 3INNA 2XYPA 1JR2A 2BHNA 1CS0A 1JZQA 3A25A 1KTIA 1NN1A 3V48A 3PEUA 2QRMA 5LZ5A 2F3TA 2ZRLA 3M5DA 1RAAA 1MH9A 3IGFA 3KHKA 4E4TA 1ES9A 2SHKA 3BEOA 3E9MA 4JJ8A 3TLMA 2HAEA 1TUEA 1M1UA 4ZVQA 1C8VB 1SCUB 1TCVA 2XNJA 3GCDA 2CLSA 1L4GA 4JC0A 5G53C 2H1HA 3V4FA 4CTJA 2UVDA 4CEHB 4E0BA 1M66A 4P81A 2H4XA 2ZCVA 4G0OA 1ZH4A 1C0KA 2ZROA 3GPDG 2UAGA 1C3XA 1GV1A 4DLRA 1Q50A 3ZXIA 3LE8A 1VIAA 2A57A 3M8KA 4JB8A 1L7PA 4QQKA 3U3OA 2NXNA 2HO5A 3SDSA 2PUBA 2IS1A 2ZG6A 2WSMA 3KCQA 5BQ5A 4HXYA 3O4IA 2DBQA 4D98A 2YN4A 3S55A 3F7OA 2QPTA 4BRUA 2CUZA 1B43A 1PD1A 2A56A 2VK8A 2PH1A 3P5SA 4L75A 1OLXA 1MR3F 1UKVY 1FTWA 3T4UA 4EO4A 2QE6A 2ZRHA 3TQHA 1NY5A 4DLTA 2MT9A 4C29A 1IB6A 1T36A 4CQNA 1REQA 1QHGA 3FYUC 1DWPA 3LQKA 4YQZA 5L6MB 4JGGA 1VQ1A 1I14A 1QG0A 2CLIB 2PYDA 4PPGA 5H3HA 4DQ0A 4MQFA 1CULC 1LK0A 2AW5A 4J0FA 2CV2A 1D9XA 3JCZA 1P1JA 4CHGA 4L5IA 3VKHA 4H9GA 3FKQA 5HYVA 1FYFA 3LX6A 5KWVA 2JBHA 3OFVA 4GZ3A 1SH7A 5DLEA 5GJBA 3EXIB 4K88A 4DDUA 1JNXX 1HEUA 4YP0A 4M8SA 3LM8A 3MT7A 2ZVDA 1B8OA 4CIBA 1W36B 4ZZIA 1KC1A 1MN6A 4M0EA 3ICOA 5EJFA 2RGDA 4WY5A 1JEQA 4TSRA 3BD6A 5J4KA 1E2QA 1LI5A 4G9EA 5CVCA 3LOQA 3TN7A 5BSMA 4IXWA 2EZ9A 2NADA 4M38A 3V4SA 4QLBA 4EY6A 2LPMA 3NIGB 2YYYA 3D3QA 1PI3A 4Q7EA 5BSRA 4B6EA 1N2CB 1U2QA 1MC1A 2GLUA 3DAOA 3SZUA 1BC5A 3HA2A 5AWFC 1DQRA 2KW5A 1GZ6A 3T9AA 4H4DA 1OFUX 4BQNA 1SHZA 3CUUA 3QUTA 3N2LA 3HS3A 4F06A 3MT8A 2BOVA 3RIMA 2OSBA 3RFVA 3DE6X 2AFHB 3EG9B 3H3XA 4TGLA 4EX6A 3EXFB 4YAIA 3JU3A 3WLKX 4NWIA 2VHXA 1UK8A 4PRZA 3EUWA 4Q82A 1AMUA 4NOKA 3HEAA 2CXUA 3QXSA 4LRWA 4KZKA 1KQFA 3OTOB 3O9MA 4MYCA 3MUFA 4EA7A 2YMQA 3EVAA 4LZOA 1R8JA 4X85A 1MJFA 4C6HA 1NJ1A 1HFEL 2JEOA 3QPUA 3F4KA 4E88A 5JD4A 2XMZA 3EHEA 3PGVA 4E51A 2P4HX 1X1DA 4Y0VA 1JZSA 1CJUC 2XTZA 3EPLA 4AQ7A 1I6LA 5F3RA 1JE0A 2H7XA 1EGQA 2I34A 4HKTA 1HE3A 1UC4B 5F1KA 1YB4A 2QUIA 3LLCA 3SHVA 2J87A 4L8LA 1Z28A 4YQYA 2CVPA 5KWIA 5DLQC 4TMWA 5EJ5A 4J90A 4MR7A 2PJUA 3VKFA 3LUCA 5BNZA 3A6FA 1IWBB 3HRKA 3LQ4A 3TQRA 2ZYUX 3CMMA 4EO7A 3EIOA 5EIWA 4DSNA 2F43B 1AH2A 3HDTA 1GTRA 2OZLA 2ZJBA 1KZGB 2BZ1A 4J0IA 4QSMA 1DRKA 2EKBA 1QO0A 2XNCA 5U4XA 3LHKA 3S7TA 3BREA 1PDWA 4UNIA 5DJ5A 1CY0A 3H4IA 3CVOA 1WDLA 1ZGZA 1ENZA 4L9AA 1FZTA 1ZH0A 2IZ1A 1TTPB 4PZYA 1RHKA 1V11B 3H9JA 4KXFB 4RK7A 5ECGC 2JIZD 3UM9A 1ZDMA 3D8TA 3ZCVA 2W2VA 4RIHA 4O2AF 3H17A 1UK7A 3CX4A 2GN1A 2IHBA 3HKBB 5EZYB 3FHOA 1BWQA 2GCOA 4B35A 3VISA 1UWCA 3G5UA 3I0ZA 1Z39A 1DJLA 1RWKA 1U2TA 2O3JA 2VTVA 2X0JA 3K9GA 1KZ7B 3MB8A 4BFUA 1E99A 4DB4A 4JLDA 4CLOB 1WP4A 2IYPA 2Z58A 4PQRA 1S5PA 2ZIFA 1WMAA 2V6BA 2CT8A 1Z33A 2EKQA 1WMFA 1NATA 3LV8A 4MGYR 7YASA 4XWAA 3S2EA 4PIPA 2OHJA 3NKLA 3V1TC 1EVLA 5BW8A 1FUKA 4Y6RA 2JGEA 5IAEA 1C9DB 1ZIPA 1TUBB 4XLTA 3RSLA 3WYGA 5L3SA 2IIPA 3NBMA 4S1VA 4W9NC 2BM0A 4NXNB 4PZEA 4Z9BA 2X1MA 4EKYA 1I51A 2EJTA 1DCFA 2G7ZA 1DKRA 3P9XA 4FNGA 4S35A 3B9QA 5EXDA 3CZPA 1FQKA 2XB6A 4BDSA 4TM7A 5H3LA 4YT8A 3JAKB 3WK7A 1GVNB 1OB5A 1NN5A 2A1IA 4YJ3A 2YZGA 5DIZA 5GVRA 2Q4RA 4E3ZA 4I6JA 1X42A 2IPNA 3L7MA 1P2FA 1JAZA 3LT1A 4IINA 2C9CA 2JI9A 3REQB 1A88A 1GRRA 3IP9A 4UCFA 1M74A 1MDBA 4WNAB 4EELA 1UIMA 5K0ZA 1K1EA 2XT0A 2YY5A 2P5YA 2QN9A 4WECA 3PXAA 1QFJA 1E9AA 4EYEA 1QHEA 3DKPA 2ANCA 4DSZA 1ZH2A 5ELLA 1AK2A 3CKKA 4NFSA 1BE0A 1TJYA 2ZI3A 2WMYA 4MWTA 1RJEA 3R9XA 1X70A 3EWSA 4OLAA 3V42A 1R64A 4W7IA 3EDQA 1CRZA 2DT8A 3HUFA 2ODQA 4KWCA 2W83A 2R6ZA 2P9QA 4XDHA 1VI6A 3DL2A 4O2RA 3BL6A 1CE8A 1Q0LA 3M4ZA 1Y9JA 4JENA 4YFVA 5C4IA 1Q57A 3IDAA 4XM1A 5TT1A 1RAIA 2G5CA 4DABA 2IJGX 3L1IA 2W6NA 1NY6A 4QDKA 3MJCA 4AZ3B 4B3BA 1UOOA 4TUYA 3F71A 2FMKA 1SKMA 2PZGA 1FK8A 4B32A 1T6NA 2J0UA 3DFFA 1UPAA 2H4JA 3DDOA 1DKOA 2NUPA 2NACA 1V96A 1DKLA 3C24A 4FXOA 4LDAA 2NV6A 1NTRA 3VVLA 3V6MA 4F3CA 4URZR 5THXA 1J7KA 1PNOA 5EINA 5I4BA 3IEMA 2PMBA 1SWVA 3DWFA 1JDVA 3E9RA 4GYWA 4MP6A 1U8TA 2P2YA 2PUVA 3FIUA 5F5NA 1DUIA 3DMYA 4GP6A 4DPKA 2RGYA 2PHZA 5AKXA 3Q3HA 2OBNA 4XUCA 4BGIA 2OYRA 2NXCA 3AY0A 3V7WA 2WIDA 4J1QA 1GADO 1HOTA 2CJYA 4IYRA 4DAEA 5LXTB 2XF2A 4BFLA 5DM0A 3NDRA 3NWBA 5AUPB 3S5UA 1E9RA 3BHMA 4BJ6A 5HZHA 3EMOA 1JB1A 2OD9A 4LSWA 2I62A 4N54A 1EA5A 3V1UA 4TN1A 1WETA 3E5HA 2BGRA 2VRBA 1YOVB 1LBTA 2V96A 2XODA 2IYNA 1NVBA 2FQ1A 2YJ5A 1ADJA 3NYQA 3Q8XB 4MV5A 4DMKA 5KVAA 4M0MA 1RFGE 3G23A 3HCFA 2FN3A 4NVRA 2I7XA 2FW1A 1VLHA 4K1XA 3T7TA 3I1IA 3PIIA 1LJLA 1EFPA 5BN1A 3FGOA 1TQDA 1XELA 3ADPA 3AHJA 1NLUA 3HGQA 3L8ZA 4TSKA 4EW3A 1VG9B 3T54A 1T1EA 1HQDA 1NDUA 2QN7A 2RARA 4L22A 2VK2A 3TGWA 2FLVA 2YVAA 2ORED 2ZVPX 3FKJA 4XOIA 3IV9A 5I9BA 4B3MB 2ZIXA 4UTOA 3JWIA 4M37A 1CUJA 5HMMA 2VF4X 3TAXA 5LLTA 1XTKA 1QV7A 2YWGA 3RUIA 1WHSB 1M2FA 1Y7HA 3FLAA 4XSHA 4E09A 1J8FA 1NIPA 2ZVJA 2I80A 2EEZA 3REOA 5JZSA 2QTVB 3ESRA 4JHLA 1WQ1R 3F1LA 4L72A 2QRLA 4U6NA 1M6VA 4PAQA 3LK7A 4N0MA 1N4AA 3VC7A 4E7OA 1JU9A 5L9AA 3ZI4A 1MVNA 4JV5B 3FR8A 4CUKA 5E38A 1P7WA 2XR1A 5TPWB 1KI4A 4UFPA 2Q2OA 1S2LA 1EKXA 3KB6A 4GE3A 4TV8F 5EIFA 4M86A 3ZZNA 2P11A 4K6GA 2QGFA 2Q5FA 4H7EA 4DNOA 4ARIA 4HBZA 1E2KA 1PVDA 2VOJA 3GQBB 5CIQA 3BF7A 3RFTA 1Y98A 4GMGA 2QR3A 2UZ1B 3EZ2A 2JK1A 1PLJA 1XMJA 1YNOA 3FNHA 3GT3A 1QRRA 1NR7A 3C1TA 3OZGA 4D4LA 3LUHA 2PRYA 2V8OA 3BE8A 4OG2A 3W3AH 4ME6A 3MXTA 1JEYA 2Q4DA 3PQ7A 4C88A 3KR9A 5BSKA 1CR6A 4DV3B 1L7OA 5A6VA 1EDEA 1JKFA 2BI7A 4BXOB 1PFYA 4KYIB 4ZVSA 5K3BA 1TCUA 3EXHA 1F3LA 1V47A 1P2TA 1GNQA 5J40A 4JI5B 4F0JA 4OX9Y 4Y8VA 5DGDA 3AK4A 4J94A 4PFQA 4QECA 5EIHA 2YR0A 4I4TB 3R7WA 1JQ3A 3TXXA 5KNDA 4QAJA 3FMPB 3B7PA 1K2VN 1KSHA 4DMRA 4DKJA 2EF1A 2BW0A 4CLRA 5KOHA 2PKRA 5K1ZA 4K03A 3NBUA 1E4VA 3DR3A 1J1UA 4IVPA 4AWBA 5EJ6A 5I5EA 3T1QA 1GQYA 2D2IA 3K5WA 2FP4A 1JFSA 1OT5A 4MQ4A 3EZFA 2QTNA 3KZOA 3AUJB 5JBNA 3ZVLA 3A1WA 3V8PA 4WCFC 1BKDR 1NNUA 1JIIA 3X1XA 5BNTA 5E6RA 2FJ0A 3NRCA 1WO8A 1JR3A 1NWCA 3PD7A 2ACWA 3Q1KA 4HR7A 4LEIA 3TL6A 3PWZA 4JLSA 4X6XA 3WGLA 5JR3A 5DXAA 1E3MA 3ISVA 3WDLA 5AESA 2DUNA 5J9FA 1HQKA 1GU7A 4QHSA 3HJNA 4JJGA 3VNQA 4F8EA 4FE7A 4HX9A 3FNBA 5DULA 1U1FA 5IUKC 3STYA 3LCVB 2ZULA 5JDCA 1QWOA 3F2VA 1XKXA 4NZNA 3TM4A 3HSSA 1KL7A 2ZJOA 4XFDA 2XB4A 5KVSA 1V1RB 1XB2A 5HCNA 1OTXA 3R3UA 1ZIDA 2ZYTX 3ZHTA 4FU0A 2FUG1 1PDVA 5L3RA 3W9YA 2KE5A 5FNZA 5LDHA 5IXSA 1QB8A 4JBNA 1MX9A 2ZUWA 4OAPA 1YCFA 3RRZA 1XXLA 4B76A 2C4WA 3M6UA 2XWQA 1BROA 3A3OA 3R9WA 4CF3A 2GM9A 5AXCA 2ZB2A 1AZTA 1YQDA 2J5KA 2V7QA 2W4MA 4YVFA 3RM3A 4HV4A 4ZTUB 5K7SA 3QNMA 1A8SA 4P58A 1UJNA 2Q2NA 5BT8A 4V0QA 5IC5A 2NU6B 4QOFA 5K3DA 3U17A 5LDDC 1KVRA 4JZKA 4AMGA 3KBBA 3I76A 1JLLA 1SEPA 3ZUPA 2PL9A 3NHLA 1K3FA 1TQ8A 3IVAA 1KS2A 3W5UA 4ZXFA 4QOIA 3FNGA 4F8JA 3RSHA 2D4HA 3JQBA 5SYNA 3A4VA 2UDPA 3ZDDA 2Y2VA 4I1UA 4ZYUA 2HHJA 1SKYE 1IN1A 3GFVA 4HADA 4OMDA 1IG3A 3MILA 1EFKA 3ZBPA 3UXMA 2V7EA 1VKOA 3AY6A 2F64A 3HVKA 3L8GA 4A6PA 5F7XA 2GZMA 1MXHA 1UWLA 2HCFA 3FGZA 4Q7MB 5GV8A 2WMNB 3RARA 4ALLA 5LC1A 4ZHQB 1IC6A 1FEZA 2Q50A 3PFBA 4E4YA 1LV8A 3BMOA 4INAA 5EJGA 4URVR 2A5FA 1PF7E 1KMHA 2AR0A 4I1OA 1SB8A 3QU9A 5JHGB 3EWIA 4BO8A 5IHPA 3PPYA 2Z08A 3ZDBA 5JO9A 2RAUA 3V8VA 2PV0A 2PSJA 4XEHA 4MUEA 3CN9A 3LIPA 5AM1A 4R8VA 4GE0A 1YH3A 3K8OE 2Q6TA 2RH9B 4DV4B 3GRKA 1H0HA 4U39A 1XTTA 4BQEA 2JGDA 5BWBA 1ZA2A 2A88A 2RFLA 1D2GA 2VDUE 1F17A 1E4OA 1CW2B 2C3OA 5TIIA 5IVIA 3FCSB 3N3AC 4YASA 4DPMA 4X1KA 3F1KA 3UJCA 1P77A 1ACJA 1T10A 2J09A 1W4ZA 2J46A 5KSYA 1FFAA 2OV8A 2YXEA 1EM8A 3C7AA 4JU8A 3DFKA 2ZSJA 2Q5HA 1T43A 1DRJA 2XDAA 1RNLA 3DH0A 4ZGBA 3PIRA 3KC2A 2VL7A 4MV9A 3TSYA 4KVZA 1T8SA 3KJZA 3KOOA 4M0UA 5AVUA 2VYVD 4LWQA 4C3UA 1NQXA 4KKXB 4KN6A 4I99A 2RB5A 1EWKA 2QG4A 4BE4A 1RP7A 3OO0A 3K9FC 2RE8A 1PNRA 1U0OC 1S02A 4NNOA 1K6MA 4ETWA 3CSUA 3N87A 4MPJA 4TTAA 3HCOA 3W3AD 3X2FA 2BVNA 4QUHA 5JVDB 2XCLA 3P2OA 1KPGA 5D85A 3C3YA 4RENA 2VTBA 4TZTA 1OXBB 3M83A 4RD0A 1W49A 2EJBA 4PV7A 1YQXA 2A3NA 3OLYA 1QPGA 2YXNA 3OCYA 4Q9HA 5F1PA 3T34A 2XXAA 4M8IA 3AZPA 3G5TA 3VV2A 13PKA 1FFXB 4L8WB 4D0LB 3OWXA 3L7IA 4QL3A 4G3XA 2MSLA 3RABA 1C80A 3PPWA 1U28C 3FZQA 3QLUA 4JJEA 4MVJH 4BCDA 4EG8A 4RU1A 1LDEA 3LFHA 3A27A 1CUUA 1G18A 3O0TA 3DTYA 1DV1A 1AUQA 4GQIA 4PTZA 2IXFA 2E18A 1NIJA 1NQOA 2AN3A 3EH2A 3HLTA 5DFAA 4C43A 3ZGZA 1SVMA 4GPTA 4TWBA 1RBYA 2ZAMA 4CKBB 2LKDA 5A2QA 1PS8A 3KTOA 1RQPA 1K92A 4MEBA 5MN5A 1LLFA 2VDRB 3F5FA 1CYEA 1WX1A 3O03A 3P94A 4C22A 1S2OA 4BPRA 1W19A 3BXOA 3G7NA 2NZYA 2P5SA 4TQGA 4IVQA 3UF0A 3ZDAA 1LRLA 1W5AA 5B1YA 1N2BA 3RV4A 5FOVA 3SC2A 4MYSA 5B3JA 1NE2A 1MAVA 3K0FA 3M34A 4CKXA 2O6LA 2PJRA 1QH9A 2J59A 4I8XA 4KR7A 2P0AA 4A91A 5ADWA 2FMXA 1TZ2A 4S1WA 4DCGA 3BYZA 1ADFA 3AI2A 1P7PA 1DAFA 2NU7A 4K9SA 5CK4A 2OLJA 2J6IA 4W5OA 3U1BA 2O3UA 1R9NA 3IAM6 3R0QA 1FMCA 1DKNA 4GECA 1EVKA 2CC2A 5KOJB 1PEAA 2WKWA 1T9AA 3UAGA 3PQ3A 2CDNA 2J9FA 2XUJA 3GJQA 4ND3A 2OGWA 3O8RA 1JG3A 3ZCRA 2QJRA 1LVGA 1ST3A 3OIYA 5BSUA 1B14A 4GWGA 2IVZA 2RGNA 4HFJA 3MTGA 2XKAA 3QEMB 3K5PA 2AOWA 3R09A 3TVDA 1X8LA 2PL3A 3CF0A 3KEQA 1HT0A 4MYUA 3WYCA 5JZBA 2CZQA 1IBMB 1IEQA 4DT1A 5HNKA 5I6DA 1KY2A 4XWYA 3EIHA 4FB5A 3MS2A 2FFHA 3GFGA 5J5AA 4DLXA 4FLMA 4ZP1A 1ZRMA 3AF1A 1YXMA 1U0BB 3UAWA 1U6IA 2EW8A 4XB2A 1OI3A 3I2JA 4OB7A 2P5TB 5CXXA 4G85A 5EUBA 3WMEA 4J0GA 1NPYA 4RXTA 3GUHA 2X22A 3RAJA 1EUYA 4UPDA 3OC0A 3GJ0A 3PCRB 3VDRA 4IIYA 5TR9A 3LVRE 4BO6A 4GKVA 3ANXA 4LPSA 4AUKA 3QVXA 1L7AA 1PV1A 1E2GA 2CDCA 3H9EO 4WVFA 1I4OA 5C8YA 4MV1A 2AEMA 3ABRB 1DC5A 5THQA 1H1LA 2I4OA 4TKUA 1GP2A 4XPIA 4BVHA 5JSYA 2OK7A 1PTJA 1JPJA 1G8SA 1V8ZA 4HVLA 1PCXA 2BI4A 4Z7OB 1RLJA 1RMQA 2EARA 4RABA 4E2FA 7GPBA 1GCIA 1TM1E 2PUEA 4REQB 2FQXA 3I2KA 3VR2D 4Z5XA 1JKMA 1KEUA 1Q83A 2MIIA 3PD0A 4FR2A 1YCHA 1FLVA 1ETUA 1JPNA 1V5EA 1WCWA 2CXNA 3SZGA 2EBHX 3KVOA 3UQZA 3AXSA 3ZHXA 4RPHA 4BOYA 4XEUA 4N49A 3KQTA 3ES9A 4ND4A 2IWHA 1X7ZB 3O82A 1GAWA 1U94A 4F2WA 5IKXA 1QQBA 1V11A 3IMCA 1U7PA 4LJKA 4CDMA 3VZRA 2YZ2A 1G41A 3HWWA 3P2MA 2RHMA 3AUYA 1M72A 3F6SA 3IUSA 4DPLA 1G8GA 3DZIA 2YWFA 4MCJA 4OHYA 3C45A 2J41A 4IQ4A 1KS9A 2VSQA 3FZEA 4KXMA 3SZ3A 3UGJA 3KJIA 3IL2A 1JL3A 1L1RA 1QTIA 1BE6A 3JQEA 1YRLA 5AOAA 3JATB 4ON9A 5ALWA 1HQYE 3L49A 2XJ9A 3D2CA 3A2NA 4CLOA 3AWDA 2VYCA 3OEEA 1NSFA 2V3WA 3F9RA 1UBHS 1GG2A 1RWOA 1YHZA 1FFHA 3AIIA 5DDIP 2HY7A 2NYAA 4KN5A 2DGDA 4OU5A 4JXXA 1Z0DA 1M6HA 3OOEA 1B6TA 1E2LA<