4DDHA

Pantothenate synthetase in complex with 6-methoxy-1-benzofuran-3-yl acetic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
289
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
publication title Integrated biophysical approach to fragment screening and validation for fragment-based lead discovery.
pubmed doi rcsb
total genus 97
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 4ddhA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ddhA01
3RK1A 4RUKA 3COYA 1WJGA 1WZ2A 5LFAA 3F3MA 1MB9A 4ARCA 3UOWA 3MUEA 1PFWA 5TEVA 3G6KA 3RJZA 1TEZA 1QRSA 4DDKA 2J08A 4MW2A 4MUEA 5KCMA 1QJCA 1JHDA 3DPIA 1KQOA 1O94C 1TFUA 4YMIA 1Q19A 1J70A 2Z08A 2DR2A 2BYTA 3CLTD 3CLRC 3TS1A 4F3RA 4I6GA 1VL2A 5F23A 3Q4GA 4ZCRA 2CFOA 3H9CA 4MVWA 4MUGA 3FNRA 2EL7A 3SDBA 3COVA 1JZSA 3AG6A 1K92A 3CLSC 4ZT4A 3SYTA 3TZEA 1O0CA 2E89A 2PFSA 1O97C 1KP3A 2JA2A 1N2JA 4MW0A 2WSIA 4CT0A 2TS1A 2H2AA 4DDMA 2YWBA 2HMAA 4NATA 2QJFA 5DASA 3KT0A 3IOCA 3IOEA 1DNPA 5J5AA 4XSVA 1IQ0A 5KWVA 4MUHA 3KT3A 1YUNA 3H9BA 1J1ZA 3JXEA 4JZYA 1OWNA 3SZGA 3Q10A 4PBRA 4MUFA 1KORA 4KPUA 2J07A 4DDHA 5DEOA 3X1KA 1I6MA 2X0KA 1I6LA 1NUPA 3GUZA 4MW9A 1M8KA 4HPWA 3VU8A 2E0IA 1A8HA 5DB4A 3ND6A 1EJ2A 1NUTA 1O6BA 1ZUNA 3MLAA 3A4IA 5LM3A 4EFKA 2R5WA 3HMQA 4EG7A 1H3EA 2VXOA 1KH3A 1VBNA 2DUMA 4MWEA 3RBAA 2CV1A 4AQ7A 4MUNA 1H1TA 2CYBA 1EXDA 4S1OA 3HL4A 3DLAA 1ULHA 1Y42X 4KPUB 1G8GA 1COZA 4QBTA 2I1LA 1YULA 3M5WA 3L93A 1KQNA 1MBZA 3D6UA 4EG3A 1YIDA 3ZJTA 4J76A 3N9IA 1JEDA 4ZT7A 4MQ6A 3GLVA 4YP7A 1VBMA 1LW7A 4EGAA 2ZUEA 1F7UA 3ZXIA 3OTWA 4ARIA 2CYAA 4GU5A 4HJRA 4ZCTA 4MW4A 3TNJA 3Q12A 3ND7A 1U7DA 2J5BA 1IRXA 1JECA 3FWKA 3PNYA 1V47A 3CR8A 1D2RA 3TQIA 1MC1A 1YUMA 2D54A 3UC5A 5FO0A 3FY4A 5EKDA 2A1UB 1VLHA 1KAQA 2DEUA 3IOBA 3IMCA 4RPIA 4FZJA 4ZT3A 3LCJA 5KHAA 2YWCA 4JXXA 3N05A 3AG5A 3RK0A 3VRHA 2VTBB 4NZPA 1V8FA 1KR2A 3H97A 2IP1A 1QU3A 1N2IA 2YY5A 4MLPA 4PBSA 5TEWA 1GPMA 3A05A 1P7PA 3ZUGA 2GKSA 3P52A 5FO1A 1GZUA 2A4MA 4WSOA 2NZ2A 1ZH0A 2PZBA 3IUEA 5DK4A 1JZQA 1Q77A 4K0RA 2C5SA 1RQGA 1JIIA 1ILEA 2AKEA 2NSYA 1EUYA 1EE1A 1F7VA 1T6XA 2QTRA 3FHJA 5IJXA 2A88A 1IFXA 3NV7A 4CDNA 1CT9A 3UMVA 1U3CA 4J75A 3CLSD 1QQTA 3IMEA 3DV2A 4DLPA 4P2BA 2ZP1A 2PZAA 1TYDE 3I05A 4MW5A 1EFPB 2DPLA 1NYLA 2G36A 3CVUA 2CSXA 4MW7A 1XJQA 3U1VA 5AHWA 3VGJA 4UZEA 3SZ3A 2QUKA 1NSYA 2QJOA 3NBAA 4UZFA 2X3FA 2DXIA 1G8HA 1J21A 3HFJA 3MXTA 4DE5A 3A2KA 4PBTA 1G8FA 3ELBA 1R6UA 2E18A 2CV0A 1JIKA 2HGZA 1ZH6A 1O96A 1J09A 3K9WA 2Z3VA 1M8GA 1K4MA 3MLBA 4MW6A 4U63A 1QNFA 3GMIA 1TYAE 3ILVA 2WB2A 2DLCX 5J58A 4OUDB 1JIJA 2CT8A 2J09A 3LOQA 4X0EA 2QUIA 1O95D 1Q11A 3MMXA 3KT6A 4HK4A 1JEEA 4YP6A 3CLUD 1SURA 3N8HA 3P0JA 1N1DA 4NAUA 5TS2A 1H3FA 3CA8A 2DERA 1N2EA 2A84A 1LI7A 4Q16A 4Q93A 4MAFA 1BS2A 1EFVB 3DO8A 1IH8A 4ZT6A 3OP1A 2D5BA 1I6KA 2GM3A 4EG5A 4H3SA 3AIIA 1NUSA 4JXZA 3CLTC 3SEQA 3FOCA 3CVWA 1N75A 1OWOA 2RD2A 2PZ8A 2ZUFA 2XRYA 1S4MA 4MUKA 3ZIUA 4R2LA 1M8JA 3NBKA 1N2BA 2J4DA 4MUJA 2BTEA 1IQUA 2Z09A 5H7XA 1QRTA 2IJGX 4DJAA 1NI5A 1N2HA 2A1TS 1N2OA 2PIDA 1WQ4A 4EG4A 3CVYA 5FNZA 3G5AA 1GTRA 4JYZA 1N3LA 1N78A 4MVYA 1VBKA 3PNBA 4L2IB 2A86A 3AKZA 5TGTA 1OWPA 2JAXA 1M83A 4F4HA 3N2YA 3FDXA 4K03A 1O95C 2O5RA 1O0BA 3FI0A 2D13A 3COZA 1WOYA 3IMGA 3FIUA 4EG1A 1MJHA 3TZLA 1J20A 1FYDA 3CLUC 1KKUA 4MUIA 3IVCA 1K97A 1PFUA 5HG0A 5K0SA 4L2IA 3L92A 4MWCA 1Q15A 4EF6A 1LI5A 3CVXA 1WXFA 3X1MA 3K32A 1JILA 2V0CA 3INNA 3AFHA 4OJMX 5LLTA 1IHOA 3H05A 5HUJA 1ZJWA 4E1AA 1TQ8A 2B7LA 4U7JA 1EFPA 1OD6A 3P0IA 1IVSA 2QTNA 1WXGA 1XNHA 3ZXSA 2VTBA 2A7XA 3ISJA 4I6JA 4MVXA 4MULA 1R6TA 3ZGZA 5J59A 1G59A 3HGMA 2QJTA 1KQPA 2AZXA 4OUDA 2CV2A 2XRZA 1X8XA 4YBRA 2A1UA 1NUQA 1O94D 1MRZA 3IVXA 4JFAA 1R6XA 2H29A 4EG6A 3IH5A 3CLRD 4XFJA 2HZ7A 1O96B 1T9GR 1KH2A 2DETA 4ND6A 3QTBA 2IELA 2E21A 3ND5A 4HJXA 4CQNA 4DNXA 1QRUA 3RHSA 3H99A 2OV4A 3QTTA 1HYBA 2A1TR 2YXNA 1X6VA 1QU2A 4KR6A 3P0HA 4G5FA 1PG0A 3PNVA 4R0NA 4U8HA 2WQ6A 4CDMA 4NDAA 3FG9A 4AS1A 1KH1A 1T6ZA 1WY5A 2RE8A 1T9GS 2WQ7A 4R2MA 1WXIA 4G6ZA 5IHXA 2X1MA 3ZJUA 3QE4A 1I2DA 3UK2A 1T6YA 1WQ3A 4MVCA 1EFVA 2EJCA 4YP5A 1EUQA 2AG6A 4QREA 3IUBA 1NUUA 1OBCA 5H16A 1JGTA 2GOYA 1YI8A 5JBNA 1IQRA 3IVGA 1U7XA 3KFLA 4KR7A 1FFYA 1GLNA 3AL0C 1K4KA 1N77A 1J1UA 1KAMA 1B6TA 4GRIA 4A91A 4MWDA 3ZJVA 4ND7A 3KT8A 1WKBA 1OBHA 1XNGA 1M8PA 1MAUA 1O5TA 1MAWA 1GN8A 1WXHA 2OQ2A 3TQOA 2PG3A 1KP2A 2PXHA 4XFDA 4MW1A 4WNYA 4KR9A 3BL5A 4MWBA 1U0BB 3FH0A 1OWLA 1GAXA 3X1JA 1WXEA 3FETA 4KKVA 1N2GA 1NZJA 4NAHA 4ZCSA 4QRDA 1XNJA 1UFVA 1TYBE 3COWA 3SEZA 1F4LA 1TYCA 3PRHA 2CUZA 1M8FA 5BNZA 1NP7A 1JMVA 3A04A 1PFYA 2CYCA 2QTMA 1YIAA 2JANA 5K0TA 3S3TA 1MB2A 3UY4A 4NX2A 1NURA 1GTSA 2V0GA 5HUHA 4ZT5A 3D6VA 4PY2A 4ZCPA 3HZRA 4ZCQA 1PG2A 3C8ZA 1H3NA 3CVVA 1M1ZA 3HV0A 2X1LA 3E27A 1PFVA 3SP1A 4I6EA 2QUJA 1F9AA 4BWVA 3RFFA 2O8VA 1O97D 1MOPA 2QUHA 4TS1A 1QTQA 4G5YA 3IODA 1OWMA 3IDFA 3G59A 4ZT2A 3LE8A 3PXUA 4EG8A 1U3DA
chains in the Genus database with same CATH superfamily
5IWAB 2ZTLA 5A3RA 1GL3A 1C8BA 1CF2O 1KI2A 2BFBB 2HF2A 1KAEA 5IM4F 5JYDA 1NDUA 3IALA 3HCWA 2HPAA 3KFVA 1T2VA 4ZV7A 3ZLTA 4K9QA 1TFUA 1SBHA 3QFRA 2NIPA 1N9GB 2GPTA 3EGXB 4UAUA 4YMIA 3W4IA 4PLWA 2IS2A 4ND8A 4U7DA 1ZVVA 3X1DA 1Q19A 1Y5RA 2GAJA 3GR6A 2QIOA 5EJGA 3FYSA 3LUCA 2VQFB 3CLRC 4KPFC 4OXXA 3G1WA 3DNMA 3OQHA 1N7GA 4JN6B 5IEJA 3RYTC 4I9HA 4N9QA 2P2YA 5IRCD 2D1FA 5SZIA 4TMYA 1A88A 5HFAA 2JBWA 2PKCA 5I48A 3N8GA 3GFGA 4MV7A 1K92A 2BZ0A 4KRYA 4PHHA 1WR8A 4HYTA 1AGRA 1Y1QA 1O97C 1MRNA 4PIMA 1MC5A 2PGAA 3CX7A 3BRWA 3G9QA 4GX1A 3IAM6 2XWSA 1XAIA 9LDBA 2C9ZA 4KAAA 1U63A 3LKZA 2FPSA 2H2AA 2BM9A 2YQ5A 3D02A 5EXDA 3DHEA 4XWYA 3C15C 2IEDA 2C7RA 1W4BA 1UMBB 3B20A 1A76A 4IQFA 2FDXA 5K3BA 1XHFA 3QKSB 4TSFA 2RAPA 4WH0A 4ZMBA 1F14A 3QQPA 5AVRA 4KXFB 4JNKA 2X3YA 3R6GA 4AJLA 5I4IA 1MORA 2AWNA 3G0BA 1SXIA 3OOWA 3K2IA 5LWQA 2IODA 4FGSA 3WMXA 1YS2X 4K9SA 3PQ2A 1QHFA 3DC7A 1FSGA 1EFCA 4KDCA 1GZ7A 3UOAB 4CCWA 1FRNA 2RSLA 2FA9A 4OHFA 4DDHA 2GXQA 2R8OA 3GLSA 4Q4HB 4GGMX 5NULA 5PGMA 3X1KA 2CJPA 4DSZA 4FD2A 1GO2A 2K2QB 5B3JC 4AB1A 4RE6A 2OZVA 1EMDA 5CB8A 2FFHA 4MW9A 4IY1A 3GLRA 5C7IO 4BDSA 1Z82A 4P4GA 2JFZA 1OASA 1VLJA 1U02A 4U4AA 1RBMA 3BICA 2F3QA 5DWDA 1DJOA 2VBIA 3VM6A 1P4JA 2DBRA 1IDN1 3UBTA 5IC4A 3IVAA 3S1LA 3JAWB 1WL8A 4G4JA 1ISFA 4WOKA 4YLGA 2VXOA 3F7OA 2QZZA 5J4YA 3K6SA 1BN6A 1PP4A 1QHEA 2JFNA 4C78A 2IOYA 1KWKA 2GPNA 1OI7A 2JHFA 3CRQA 4WD3A 2WWTA 4Q00A 5JFGA 3U7QB 2Q2WA 1P7YA 1EP2B 5L3SA 1DEKA 3HO6A 5DHRA 4FZ3A 4GRDA 2MR5A 1U2GC 1CS0B 2O3UA 4F8YA 2JKYA 4CCYB 1SCKA 3A1VA 3WL5A 3H5LA 1IY8A 1YS7A 3OUTA 1KZ1A 3EZ6A 1ZD2P 1YU6A 1AHNA 1O58A 2K5UA 1KI7A 2R8XA 5EPUA 5HNKA 3RHZA 5ANRB 1TVKA 5K3FB 3CSSA 5EOVA 4WE3A 4PO3X 2A53A 4NMWA 2IDMA 1RXYA 3OQ6A 3ZJTA 3HYCA 3NS7A 5EYPA 1PNRA 2RGNA 4B6JA 3CZ5A 1F06A 1P0QA 4IDBA 2G9QA 5AO9A 3LQYA 1QZUA 1VBMA 2NU6A 1VJDA 1W29A 2RHDA 1Z2PX 4KYTA 5DISB 2PS1A 5EWLA 3WAJA 3VX4A 4LF9B 2JCGA 3COPA 1PFQA 2CWDA 3SKXA 3HVKA 1UR5A 5KX5B 4TMVA 3DONA 3AKCA 2JBAA 3IB6A 1RI4A 1QJ4A 1QLHA 1HYQA 1PZHA 3ZDZB 4XVUA 2ZE8A 3D5EA 4GP6A 2REBA 1THGA 4H7PA 4GPBA 4TLMB 4UVHA 3QU9A 3OIWA 3ILHA 2NU8B 3T9DA 4D98A 1X42A 3PZRA 4UHHA 1R0WA 1TC2A 2IVFA 1II8B 3LGAA 4P6VF 2G8NA 3N2ZB 2AMLA 2NUPB 4HFJA 1VB3A 2DEUA 3ZE6A 3UC9A 5L3QB 3OJLA 1VYVA 4RD6A 3EDYA 4ZWNA 4FHGA 4RVUA 4FZJA 3W6PA 3WWYA 4CDRA 5J4HA 5LU8A 1QRAA 1Z07A 4G07A 1GVHA 2COEA 7MHTA 1XLTC 4HI0E 4PWYA 5D7NA 1OB5A 2XNDD 1CB7A 1MFPA 3BF7A 3PE3A 3ZY4A 2EX4A 3GIWA 4J94A 2YY5A 4MLPA 3HHEA 2VBFA 1GPMA 1ODLA 3A05A 4GICA 4TL7A 1P7PA 2JHGA 1FW6A 4QNMA 4D4IA 2YNMD 2MU1A 1U9IC 1Z6YA 2NZ2A 3GUUA 3S28A 3C6MA 4LRUA 1RJWA 1WDLA 4EB0A 3AR7A 3ZWAA 5CYOA 4MQUA 1SKAA 2CUKA 1YNOA 3KCQA 4DV3B 2W2MA 4JL8A 3WQHA 1ZICA 4WDRA 3QI2A 1R5OA 1FP4A 2ZPAA 3NV7A 1UINA 2H9AA 3HUUA 3LSTA 5FLYA 2VHUA 4RPKA 2YZGA 2GKOA 2ZP1A 3Q9UA 1MJNA 4C4TA 3I05A 4IFTA 2IV2X 1EFPB 2V3WA 1NYLA 1AK2A 1OFUA 2R5FA 3HCOA 3QHPA 3L7LA 1Z4OA 1PSZA 3DW1X 4LX8A 5ALQA 3MQ2A 4BTEA 1KI9A 1YMUA 5T64A 1OGJA 3RIHA 4V02A 3STTA 1JB1A 4KE6A 3HQ4O 2RAFA 3EQ6A 3HH8A 3PQ5A 3UT6A 2NO9A 2ZIZA 5L53A 2GERA 1GNSA 2HU5A 4CEHA 1T4GA 1J2YA 1LNSA 2C4WA 2FMXA 3A2KA 4PBTA 2BEKA 5EZ5A 1DKNA 2CLKB 2HMUA 1W85A 2WVAA 1NP3A 3ANNA 3IO5A 1GRCA 3PNMA 3PXCX 5EJMA 4IRXA 4MI1A 5HHTA 2JGFA 1SVSA 4MV9A 5M5BA 5FAKA 2QMUA 1WVGA 1ZGCA 5IC6A 5ED4A 1NM5C 3IAXA 2WINI 2C96A 1Q17A 3GGDA 3LF1A 3LX5A 2IYYA 2VJMB 4W6QA 4AZTA 5E6RB 5DTJA 1R12A 2J09A 2CT8A 3HKCA 1Q11A 2R7MA 4KSBA 3IAS6 1GPBA 2M1XA 1XEXB 2H7XA 1YQ9A 4B4VA 2ZJ6A 1JEEA 2HRQA 4ZI3A 3TLCA 4DA4A 2XCRB 1O08A 2F1KA 3K0FB 1DFGA 1KZ7B 3KUXA 4PGGA 5KQLA 1TZ2A 1M1NA 1P81A 2IY7A 4Y67A 1T0PA 2IHZA 1O89A 4I1YA 2OWEA 3ZDRA 1NJSA 4RIIA 4D9IA 5AFSA 1UEJA 4HBZA 4Q9JA 1ZDMA 3PPVA 4NFSA 3QHAA 3JYQA 4K6MA 1GZDA 1NAIA 2AXEA 2Q3HA 2YWGA 3K0HA 4M8LA 1QAOA 1LBSA 1RPAA 1G4AE 1NM5A 1QVAA 1RABA 1TK9A 3AKEA 4NMLA 4B4UA 2EBUA 1ZHOA 2XWQA 3DR3A 2PRKA 4QBIA 3BMCB 4OK6A 4XEHA 1FVXA 2C29D 4B1FA 5IT9A 1C3JA 1SCJA 2HU2A 4XR9A 1XDSA 3GEPA 2WD7A 3NIBA 1A77A 1W52X 4OV6B 4KRFA 2ZUFA 1BDIA 3AUAA 3S2IA 3O31A 4V0OA 3KYDB 2LRHA 4RL4A 2B69A 4Z8XA 1AUQA 2WZCA 2UUBB 3L7IA 2PS0A 1NC1A 5IG2A 4N0QA 4IDEA 3K0CA 3EXIA 4RK6A 1Q0QA 2VDVE 4XD7A 2FX5A 3H75A 2DPYA 5FTNA 5H7XA 4LXUA 3L7KA 5FXMA 3TW6A 2PZJA 4C0LA 4UBOA 3EFOA 1NI5A 2Y0EA 3KTAA 3T5DA 1FIUA 2R1VA 2OP1A 3DV9A 4B3RB 1TVMA 3PPYA 1R37A 5I9LA 1LA2A 4IP0A 4HKTA 1DCKA 1MFZA 3QKIA 3WAKA 1JSXA 2D4AA 1VI5A 1PGNA 3NANA 4Y2SA 4AG3A 1IN1A 4PG4A 1SOVA 1DTSA 4GLFA 4Q48A 3B1YA 4GM0A 1CJSA 4BUCA 4JC4A 1DAKA 2Y68A 1GGEA 3RM3A 4KXVA 1OQAA 1HT3A 2C54A 3FGOA 1ESEA 1CY0A 2CHGA 2N46A 1Z29A 4KRXA 3NOVA 4OSEA 1KEKA 3O2QB 1UDCA 3GGGA 5TGTA 1OWPA 2HXSA 4QG7A 3HDYA 1OXBB 4NAVA 3AY7A 4RDXA 1Q1NA 3H6KA 1XZGA 1O95C 2HQ1A 3EPPA 1U2PA 5EHIA 4UOEA 1ZCAA 4G0YA 4LCJA 4GVLA 4UE2A 3HADA 3HK2A 1P60A 1XFDA 5FJIA 3TNLA 3BMCA 3LP6A 1KXZA 5AQ1A 1XJ5A 2JFWA 4O4JA 1FMFA 1YZUA 3UW3A 4ZU3A 4EHFA 5HKOA 2M6SA 2QU7A 3GAFA 1LBHA 4G0QA 4DDUA 2ATCA 3NTRA 4GOLD 3DLPX 2H4JA 2FEOA 2PZFA 1PLJA 4IX9A 3DCYA 2B36A 1EFUA 4L27A 2QRJA 4EI7A 5ERXA 2NGRA 4W6ZA 4MQEB 3O4FA 3UBMA 2PJUA 3LUJA 2DULA 4IVNA 2OLKA 2R1TB 5HF8A 4CLRA 4BC1A 4C9BA 1K7XB 2PVSA 2FUG6 1UMKA 4Q9LA 2QTNA 1GQQA 1RWXA 3QGMA 5BV2P 4I6JA 2WSYB 4E07A 1U80A 2OZKA 2A67A 3V1MA 1UPUA 4D8UA 3SOPA 1WTAA 4EW3A 3SVTA 4F9EA 1N2ZA 4IKPA 1R00A 2XMPA 3H2IA 3HB4X 3NM4A 3EQ8A 2LDXA 5BSTA 1A1VA 2N3ZA 4QEDA 2OCAA 3LTNC 4OATA 2QBYB 4MRPA 4LFCB 3QNUA 4PX5A 1O94D 1AKUA 2Q5HA 4QUDA 4G65A 2O5EA 5CNKA 1OJ7A 2WU3A 4BNIA 3IV9A 3C4VA 2VTEA 4QO7A 4FHCA 4JKOA 4ZVSA 1KKLA 4L4SA 3ZWXA 1D5WA 1GZ6A 5LNK6 1OCEA 2QMOA 3O1HB 3JY6A 1UT6A 5GZ3A 5LP6F 1H1LB 3TI9A 3RRYA 2LUOA 4F7WA 4H6PA 3UPTA 1I3LA 4EYGA 2YYYA 1GITA 3H99A 4FUTA 4FT2A 2QNBA 4RV9A 5SZKB 1O8BA 1CQZA 3CF0A 4EPRA 2JJ1A 4INZA 3VKUA 4DBZA 2J0SA 4HEQA 4BVJA 2IH2A 2HA5A 5C1IA 1R4MA 5AW5A 1NG9A 3LA8A 3KZCA 4LNAA 1JHVA 4HOYA 3H5OA 1WUIS 3DD1A 1UJMA 2ZB8A 1NQOA 2G1PA 2GBFA 2YVQA 4MV4A 5BR8B 7REQB 4KVFA 5KJCA 3ETEA 4ALLA 3PR1A 2VJCA 3HA2A 1U7TA 3WHLA 2QM7A 3SWWA 3PQ6A 1LPMA 3JZFA 3JD0A 5AJTA 3TQHA 4IHAA 1ZNXA 2GR7A 3E3LA 3VV2A 4ENQA 1RP1A 3U3ZA 4MVCA 4BMCA 1OFGA 5LQJA 2C8JA 1U28C 4PEVA 2IHJA 3D7SA 1V1RB 2VI5A 3ME5A 1KOLA 2PX0A 1NMQA 5DHQA 4QJ3A 3OY2A 4IEIA 4GH5A 4M54A 2GEFA 1ZRMA 2B20A 3KX2A 4JA0A 1DC4A 5LOVA 3T7RA 3NBYC 3REQB 2W5UA 4UEWA 3ZY3A 3WQQA 2VTVA 3B13B 3LQ2A 2NXNA 1EVEA 3E0QA 2VKQA 3G88A 3K0BA 4JJEA 4P5EA 4KVZA 2O7NA 1RBYA 3DL7A 1O4WA 3VR5A 1SBIA 2QIPA 4W7SA 4R1SA 2Q49A 1CUXA 1EXMA 1WXHA 4DCOA 3HBFA 1YTUA 3VMFA 4HNVA 1VKOA 5ALKA 5KTTA 3H2JA 1YONA 3FDZB 3I53A 3ZE2B 1OF1A 3C7DB 3BD9A 4JBGA 5JSZA 1PWYE 2ESRA 3R20A 1WZIA 5GVRA 1KFKB 3VBEA 4TLBA 1H42A 1CDOA 2V6GA 4B34A 1JTEA 1U9CA 1H6DA 1WOMA 3C24A 5LUAA 3D81A 1TYCA 2JBAB 1SVMA 5JS6A 1NW4A 5F21A 4REMA 4RV5A 5TQ2A 3GJ8A 4Q4JA 4N47A 3UJAA 4DMKA 3W5CA 4MDHA 4TXLA 1M6EX 1G8SA 1NXXA 2PT6A 1NOIA 1ZW1A 1Y8RB 2XYPA 4IG9A 4Y2PA 4KZPA 2XAAA 5HIJA 3HN6A 5CVTA 4LJ5A 2B4AA 1YE3A 4TMWA 2IBMA 2CL7X 3MOGA 4MB0A 3M2PA 2C2XA 2XAUA 2D8MA 4TRRA 4XPIA 3VR3A 4EIWA 4QFMA 2BGGA 3SIRA 2HYIC 4FIDA 3UWDA 3HVUA 1JALA 2QDKA 4WNIA 1DBVO 2OOSA 2XYHA 3L1KA 2JZNA 4L7QA 4PPQA 2E4VA 4QT0A 5E0KB 1CY2A 1TQHA 2ERCA 1V35A 3JQ9A 2Q2OA 1GRVA 3GMDA 3AFGA 1XXHA 2H0QA 3KUKA 3L7CA 4IMIB 4CCYA 1K8XB 3C8ZA 1TLLA 3ECAA 2YBDA 5GONA 3MRTA 4NLLA 4R4JA 2CE7A 4A0RA 3GV0A 2XUGA 1II9A 1Z7BA 3F6RA 4BWVA 4J3FA 1QTQA 4KN5A 1KI1A 2GZ2A 4XLLA 1KQ3A 3E82A 2QX6A 1CYDA 3VZPA 1ZOOA 3R3HA 4LPKA 3RK1A 2W6QA 4A2QA 3COYA 3IAHA 1DQSA 5TLSA 5K7SA 3MMSA 1Y7HA 4I0WB 3E4DA 4JIMA 2I8AA 1NC3A 3NH9A 2QLNA 2VPXA 1QOZA 2IZOA 3FLAA 5GOTA 4G2TA 4DDKA 1QV9A 1VC2A 4LV5B 3WYNA 4LKOA 4DPKA 1JHDA 4EA8A 1O94C 2O8EB 4EDHA 4BGDA 2PUJA 1GPLA 1VKNA 1D0SA 1TJ3A 1UP6A 3BSYA 2PU7A 5DNAA 5H83A 5HUQA 1ICEA 2OILA 3IUPA 5TF0A 3MJRA 2EV9A 3CR7A 3U4MA 4CW7A 2CF5A 1EK6A 3GG9A 4U00A 4ZCRA 4MVWA 4F85A 3KEMA 2W71A 5ILGA 2OMEA 1YSCA 3ZZ0A 2EL7A 4HWRA 5JAOA 1E2GA 1FX0B 1M0TA 2BHTA 3HV2A 5DT9A 1RACA 1AKQA 4PPGA 3UENA 4LY3A 5HZMA 3QKSA 4FBMA 1XYYA 4CKBA 2Z2YA 5ALNA 1BMQA 1G3UA 2OOKA 4L9RA 5LWHA 4QOIA 1PQWA 1NWHA 1RC0A 4IUBS 1X2EA 3ZUPA 2EZ8A 3O21A 3B3QA 3E2IA 1E3WA 2AOXA 4YJ2B 2NVBA 3L1VA 4LXXA 4PTZA 4HNHA 3GUCA 1SC6A 2QT1A 2BHLA 3ONDA 1QQAA 4E7PA 4AJ4A 4LSWA 4DREA 4M0DA 1W4CA 4BNVA 1X1QA 4KHZA 4NH0A 5KTOA 3EXG1 3JXEA 4JZYA 3GAMA 2I22A 4WMLA 2QN2A 3JQGA 4QDOA 2QTGA 4OXYA 4NMHA 3DKIA 2P5UA 1XF1A 3C3AA 1GUAA 3E9YA 3I23A 4RYDA 2Y2UA 3TI7A 1JYSA 2FU5C 2J07A 2WSSD 1RPZA 3DSRA 3LUPA 1NBME 5DYYA 3GZNB 4G4SO 1FQJA 4WBNB 4ND8B 2VJNA 5EE0A 2R6CA 3TZCA 2VHZA 2P2ZA 3EQ7A 1XCPA 2DKFA 5T3YA 1N6KA 3B36A 3KAKA 3SEAA 4QRIA 4TM8A 3SR4A 3TJMA 5CT6A 3WIDA 2P78A 1XB2A 3MEQA 2VP9A 1E77A 3N0WA 4TXMA 5EKTA 1ELOA 3HVIA 3GVHA 3K4HA 4BNYA 4HPWA 1ONOA 3AOEA 4GECA 4PZYA 3TRKA 2B25A 4V3CA 2BBWA 2G72A 5DB4A 3PXGA 1C4WA 3BRQA 3ELWA 3EW9A 5EE9A 4TS9A 3EVGA 1FPMA 1G8JA 1ORDA 3KYIB 4DIMA 1EWQA 3G0OA 2LXNA 4G41A 1PWXA 3CFAL 2I9PA 2ZWVA 3EGWA 3ZS8A 5JAZA 3CXUA 4ZO9A 4RD2A 4RZ2A 5AI6A 2ZS7A 3QYJA 4X41A 2H8KA 3VR1A 4EYSA 3E53A 3GVPA 2I67A 2PH1A 2J7PD 1D8AA 2OUIA 3PIIA 4MQFA 3ZZTA 4ZYTA 2IU4A 3VR0A 1BA3A 1YKFA 4C5AA 2OD7A 3VHXB 3DLCA 3TOSA 1CFZA 1KMHA 3EIEA 1E4OA 4KXXA 5G0WA 4GD3Q 4ICIA 4F4UA 5JYCA 4DMCA 2E2WA 1MGPA 2V7EA 3EIHA 2FSFA 2PX3A 4XIGS 5JLJA 1U9JA 4PRLA 2JLZA 3FVWA 3WRXC 3SFZA 1F60A 4MDEA 4ZI7A 4N3CA 1V9SA 3HP7A 4P7BA 2VYVA 2G40A 2IBSA 3VC2A 3KQKA 4W9MC 1F7UA 3PLAE 3I6IA 3ICWA 5TMDA 4TLEA 1W1WA 2B61A 4FNOA 3ZWNA 2PUFA 4C2AA 4NBKA 2BCEA 2VK2A 4MS4B 4C0SA 1ISPA 1CHDA 3GRPA 3LUBA 1MOSA 1ID1A 1TT5B 2HB6A 4QTYA 3FFAA 4R8SA 3ORQA 2QGNA 1NMEA 1I5EA 3E2MA 3L1UA 4IS3A 2D2EA 4MJLA 1PNOA 1V5WA 3HSYA 5JS2A 2Q5CA 4I50B 2DTDA 3WLQA 2ZUDA 1DJLA 2AKYA 1W44A 4KQCA 5BOSA 2O8CB 3HCPA 4M0CA 3W0LB 4IJUA 1D2RA 3X1XA 1R7RA 1H2ZA 1U2SA 1KMMA 3EZNA 5EXPA 4F2HA 3VISA 3VSDA 4OFWA 1CUHA 8GPBA 1XRLA 2VZLA 1A3CA 3DEFA 3D3KA 3SJUA 2MR6A 2B1GA 3VU0A 4OVKA 4YMVA 3S8MA 4P7KA 4V1CB 1KQFA 1CQJB 2Y3IA 2O8NA 4GP7A 3LT2A 2FUNB 3OBBA 2EYUA 3DHNA 3LTEA 4EPTA 5KHLB 1CJKC 3ONNA 2DUJA 2QDXA 3K9FC 1Y8QB 1JP7A 1Y0BA 4NZPA 4BIMA 1OB2A 2PVCA 1YZ3A 4IILA 4ZAYA 4GPTA 1QGZA 3ZTTA 3MWLA 3VU3A 1AG9A 1AS0A 1XZMA 2DHEA 1XVTA 2OM6A 3PKIA 1WUYA 1V2HE 3RKUA 3ZQ6A 2WJHA 1XMJA 3GT7A 3IULA 4W1QA 2YQZA 3AONB 3CZ4A 2QUZA 3HL6A 3IUEA 1GUDA 1P80A 2EZ4A 4EUFA 2IE0A 1NXVA 3UK0A 4CQJA 2XT0A 4N3BA 3ZV4A 3TKAA 3AI3A 1QFSA 3KL2A 5LYJB 2GZDA 4RFVA 3CX8A 4K87A 3PZBA 3C1TA 2R11A 3VH3A 3WIVA 4J75A 3N8IA 1TUIA 5E2AA 1EJBA 4XCVA 5H9VA 4DPMA 4FIZA 1NPYA 3NETA 3U4IA 4ROTA 3I64A 3N2KB 5TS3A 4WECA 4UMDA 2VT2A 1H4SA 2X4LA 4YYEA 4LK2A 5G0TA 1GL9B 2F3TA 1PDVA 2PPVA 2AC2A 2WYHA 2XZOA 1DDGA 4OTZA 3G2JA 4TGLA 1OXVA 3C4JA 3V00A 1H4VB 3IA2A 2AFHE 1LC0A 1ND6A 3EEYA 4ZEOA 3WGJA 1T5LA 1SG6A 4XOUA 4OQPA 1A9PA 1X7XB 2JI6A 1LNZA 4HZUB 4Q5IA 2B4QA 3DQQA 5ELLA 1YJAA 1IXZA 2PRSA 3LHKA 4JKYA 1RLMA 1JG2A 2R4UA 1Z0JA 2JRLA 3A6JA 4DLTA 3MVEA 4YRNA 3D5TA 4P7GA 5I5EA 5KYTA 4A6XA 1U90A 4TT3A 1LDGA 2VP0A 2W83A 3OO1A 4GXTA 3VYTB 1H9CA 3GMIA 1L5HA 1YNSA 3CZAA 3DE3X 2NO6A 3HWWA 3OFNA 3TQSA 2VP6A 1XLWA 3D3WB 2HDOA 1T5DX 4G5GA 1ZP6A 1KSFX 3SQWA 4CMJA 4F86A 1XTPA 2PRYA 4B71A 1FRFS 3B6JA 2A58A 1AQ6A 1C4OA 3RC3A 2QKYA 2DH6A 3QY9A 1RM5A 1Z75A 1L5WA 3JALB 4JLVA 2ZRQA 3TAUA 2I4LA 4Q12A 1PL8A 4AJEA 2RETA 3F5QA 1UBGA 3TW4A 5A6SA 5ITZB 4RTJA 2HHJA 2H3EA 2SNIE 2I78A 3DOFA 4O2BB 4AJ1A 2J6HA 4M1MA 3L4KA 4DKJA 3G9XA 3FPKA 1RADA 1UF9A 1YFKA 3RVDA 1X7WA 5HQ3A 3WGIA 1Z08A 1PV4A 1NMSA 1RFGE 4PHGA 1I6KA 2D8AA 1X0VA 3R3WA 2W2QA 1E1CB 1QS0A 2HYDA 2Q41A 4P3OA 4UM5A 5DHSA 4ZD6A 4NJOA 3R3YA 3D0RA 4P0TA 4Y9UA 1P1RA 1G64A 4AU1A 3BH7A 4LJSA 5CVDA 3U1TA 3S2GA 3PX7A 1YGPA 2Q4OA 4XX0A 3QPBA 1UMCB 2VSNA 3AJ9A 2GYWA 3DZ8A 5DGXA 1RPJA 3D8BA 4WKPA 2E5LB 1L8OA 4AFNA 1DKQA 2H5JA 2XE8A 3LCVB 2ECQA 3FJOA 4C4AA 5HJEA 3T3PB 3TIFA 2I62A 4RDHA 1OBVA 2VJLA 5DRYA 3EC2A 4IFEA 3R9WA 4DV0B 3R3ZA 3DJFA 4Y2VA 2B1IA 3AV0B 4YRBA 1ECBA 1KYIA 3DL0A 5IBPA 4C0AC 1AK9A 1K6MA 3RNLA 3OCZA 2CXSA 4GXRA 2AI3A 4CT4B 2ZE6A 4K9LA 3ACBA 3BWXA 3T9AA 1XVVA 1POXA 4IRUB 4IJKA 4YJHA 4A0FA 2CNNA 1BE8A 1OAKA 2NZJA 5D5HA 3ZCQA 5CEJA 3P2IA 4N5IX 3WLNA 4CM9A 4JT8A 1XD2B 3LY7A 1IL0A 4IFBA 3UXHA 1JPVA 4PYQA 3VKHA 2O4CA 4MRMB 1E8NA 1GARA 3RKSA 4UUAA 4FFNA 5T3UA 3SJ7A 1ISMA 1E3IA 4BVBA 2WLSA 1B26A 421PA 3FCOA 3ZHOA 1Z16A 3N2YA 3O3MB 4OU4A 4OHWA 2C2GA 1ZA2A 3A6ZA 1A5SB 3LDFA 3ZLVA 2PJRA 1E6UA 3K1ZA 3FI0A 4N5LA 2QL5A 4Q7QA 5EJAA 3COZA 4Z0NA 3O6VA 1TTTA 2XGSA 1C30A 4O0MA 2QRMA 4KUGA 1SD1A 1U11A 1I4TD 2WWRA 3QPUA 5CX1A 1XMIA 4Y2QA 1FQWA 3DOEA 4JJ6A 4P93A 5JECA 4D0SA 2X76A 2XUKA 3M1LA 4UULA 1MQ8B 4IL5A 4YRJA 4J0KA 5EP3A 3UCXA 2OECA 2PGXA 1EAMA 2E4ZA 2GPWA 4HQ0A 4QBFA 4XE5A 4AUNA 3CCCA 3EQ2A 2HM7A 1USGA 5BN1A 5KWIA 1SC4A 3OQIA 5G40A 3F6PA 4Q7JB 1DTWB 2NM0A 3BTOA 2BKXA 4MR7B 5FYDA 3RFTA 3S44A 5K8CA 3VR4A 1UAYA 1ZVQA 2XQGA 3ONEA 3KHSA 3UK1A 4X5OA 4EPWA 1OD6A 1S2DA 2PSDA 2QXUA 1WABA 1GFZA 2B2NA 3MWJA 4KK3A 3WYGA 4K26A 1MEJA 1Z26A 4KLNA 4CR7A 1E1YA 1HLFA 1JIXA 2OHVA 4CM6A 1ECJA 4ARSA 3PA8A 2ZT8A 3EYAA 5P21A 4RM3A 2OG2A 1R74A 3HDVA 3SVZA 1VIDA 5IT4A 4JP1A 1Z0UA 3ADPA 1Y3HA 3QOYA 1RLIA 2YJ3A 3QXJA 4Q02A 5DSXA 3TVYA 4AJNA 2XXAB 2O20A 3R3UA 3KQYA 4G63A 4MWOA 4B83A 4CF3A 1UWVA 4C87A 3QUAA 2RHHA 3BPSA 5C37A 3UQYS 3ZWQA 3NDIA 3CT4A 3AEKB 4HAIA 1NSTA 5EI5A 1PYGA 1ZH2A 2NAFA 4NIMA 2IELA 1HH4A 5DI3B 4IVQA 4R1PA 1LFDB 4EJMA 2ATXA 3FCUB 4BFVA 3MB5A 4AY6A 4MA5A 4ZYWA 1G18A 4NCKA 1S8FA 3ORHA 4BLWA 3ZCPA 2Y1XA 1G20A 2BGMA 3D64A 4M37A 1VXRA 4HDKA 5I8PA 4R40A 4U9UA 3V8VA 5BURA 3IKJA 1ZUD1 1VOTA 3IMKA 4W9NA 5FPTA 3TRJA 5ES4B 5M29A 1BXRA 3ABQB 4BN4A 1HEYA 4E94A 1KH1A 1VJRA 3M5PA 2NO0A 4IV5A 4TL6A 4IIGA 3VHRA 4Q7EA 1W5AA 3MT9A 4Q1FA 4W5OA 3CTPA 4HR7A 2OCPA 1YCGA 1CUAA 4HS9A 4DUGA 1YT5A 4IDHA 5D00A 3PX3A 1X15A 3H5RA 3W8FA 3KJFA 1J2TA 3AZOA 2J31A 2VDMB 5GINE 1EK1A 1L3BA 3I3SR 3UK2A 1MG5A 3KTOA 4I14A 4KU4A 1EFVA 5BW8A 1D6SA 4OQFA 3T9BA 1Q0TA 5JHGB 2W48A 4YJ3F 1JHXA 4BBAA 2EJCA 1A82A 1RCFA 4TXNA 1MV8A 3H11B 3NNNA 3SS7X 1FRQA 2QTFA 1Z37A 2EF0A 3JATB 2GS9A 1RPNA 2JEYA 1I7SB 2AVNA 5EMKA 4H0CA 1R0YA 2GOYA 4IQ0A 1QLJA 2EQBA 1EK5A 4R84A 1D4OA 3TSYA 3IKMB 4X62B 4YMTA 4KR7A 2G08A 1G3MA 2CCGA 3I5XA 4BB5A 4QLBA 4TZ0A 5C8XA 1NDQA 1QDEA 3C1OA 5T6MA 1N5JA 3Q40A 4QUIA 3RSHA 3TVDA 4LZPA 1JG6A 2HMYB 3W9SA 1KOJA 2J3MA 1SBYA 1WKBA 4K1XA 1SKYB 4CQLA 1RKVA 2ZSIA 2WE8A 1TTHA 4TMXA 1V3QE 2X8JA 2IDKA 1VZ2A 1UBTS 3MB8A 4OLFA 1KDPA 4XWWA 3C6YA 4YRTA 1SG0A 1TYZA 3EGOA 1HMYA 2HHCA 3I9OA 5BUCA 2PKWA 4JI5B 4FMPA 3NBQA 5AKZA 3R1IA 5C1PA 4HWSA 3CX4A 3EXG2 3FA2A 4KKVA 4WKCA 2PPLA 3TE7A 4JXJA 5AOBA 4YUXA 1T9BA 4WK6A 3AHEA 3NNSA 3JAMA 4BZXA 1L7BA 1UFOA 3PJEA 1TYBE 3U81A 1Y82A 3BL6A 3CGWA 4RS4A 3P5BA 2YWRA 3R4CA 4ZCLA 4BVAA 4D9KA 4FB4A 4YQFA 1QCZA 3QKUA 2XMSA 5FPPA 2E82A 5IMBA 3IPXA 4GR4A 3CNEA 3E0XA 2BUAA 1WUJS 4MYCA 5JXHA 3TW8B 4E03A 2H65A 3ON5A 2PFGA 5BNZA 1BAPA 4XM1A 2PGNA 2VRWA 2H7CA 1Z5GA 5SZJA 3HE3A 3ROFA 2JANA 3HKBA 3Q2IA 3QUSA 4PSCA 5ITVA 4LF6B 1E20A 1F12A 1TUGA 4NV1A 4GAEA 4YCAA 5DLQC 1GTSA 4YCJA 2I3ZA 1DI0A 5CFOA 2IU6A 3R6WA 4F3CA 1ZNZA 3AVVA 3D3JA 5AXCA 3NALA 2XVXA 1QYXA 1ZISA 4EFMA 4BFLA 1VYTA 2WQZA 4BQEA 5LA6F 3GEGA 3T4XA 1UWLA 3ICCA 4I6EA 4F92B 4DBLC 4YCLA 4D1YA 2FDCA 4DMUB 4EG0A 2XTZA 5KQMA 2HEIA 1IZ8A 2CVOA 2ET6A 2H1LA 1R9MA 3CIFA 3N7TA 4TS1A 1XRPA 1P4SA 3TR6A 2FX2A 4XJXA 4Z0PA 5JNSA 2AHOA 2JEOA 3NUQA 3OLZA 3TQFA 2ODBA 2WU8A 3NVKI 3V7FA 2F3UA 2AH5A 1VECA 4RHUA 4E14A 1Z9BA 1DX6A 1U3WA 3G6KA 3MS7A 4G5XA 4TN1A 1SOWA 1PHPA 2VYND 3NTXA 1OXTA 3BJEA 2P9TA 3PJGA 4D3YA 2VAVA 4ZIRB 3UW1A 2BMWA 3WLAA 1W34A 4HUQB 2DFLA 1J70A 4WZAB 2J9YB 1GWNA 2JDID 2VNSA 1J2EA 2YHSA 4DIBA 2A9KA 2VQ3A 2NQ8A 2XT6A 2H07A 5JOQA 4XARA 3AY6A 1YZGA 3GRAA 3JQQA 3NBFA 2G1JA 1ZCJA 2XW6A 2L42A 5LLDA 2QYOA 4NQZA 5A0TA 3PA6A 3U0BA 1J8MF 3K9BA 5JWHA 2IVZA 2PXXA 3VNSA 2OO7A 2PS3A 1F2TA 2E89A 3DDOA 4N7MA 3L18A 2ZYIA 1R0RE 3NJRA 4MVJM 1G38A 4CIDA 4INPA 4ZEMA 3BZUA 1DPFA 2G1UA 3CEMA 3UKDA 4NATA 3CFHL 1B6GA 4X1IA 5CLIA 1DBPA 1RXUA 1CHNA 3KLPX 4BFUA 5LXTA 3E18A 1CEEA 3FCEA 2I6FA 1CZUA 1LV8A 3ENZA 5J5AA 4E2ZA 1JA0A 1EVKA 4EFLA 3TBHA 1Q21A 4P3XA 2PSEA 1RZUA 1JR2A 1YUNA 3BMNA 3URMA 2X22A 2WJ4A 4YMUA 2DT5A 3DDCA 3Q10A 4ZICA 5FH9A 1E0DA 2GRUA 1JQDA 3N2GB 1ADJA 3U4HA 1BVHA 3KZKA 3UJHA 3K0CC 1WQ1R 2ZIWB 4J8PA 1X9HA 4COKA 4DA7A 1EG7A 3F5DA 1WPQA 2A0KA 3JWIA 3ZNOA 4DMMA 5A3QA 3AYXB 5ALTA 5B2EA 1JLRA 3AWDA 5BR4A 1TF7A 4MMYB 5ARDA 3LVBA 5L95A 2OBBA 4ENTA 3GLHA 3WTCA 1KKMA 2G17A 3NTVA 3VA7A 2JAOA 4UHEA 2IHUA 3IDOA 3ZDQA 2AOVA 1U3FA 3AM3A 1F1JA 1WHTB 3UYLA 3IC5A 4MWEA 4MUNA 1B0UA 2CYBA 3NHPA 3EXHC 4JEHA 1XEFA 2QP4A 1JI0A 1V8DA 3DP7A 4DWOA 2Z3WA 3H5VA 4FN4A 1SU4A 2OG1A 1NXQA 4CETA 3F96A 3GCZA 1YO6A 3ND9A 1Z6GA 4ZVVA 1YULA 3DOOA 3P9IA 2BGLA 5JAUA 3WISA 4A6PA 2XODA 3EAGA 2E1PA 1NBHA 3G13A 4IHJF 3USCS 1U7WA 2VDLB 1MQ9A 2XCLA 3Q85A 1BOOA 1YJCA 4CLOA 3N9IA 1BCSB 2WBLC 5AJWA 2XNJA 4QUGA 4IDOA 3UV3A 3SQLA 4JGIA 1LW7A 3GY0A 3B78A 1FYWA 1TMYA 2JD0A 1NJ8A 3A1SA 3PQ4A 3FDJA 4J7CA 2Z83A 1YJ8A 1GTZA 1J97A 1QQ5A 3Q88A 4KR0A 4WEQA 3ZY2A 2M6LA 5C8DA 1Z2EA 3WGYA 1U2QA 2FPOA 3RFXA 4F3TA 4N8EA 2BP7B 3COSA 3E9RA 2YWFA 4HGYA 3OX1A 3LPCA 3C5VA 4D3DA 2XCQA 4D4HA 1JR4A 4D4KA 4DN6A 4RMHA 8ADHA 4EQZA 2HCBA 2VQEB 1UKVY 2YIVX 5CPFA 2GILA 2D2VA 2IW1A 4KMMA 3VDMA 1TJ4A 2QW0X 2Q46A 3TG2A 1RNLA 1MC1A 1JW9B 2CLLB 3KSRA 4GR5A 5I8ZA 3TCKA 1FXSA 5F5NA 5E95A 9MHTA 4V38A 3DV0A 1IE3A 1VLHA 2A1UB 2KBFA 3PC8A 3BEDA 2IRWA 4DV4B 3IMCA 2WAXA 3A8TA 4D99A 5JSUA 1Z2NX 4ZI2A 3QVSA 4K9DA 4EUSA 1LQ2A 1T9ZA 3I62A 4MVJH 3HB9A 3GT4A 4JXXA 1P9RA 3CZPA 4H7DA 2OHJA 4PINA 4WERA 5I7EA 1P6UA 1FVOA 2CWWA 2Y71A 3IA7A 4O1IA 2MWMA 4HVLA 3W5BA 2UYCA 3S2FA 3P9YA 4ADSG 5CDTA 1KR2A 5AKLA 1MN6A 2UYHA 2O8DB 1O87A 1OX4B 3KKMA 4OHBA 1T9DA 1MTZA 4BU1A 1SEVA 1Z5VA 4EB6A 2YIDA 1M74A 1Y4SA 1S01A 3ZU4A 2BRUA 4FR0A 1TM1E 1ZH0A 4ABTA 3AILA 2V58A 3EA0A 2AG8A 1JZQA 1AURA 2Q1SA 2R6AA 4NFHA 1CVLA 1WBBA 1U0OC 4OK3A 1AMOA 1G7RA 1X7GA 1Y1PA 2B3TA 4FCVA 5IJXA 2D1YA 3PCTA 1P3JA 3BXEA 4RPLA 3Q6NA 3V42A 1U3CA 1NUAA 2YJNA 2RB4A 3KQWA 3PFNA 2FMTA 1UM9B 1OI4A 3QVTA 3SXUB 1LPBB 1U7HA 3P2MA 4DIOA 4LJRA 2PZAA 2WILA 3HO8A 2XNDA 4NBUA 3ZVRA 3L05A 2WHYA 3EXEB 5CK5A 1W9HA 2IEYA 5CXXA 1U8CB 1VG9B 2MMCA 4I3GA 3TK1A 2ZE5A 1OILA 1U28A 1OPXA 2R1UA 1G8HA 1TQ6A 1Z62A 3KTDA 3PUXA 4DE5A 1R6VA 2FAXA 2YWEA 4WCDA 4Y2GA 2O54A 3ESDA 3ELBA 4F4CA 4K7JA 1A96A 1SZJG 4AO6A 1IB6A 1NX6A 1SU8A 4LZAA 1LX7A 5CIWA 5C8YB 3IE1A 5JRDS 4LF4B 1QF6A 1IY0A 3MWGA 2CVQA 4JJKA 2H8GA 2PGIA 1HFKA 4K9OA 2Z1MA 3PL1A 5DW0A 4DC9A 3OU6A 1Q0SA 5DXFA 4NYIR 3N2NA 3VC3A 2C7QA 2HPHA 5C0OE 3UXMA 2Z9CA 1IWOA 2BMDA 3ABIA 4ZYVA 4MWSA 1E3DA 1EK0A 2FF5A 1LPNA 2ZR7A 2B8WA 3EFBA 3VAAA 1XQXA 3GRUA 3AXSA 3ROMA 1XTZA 5CB4B 1C3XA 3G0GA 1K3TA 4ZK2A 1B2LA 2ON6A 4B3MB 3ZDXB 3GT3A 1MNAA 4WCFC 4AXXA 1H8HA 3QPWA 1KPIA 5LBIA 3E7FA 5H9WA 3S27A 2IOFA 1ADFA 2QZ9A 1P18A 1MDFA 3LG2A 4PFJA 1M3SA 4A16A 3FWHA 2P0AA 1SUPA 1IJKA 3PDIA 3FGPA 4KQ9A 4UJ5A 4ZDWA 4RORA 3RRJA 1U65A 5KYYA 3BZWA 2G06A 3DF9A 3WGTA 3T3IA 2AN5A 5C32A 2OGFA 2XUOA 3HEBA 1UDBA 3VUFA 5DHTA 2FMIA 1ZL0A 4ZQGA 1WCXA 2K4MA 3KOYA 4CQMD 4WXYB 1KJQA 3IIMA 2YINC 1FU8A 4NV3A 4BNZA 1YVPA 2FR8A 3HYLA 4CXMA 3E5HA 2VXBA 3K16A 1DS6A 4JQYA 1N57A 4OP2A 4BWGA 2ODQA 3CVWA 4Q82A 3KXDA 1P75A 2BELA 3O8DA 3VC1A 3CU5A 1VL1A 3ABOB 3WKBA 4OQEA 3D7KA 1N6HA 2CNLA 3EXEA 2PZ8A 2Q5IA 1FS6A 1EFKA 2X6QA 1A7UA 1LVHA 2QVXX 3F4BA 3QEOA 3KS9A 4CN8A 2DTXA 3R6TA 4EF5A 2XMRA 4DR1B 4GPZA 1ZK2A 2OL4A 5BVGA 3F47A 4II3A 2G9VA 4Q9AA 4FMCF 3OCWA 4WCFB 1OV4A 2RCYA 2QAIA 2XDQB 2JJ1D 1IEVA 5ER9A 3BXGA 5K4HA 1DC3A 3AL3A 3PU6A 4G1UC 3WKEA 2X19A 3RYFB 2VLBA 3DCJA 1MTOA 4LOAA 2A1TS 2GN4A 5CH3A 1PWZA 4G1FA 4TWJA 3KQPA 1DRWA 1QM5A 1VKHA 4NC9A 3E9DA 5EZ6B 1OX4A 4ARZA 3ISTA 4LXQA 3STUA 3K9NA 4C1BA 5BXQC 3V9AA 1PR4A 1YAHA 3UUEA 621PA 2PUGA 4P33A 2R8YA 4TSFD 3O9VA 2ORED 5FTKA 2Y1DA 3IQIX 3EXFA 4JMPA 5CRIA 4TLCA 3TQQA 4X63A 4H7IA 4PR3A 4L1KA 4D96A 2C4NA 2MCFA 4QT4A 4GZMA 1U1CA 2O8FB 3CYFA 4WA8A 2FPUA 3LL7A 2LNDA 1T3GA 2FPKA 2XVAA 3FDXA 4ALNA 2XIJA 2Q3EA 4A73A 1H2YA 2HNAA 3TX6A 1BXKA 3IV7A 4YAKA 2DMRA 5AVQA 1ZR2A 1P1KA 1JG7A 2VUUA 2C5BA 3DQZA 4M8KA 5JD3A 4MUIA 3A10A 4BQNA 1Y80A 2VPPA 3TSCA 5JH7A 1GZ4A 1M10A 3EAQA 2GTPA 4X85A 3LQ1A 4EF6A 2BTQB 2JGDA 3WGNA 1WEKA 3JQFC 3X1MA 5COQA 4KE7A 4OHXA 2B30A 2WAMA 1PK7A 3NC1C 4AJ2A 5HFNA 4YV0A 2APJA 5LLTA 4UU0A 2PLWA 1YR8A 1KZYC 3BWBA 2AN9A 3IP1A 3DDUA 4BGUA 1P8JA 4QC2A 4E5MA 2QPTA 4EGCB 2VSFA 5JNTA 2WDZA 1JHZA 1QHNA 1JQJC 1U9YA 3AVPA 4MKGA 4YALA 2X8AA 4KVAA 1RW4A 4TWBA 3AJEA 3GXBA 1JKJA 2J0UB 5K09A 3AEUA 1NY6A 2OEPA 3MJTA 1CE8A 1K0FA 4D6XA 3I76A 5CFMA 4U02A 5J1TB 2XGMA 4DLUA 1A7JA 3L6OO 2FV8A 1DAFA 4WZBB 1D6JA 1ENZA 3M2TA 4KXWA 1HNWB 1FCJA 1RE0A 4FKMA 3DEYX 2AB0A 4IH4A 4N0EA 1PTJC 2DQKA 3JYHA 3EZYA 4UFNA 3VKGA 1UBUS 1P1HA 3RW9A 1M5UA 3HWRA 3M89A 5K0FA 1VCOA 3GQBB 3TTTA 1KE1A 3MTGA 4G97A 3V3KA 1LSJA 3AM5A 2H2DA 2O9JA 4FGWA 3ZHZA 1P0CA 1YB6A 4ES6A 2EFYA 1EA5A 1QRDA 1PGOA 1HYHA 2OV1A 3HUFA 3AKDA 4INJA 4QWWA 3WBKA 5CDUA 5DULA 2ZKLA 3BA6A 5JG7A 4KXMA 2CEAA 3ZTYA 2V4UA 1X3SA 4KKXB 1JAYA 4NG5A 3KE8A 2JGAA 5DDIP 3WQRA 3HU1A 4DQKA 4UTPA 5AVTA 1E9EA 3JASA 1B8VA 3H7IA 4R0NA 3VNVA 2QAGC 1A27A 1XWWA 4YRQA 2C1ZA 4CDMA 4LF5B 3VXKA 4IR7A 3C3JA 2QN3A 4R2XA 1U0LA 4MLZA 5E3JA 2C7VA 4IXNA 1YI1A 4P54A 1C9NA 3DE7X 5EIFA 2O0MA 4YPFA 1FDOA 5LD2B 4LFBB 5AXDA 2CF6A 6REQA 1LDBA 4K86A 3S81A 1SHKA 1WXIA 1Z38A 5KYNA 3QE4A 5JU6A 2PYIA 4ZO4A 5DW3A 2V4MA 2P9BA 4BP8A 5B5SA 4KAFA 4DVGA 1RD4A 1WMBA 2GHIA 1Y9EA 1AN9A 1SUDA 1IN8A 2JJMA 1JBQA 1KO5A 3ILSA 5TV2A 1M7BA 4Q9HA 2FW9A 2O6HA 4P4NA 1N0HA 1TKAA 1J9EA 3KUDA 4K9KA 4YUZA 1HG1A 1P1BA 1FSSA 1NLYA 2VYNA 4LGYA 4IW3B 1C0KA 3TMKA 4EY7A 2H08A 1JDTA 4OYLA 1PU2A 4TV8F 2ZJ4A 2PRJA 3KQSA 3JQAA 4J03A 4XGNA 3OU2A 4D02A 3H9EO 1NDHA 3V1TC 3VZDA 4O08A 2D7JA 2QEQA 5IH7A 4RXTA 4K6KA 1P74A 2QZJA 4P36A 4YAGA 1ZRSA 2IHTA 3ETLA 3C74A 2Q4DA 1ZMTA 3ESZA 5K3DA 1W8IA 4IM7A 5FTMA 2JCBA 4CM9D 3E22A 3DS8A 2NZXA 1GTVA 2PO5A 1ZD8A 2BV3A 3FTNA 1K6IA 1OHHD 2SCUB 2P1ZA 3G7SA 4HUQA 4EHIA 2ZKIA 4UTZA 2ZJFA 3HM2A 1F6WA 2QTVB 2NU7A 1E79A 1CNMA 4FEEA 3GYGA 4IS2A 4NENA 5LA6A 4YRMA 5KCZA 1HDIA 1IOVA 3BORA 3FBTA 4NAHA 5DLDA 4XB6B 3RG2A 2CFRA 3PWZA 4ZCSA 4J43A 4ZAGA 5FUBA 4MR8B 4ZI7F 2YXPX 4P4TA 1B2RA 1KS9A 3MT7A 2FN4A 3ZDDA 2FQQA 2HN9A 5KNDD 2PANA 3KXKA 3G9ZA 1AQUA 1G5FA 2WHPA 1LLCA 3A6DA 2ZSUA 1B6RA 4DDTA 1ZC4A 2EZUA 3FROA 4A03A 4AW9A 2AR0A 5TGDA 3U4AA 5K8VA 5EJFA 4EARA 1HLDA 1E5VA 4IIDA 1UM8A 5TRTA 3BE6A 2WUFA 4M0EA 1YIAA 2BCJQ 3H0CA 5AYVA 3AZPA 4BEWA 3S3TA 3HEAA 4ZGBA 5E7JA 3QX9A 4BAGA 3SG0A 3S2SA 3UJ3X 3MTEA 1MB2A 1HT2E 1EFHA 2DFKB 3UY4A 1NBIA 1NASA 1QO0A 3A6EA 1T3ZA 3LYLA 3WP0A 4CUJA 3CSDA 4M86A 4XQGA 4N48A 3IUSA 4PFSA 3ZWBA 3ZY5A 4U3JA 3FTDA 1U31A 1V4BA 4OA5A 2GMWA 5DV9A 4N3NA 5TJHA 1GAJA 3OICA 2J3QA 1GCIA 1ADBA 3DE4X 3HV0A 5DP1A 3S70A 3SP1A 3I72A 3HKBB 2EOAA 4EJSB 5ABPA 4YRDA 1G9TA 2A5GA 2CDNA 1VPTA 2O2YA 2XUFA 1KVUA 2MINA 3K5WA 4LJ8A 1P5JA 5SY4A 3KPJA 1MOPA 5IK2A 4BNKA 1CUGA 4G5YA 1TDJA 4MICA 4BNWA 5EHQA 1D9XA 3K1JA 3KR0A 3PXUA 2HRDA 5IJWA 4TN5A 4GRAA 4MVJD 4BRZA 5CT4A 5M34A 1VIAA 4UBMA 1WZCA 1PL0A 2RC5A 5KVCA 3VVMA 5CLFA 1DCFA 2VYVD 4RF3A 2VT7A 1O9GA 2RH4A 2XA2A 4DCUA 4N39A 1PJSA 4FMDB 2J8ZA 2ZT6A 5KMGA 4HF7A 3BD6A 5J2UF 1D4FA 1QH1B 3KVOA 3K6KA 4O1MA 4OYYA 4H35A 1NX9A 1IVNA 10MHA 3AESA 3DL4A 5E38A 4JAVC 1UOEA 2FW7A 1AF7A 2EJTA 2GM9A 1ML4A 3IE2A 5E7IA 1IIBA 5FORA 1MD9A 3DKRA 1E66A 3NGMA 1USVA 3Q4GA 4LYYA 2CFOA 3KU1A 1DAOA 5FA5A 4FC6A 4B6PA 3KQMA 4B3FX 4GFDA 3FNRA 4X93A 1RKUA 3ORFA 2QLBA 2AUMA 3DZIA 2ZT5A 3LOPA 4KW7A 4TWZA 5TC4A 5FJJA 4XYMA 4S05A 5TMBA 2XCUA 3LV8A 1HFWA 1Y9JA 3PEYA 4LGCA 4L0DA 1EDEA 4LAFA 3NATA 2FFAA 3RS3A 4M1YA 4FWBA 1I5RA 1MC8A 1Z2AA 4AN0A 2TS1A 3ZK8A 2RAUA 3G7NA 5BSMA 3TPCA 2E6KA 1YL7A 3GFOA 1MOZA 1NFRA 4M6WA 5FP0A 3OFSA 3PJRA 4PNEA 1GEGA 3H2GA 1KMIY 2J48A 4NCJA 1BDHA 4DXDA 3SCZA 3D4IA 3BEOA 1AXRA 2BWJA 4RXMA 1JPJA 2QMEA 1UBRS 3F7MA 1J0CA 4PYMA 2EP8A 1MABA 3OE4A 5B64A 5M2QA 1RU3A 3STXA 2VG8A 2GSDA 2PQ6A 1RHUA 1H2BA 1X3LA 5H8WA 2W6ZA 1NQWA 1XDUA 1YB1A 5D6NA 4K6OA 4AF6A 3R41A 4BPBA 1BXRB 4KH1A 1AGNA 4BKMA 1G5IA 1XR3A 2VF2A 1GR0A 2FWPA 2EFJA 3VPDA 5FLXA 3PWKA 2Z56A 5AVOA 2IWHA 5D7BA 2AX4A 4CV2A 4R8VA 2P9FA 2C0PA 2FOXA 4WRRA 1Z28A 1Z4MA 3ZI7A 1ZOLA 3H18A 5FNVF 3A06A 3QQ5A 1KAHA 3PR2B 1NVTA 2CMHA 5AJVB 1IHUA 3O90A 5DI3A 2M6KA 2IYAA 1KJZA 4LRYA 4HDCA 1LVUA 2NYUA 3KRTA 3VSCA 3N86A 5JALA 2NU7B 3HXLA 5COBA 3TQCA 2VDWB 4KX5A 2Y66A 1DIBA 1H2XA 1JLHA 2B9EA 4TWIA 2Z6UA 4ARVA 1IMJA 3HL4A 3TLMA 2ARKA 4RDIA 4RV4A 3LC1O 1XPJA 1GNVA 4EW2A 2BZ1A 4RFLA 1VRVA 2JHAA 2QHXA 4UBIA 2PNJA 3UGTA 1D2EA 1ZGAA 4Q3OA 4FINA 1M1YB 2P7HA 5H0IA 2WMDA 4OIFA 3WGQA 1C29B 2BUBA 3TRIA 5IJZA 1A5BB 4PX3A 2BZSA 4YI5A 2I8LA 3DGEC 2O3SA 1ICIA 2XYRA 4PS0A 1P33A 4M49A 2UXBB 5HGJA 1Z2DA 2X42A 4FDTA 4YP7A 5CIYA 5HF9A 4EEXA 2VIIA 4KOAA 4AMZA 2JH3A 1VIVA 1RIFA 3B89A 3OURA 1E60A 4BMZA 1IM8A 4PG7A 3VSEA 2IUYA 2XTNA 2POQX 3SXJA 1CUEA 1F6BA 1PJ3A 4O8ZA 1PL6A 3VI4B 4RTRA 4A15A 4L5BA 3NDBB 4PHFA 2XKKA 2CMDA 2H4ZA 4KODA 1GL6A 2INGX 1LLUA 3ANTA 1KI3A 3I0MA 3L40A 3UCFA 4EMSA 3FW1A 5LQUA 5M04A 4FMBB 1P4GA 1JN0A 5AHKA 1H93A 1RAHA 5GPBA 2CDBA 1FXUA 1C30B 2QQ5A 4FGZA 5M7EA 5DPMA 3EXAA 3NEYA 4YAFA 3IPAA 2IS4A 4B6RA 3TFQA 2ZULA 3VAYA 1AZLA 2ZWAA 4RPIA 4Z49A 2IIPA 3K70D 3SI7A 3D59A 4ZC8A 5BWNA 1FFDA 5BSRA 2CLHB 5MFPA 4TVSA 2J41A 1IIRA 3I12A 4UOZA 2BM1A 3DVAB 1QFXA 1NOKA 2P1RA 2B9VA 1U6JA 1PVVA 1SU6A 3B7PA 3E9EA 4FQ5A 2ZBQA 4TQGA 1HNNA 3HEMA 2KMLA 2LIPA 4RELA 4EHKA 2NQ2C 1SK8A 2OV2A 2BKUA 2VSXA 2Z8YM 3QOWA 2EZTA 3DWEX 4FI3C 3ZV6A 4B3XA 2JFFA 2RONA 5FIUA 1UZLA 4PGHA 4D6PA 3TG8A 5G1NA 4E5VA 4DR5B 4LX0A 3B3JA 1QP7A 4PXYA 2IHNA 3GQBA 1YVRA 4H9GA 4CIAA 2JJ2A 1HKHA 3QFCA 5FUVA 4YUAA 3JVEA 4MMZB 1C9JA 2JGLA 4QYSA 1ILEA 1MZPA 3EDRA 3MPUA 3ORRA 5AW0A 5LMUB 5T4EA 2L69A 2QD3A 1A2BA 4JELA 5FBKA 1ISRA 2QZSA 3U37A 3IYLW 4ND3A 5FWYB 4BC0A 3PL5A 4LE2A 3DMRA 2HJHA 4F11A 1JKJB 2J0UA 3C6ZA 3DZBA 3F6SA 3LH5A 1C80A 4QJ4A 1OFIA 2I8CA 1XN4A 2ODPA 5D84A 1TIPA 1AUXA 3K73O 3UHAA 1UMCA 3E8MA 2C8LA 1HSOA 3QX7A 1ZL2A 2G36A 3UANA 4BIIA 2WTBA 3VGJA 2C3YA 4EECA 1RWOA 2QPLA 1BMFD 2C5EA 1NSYA 3FPJA 3KPYA 1E1CA 1QS0B 4IWYA 221PA 1RQ2A 4OFZA 1F20A 2CCJA 3K2QA 4PXAA 4MPTA 1TE2A 1XE3A 3RVJA 3VOSA 3A4VA 5AOCA 5GP1A 5B7NA 5JH7B 2X15A 3PNSA 4I8IA 3EZ2A 3KPVA 3AUSA 5IJAA 1P39A 1C9YA 1G2IA 1X9IA 3DVLA 4Q34A 3HCBA 5KWSA 1EG2A 3M9WA 1J7JA 1DFHA 1TL7C 4S24A 3GLIE 3N2IA 5I7VA 2ZXUA 1CP3A 5KNBH 1F5NA 5DBEX 1HYGA 5FA6A 4XVCA 2BGUA 3AHFA 4LECA 5KC8A 1SXJE 4IJ6A 4MQBA 5KBYA 3U61B 1HE2A 4TT8A 1SXJA 3F1LA 2ZCUA 1CUJA 5LQKA 2WM8A 2XZTA 4I1RA 5K6AA 5DJ5A 5HCIA 1IOLA 1B3BA 1O5IA 3S40A 3V48A 5U9CA 2EKZA 5KPDA 3U6KA 4KJZA 4AY3A 4DJJA 1P1JA 4HTFB 1JG1A 1L5HB 4I1OA 3U48A 2ZJ7A 2QMHA 4KBGA 1P6XA 4L02A 1JR3E 3HG7A 3TSZA 4A0HA 4ARZB 4X90A 3HNPA 4P1ZA 4GQAA 4U2GA 3H2HA 3SQNA 3O1LA 2Q4EA 4YJDA 1ND5A 3CA8A 4G86A 5EMJA 5ALMA 3QX3A 2ZCVA 1UOOA 2HRCA 1SC1A 2Y92A 5JSYA 3W1EA 4BVFA 5JAIA 1N2EA 1LI7A 1A0OA 4Q16A 5K3CA 3W79A 1ILWA 4RKYA 3DO8A 1V5GA 2GN2A 4L6AA 3JQ7B 1QF7A 1YBHA 3E3MA 4UDOA 1ZU4A 2XDQA 1RC8A 1PLKA 2Q0HA 1U5AA 2YYZA 1KBZA 4JXZA 1PR6A 4PYIA 5JC1A 2CL6X 1EQ2A 1JEQA 5EIAA 2OORC 1R16A 3D6MA 3NDRA 3QWIA 2IU0A 1GFWA 1GKLA 1K8RA 2XMCA 4PCUA 2C9MA 4QOFA 1M5RA 3TLBA 3F2IA 2G5PA 3Q3CA 1C0PA 1RKBA 3G6WA 3H5WA 4OI2A 2OVFA 3N1UA 2ZRDA 3H6GA 5J2TB 2CD7A 5L45A 1LPAB 2G0AA 4R2LA 4C4XA 4L73A 2XKBA 1KQGA 1RSZA 1ODFA 1VIMA 3N6RA 2H16A 4J2OA 2BTEA 1HGXA 1VG8A 4FNMA 1RKQA 3O4HA 3HU5A 4CM4A 4MIOA 4DIKA 4RTMA 1QORA 1QRTA 3HTXA 4HY3A 4YRCA 2UZ3A 1RLUA 3GEBA 3HKDB 3NEPX 3O2NA 4HH4A 4MGEA 4UDYX 4DC0A 3TR0A 2W2NA 3GELA 2NVOA 4IEFB 3K30A 1QE0A 2BGIA 3HZZA 1E9FA 3BIOA 3ET4A 3OSZA 4X8LA 3RVOA 3ER9A 1W0CA 2DFDA 3EOAI 2IWRA 1L7OA 1LSUA 3KBOA 1GNLA 1VPWA 1CERA 4OD0A 2GJSA 4QODA 4I19A 1JVSA 4J2TA 4R3UC 4WJLA 1N78A 4LN1A 1Q1BA 2G8LA 5CLQA 3FNEA 5EKXA 1Y4AE 4E5UA 1A8SA 3ZBUA 3AF6A 1D04A 1VMEA 3P9CA 4U6SA 1Y3DE 1XK6A 2GN6A 3RFUA 4ZAZA 3GA5A 1YV9A 1EE9A 1XRNA 4P5DA 4R8MA 4XTRA 3B6MA 5CYFA 1P2FA 5HXAA 3BK7A 1U8YA 2QRVA 3H8SA 4G25A 4H15A 3TUIC 4JI0B 4PAQA 4C76A 1VDMA 1J56A 3KTFA 4IXMA 2XOKA 4XCQA 4D8VA 3WLFA 3INGA 4Z53A 3Q2OA 4I50A 4BNTA 2FPLA 1PZFA 3E5MA 3IGFA 4TLAA 5C8YA 2P30A 3U4DA 3NWOA 4BFCA 1EVYA 3DBRB 3EPHA 1DJNA 2CUTA 1LUAA 1AU9A 2V9CA 4GPEA 2SKEA 4K6CA 1A9TA 1T43A 3A7EA 3K96A 3I3OA 1I3MA 3DDNA 2BEUA 2P9GA 2X14A 1V4NA 2J6CA 1UZAA 3AHGA 4R16A 4DLAA 3RREA 4EBBA 2NO4A 5H4GA 3H1FA 2FPMA 5T57A 1D7AA 5TDHA 4PU0A 2EG9A 4S3MA 3A0UA 1EFDN 1RZ3A 1X1SA 2NXCA 2XXBA 2IS6A 1VHWA 3NRBA 2RHOA 1KPHA 3CPSA 2PGOA 2B8EA 3AR8A 1VGVA 3R9XB 1Z6QA 2G3YA 1EBFA 1MG0A 2FWIA 4MCJA 2QRLA 5J59A 1G59A 4YJKA 3F73A 4ENPA 2G5TA 7ADHA 1T25A 4P3NA 3WHKA 4EKEA 5J2TA 1KAOA 4Z4IA 2DBVO 4OXNA 1C1XB 4UQOA 3ZKAA 2WWVD 1ST2A 4YRIA 1P5ZB 4TRMA 2C0CA 3ANYB 3WOHA 1HURA 2QW1A 1ECFA 1LQUA 3HB7A 2OBNA 2VNIA 1FJGB 1G9SA 1SQGA 3E1GA 4NBLA 4A8JB 5LMNB 1T9GR 4KV7A 2CKDA 3ICOA 1RI2A 3VH2A 4Z7QB 1G5TA 3P4UA 3AH8A 4UCXA 1KGSA 9ATCA 1DRJA 5JAHA 3E3AA 3IFSA 1WBJB 4PLPA 3OZWA 4W5RA 1CRQA 1S5PA 3HSKA 1B14A 3JARB 3QLUC 4MGHA 5GVSA 4B32A 1JRLA 5FEMA 2IEGA 2ANBA 1Y5LA 3GH3A 5B4UA 1S7GA 2GXUA 1U7UA 4KXYA 3C3PA 4U7FA 3NHZA 5SV2A 2HO4A 5EIHA 3B6EA 3BYZA 4R1TA 3DM9B 1SKYE 1YE8A 3MUNA 3M7IA 3PQEA 4WBNA 3HXKA 3H2SA 3JQAD 1XPOA 2C4VA 4OGFA 1X70A 3QA9A 2WNSA 4W5JA 1T9GS 4C3ZA 2H5IA 2AV6A 5IC5A 4HBGA 5IHXA 1RTTA 3V8RA 4HN4B 5BV0A 5HVNA 4IMPA 5K1ZA 1VSBA 3V4PB 2XNHA 3W2EA 4RS3A 2FFRA 2H06A 2QYTA 2RHJA 5KHOC 5JNWA 1RYMA 2OBMA 3PVZA 3ITEA 1GXSA 3A31A 4R6XA 5B53A 1LC3A 2Q5FA 1YQEA 2QR3A 1PR9A 1L3IA 2DY1A 1ZKMA 1E2JA 4Q1CA 1L1RA 1SCUB 1NNUA 5F73A 1RJFA 1YI8A 4XJTA 4XYGA 2GEKA 4KXUA 1BCSA 2V7QA 1MX3A 5K05A 4PAOA 5LDGA 1FFYA 1GLNA 1YVEI 3PEFA 3K5PA 4OMDA 1VA5A 4PAMA 1PQYA 4IRMA 4YCSA 3QFHA 4BNGA 1KFJB 4ZVMA 3THWB 3ZVLA 3BWCA 2ZRPA 1JTFA 5ICEA 2WJIA 4GQIA 1KEWA 1HC7A 1A5AB 4GRIA 3G2MA 3K9CA 5CP8A 3V8QA 4XH9B 2ORYA 1L5GB 5LDHA 1Y3BE 1CSEE 4RVCA 4ZI5A 4Q3BA 1GN8A 1C8KA 2I1WA 4ACAA 3MYYA 4RKQA 2A0FA 3WGHA 5K9ZA 2YQ4A 1DGQA 4RIFA 3NRJA 3THXA 1R9GA 2PCLA 3D1VA 2DTEA 4LY9A 1GA6A 4J7UA 4HQNA 4LBWA 5DGDA 1UXOA 3OOHA 2ZRCA 3FETA 3OZFA 4GP9A 3RDPA 4DLYA 1L8AA 3H0KA 3NWPA 5FWYA 2E4AA 4L74A 4RPGA 1BHO1 4IXJA 1QWSA 2WVJA 1AQYA 3JPYA 5ALPA 1FSPA 3CI0I 1XIVA 2OMKA 4P98A 5DHUA 5HSGA 4G0MA 1X8JA 4YAJA 1A4XA 4KQEA 4MCHA 5K01A 1T13A 3F2VA 3RGWS 1T8TA 2YYSA 3NC4A 1EAYA 4KWHA 5JI3E 5HMLA 1DKLA 2VA9A 4QQRA 4NY1A 2QU8A 4BV8A 3A04A 4MP6A 1PFYA 5IVKA 4U0KA 4L95C 5L8VA 4BKPA 4FHFA 2BKAA 4R1LA 4JC0A 3O2SB 4I9UA 5GONB 1T4BA 2WAYA 4NULA 5J2UA 2VNHA 4M1QA 4POOA 1N92A 3BSWA 3GJ5A 4ODIA 4KSCA 1JHUA 4NXMB 5KTSA 3HCAA 3U19A 5F7JA 4V0LA 4J1QA 3IR6A 4KNVA 4IDFA 1T8UA 2Y1EA 3AQ4A 1YFZA 3GFBA 1EWTA 5LLSA 5HUHA 3UMYA 1LY1A 1EVLA 2O3JA 1J8QA 3A9UA 3H42B 1FNCA 1N5LA 3R6LA 4HTAA 3LBYA 5KI6A 3MHTA 1E96A 4OMUA 2RJOA 3KOZA 1U8UA 2UZ0A 4PSAA 3EJ6A 1I14A 5CCDA 3ZI0A 1YQQA 1GYRA 2GX6A 4X1IB 3QA3E 1L5NA 1U7PA 1XZPA 4BDTA 1DEOA 3OH8A 3IODA 1MENA 3UWPA 1CQIA 3OQBA 3FNBA 3LRPA 3RD5A 4O3FA 4Q4JB 2PO7A 2EFEB 1NHGA 4QO8A 4NCIA 2JCVA 2CFIA 4HPXB 4ISBA 4PZZA 1USWA 5G41A 1B4DA 4OAPA 4K3VA 4ZC1A 2QJRA 3NYQA 3WWPA 2H1RA 1R0SA 4DLZA 1Z45A 1B8OA 1SVWA 2FI1A 4Y7CA 4HNAB 5HF5A 3WYAA 4H7FA 5TQ0A 3AIKA 1BKSB 1V9LA 3GLHE 1KERA 1SVLA 1X13A 3BSFA 4C0XA 3DDSA 5CA0F 3U5TA 2QG4A 2Z6QA 4PIPA 1WCV1 1U3GA 4LPSA 4QNRA 2A52A 3R7AA 3DEZA 2QV7A 4E15A 1VZ3A 3UA0A 5FPKA 1E1QA 2OZEA 3BH0A 4YREA 1YFJA 4PSKA 5I7HA 1EFTA 5HX7A 2ZRBA 4G8CA 3WO1A 4F2WA 2Z4TA 3O8QA 2OE2A 2AR7A 2PFSA 4HGZA 3A1TA 1VM6A 3UMMA 5FL3A 4CIWA 1KP3A 2ZTSA 3QE2A 3EULA 3OQPA 3NAQA 2HJWA 4E5NA 1OYWA 5CM8B 3W8EA 1NT4A 4URXR 4WIAA 2P40A 4E5DA 4FYYA 1YB4A 4BHRA 2GRAA 4E88A 3UWSA 3LZ6A 2VDKB 4PE5B 4R0VA 4OJNA 4BB0A 4XSVA 3PXBA 1TCVA 7GPBA 4XGRA 3OSUA 2A0XA 4XTCS 1X19A 2R3SA 3IT1A 3AQIA 4K6FA 4QPNA 2FZVA 1OWNA 4OFXA 4TTAA 2WKPA 5HKKA 5HRAA 1ADCA 3BDVA 4BB9A 4CRWB 2I03A 3NHYA 4E22A 3U7HB 3LHIA 1G5PA 1YZLA 3AR9A 4KAJA 2SKDA 2YFHA 1CJVC 4R1MA 1ESMA 1PN3A 3SFTA 2YFYA 4DV2B 5D8DA 3WSVA 3BMQB 4QXRA 2J30A 3OIVA 2XB9A 3L4EA 1KSGA 3S5UA 3SBOA 2E0IA 3ROZA 4F4JA 4M7RA 1EJ2A 1W5FA 2JF0A 1O6ZA 1VE1A 3PJDA 4KNYA 2EWWA 1E89A 3MLAA 4BS9A 5LM3A 2ZJ8A 1DBQA 3HMQA 4WLEA 5HE9A 3X1ZA 4XQ9A 2CV1A 2R8PA 2X9GA 1X7YB 4OXRA 3Q0TA 2B94A 5LUBA 1AKWA 5E4FA 2V5AA 3T5TA 2VWGA 2QM0A 3THSA 2RGXA 3S29A 2BISA 3O93A 1GP2A 1SUEA 2OB2A 4WGFA 1L7XA 4MCAA 2WU4A 1M5TA 1TB4A 3M4NA 4KPUB 4OHKA 2IYRA 5LP6C 1FA9A 3LBNA 4C43A 3GRYA 1RHJA 1JHAA 3LK6A 4HT3B 3KVYA 4M9RA 1H2HA 3OCUA 4JUAA 4C3VA 4RVSA 2H7YA 2YWXA 4NF2A 2YWDA 3SZUA 4GMDA 3VR2A 4CI0B 2A9OA 4X6XA 1W35A 5CB6A 3HZHA 2PUBA 1SUFA 4A2WA 1GT6A 1ZK4A 2P4HX 3IEXA 4MO2A 4YAIA 4EO4A 3EG5A 1JXMA 2XBUA 5K3SA 3PFHA 1AS3A 3WAGA 2I33A 5DLEA 4F6RB 2BGKA 4Z54A 4I8DA 1YK1A 1PUXA 1IN6A 4NCBA 1CVRA 2R6JA 1SOUA 1GUFA 4YRRA 1VSUA 5HM6A 4FM9A 1JEYA 1ZI9A 1PZGA 4C30A 1C3VA 2H4HA 3GVCA 3L6DA 4MGKR 3Q12A 4WOPA 3BWEA 1E1QD 2FLKA 5C34B 2BFMA 3RSLA 1NBOA 3B3AA 4B2LA 1QFJA 1N25A 4RJKA 4D82A 4X1KB 1UPFA 3HACA 1V8OA 3RV4A 4HGPA 4J0JA 3CR8A 1BTOA 1DX4A 1GQSA 2BFWA 2NO5A 4S0ZA 4JI3B 4TTRA 4EJSA 4JNCA 1EPUA 3DE5X 2Z8ZA 5FO0A 1KHTA 4HX2A 5E2IA 1TZBA 4M3NA 4YCNA 4JI4B 4X71A 2ZYTX 3CZRA 2R79A 4YWHA 4DV5B 1KI4A 4HV4A 2DYKA 3AGPA 1R3DA 3R7NA 4DUYB 3N05A 2Y9MB 2BGTA 4AQYB 1XTSA 2KLHA 5ALLA 2FP4A 3KL4A 3GJXC 3TO5A 3AHHA 4V03A 4CMBA 2YUTA 3P27A 1O5OA 4DLBA 4L51A 4GI7A 1M66A 4XQEA 2XITA 2JGMA 1U2EA 3AFMA 4MQLA 1DT5A 3WMEA 4URWR 5FO1A 1G6HA 2Q2NA 1J8FA 2R1VB 3D1JA 3JAKA 3KTAB 1XDGA 2HLDA 3EFOB 3R3JA 2OYRA 3WL4A 5I7AA 3O8QB 1TA4A 4KE8A 1PJAA 3C3MA 1QE5A 4KMSA 4ZJUA 2I7TA 2HSEA 4BMSA 3G2HA 2A88A 2Q1UA 2CHQA 4GR9A 1ZR4A 5F2KA 1IFXA 2ZVQX 3OCCA 4YUYA 5AUNB 1N2SA 1PE0A 3M6IA 3LP8A 1RM3A 4YCCA 3SE7A 4M0KA 4QYXA 1KETA 1PLLA 3EMVA 3UAXA 5ICFA 1YU9A 3PD1A 4MB2A 3D6AA 3IJ5A 3FSGA 1UJ2A 4URYR 3CFIA 4GOKA 3RVPA 3SKVA 2CSXA 3RFCA 3SF8B 1ZZEA 2DFVA 3DA8A 2OBXA 2AI2A 1KK3A 4BMVA 2LBPA 4EPVA 1DTWA 1TFRA 2W2VA 4MR7A 1FW8A 1UP4A 4F71A 4UD2A 4EITA 2YZKA 3OQIB 4EO9A 4JUBA 5AESA 1JEJA 3QMMA 4AY2A 3BXPA 3HFJA 1K7SN 3FVQA 3ZC3A 3ZIAA 2G67A 1TCBA 2W6CX 2BMJA 4B3JA 4C7KA 2I2XB 1CQIB 1TO2E 2HGZA 1ZH6A 4IIJB 5AKHA 4A4DA 4CDGA 1T4CA 1RAEA 3T99A 4BKQA 4RTQA 4IV8A 2FQXA 3L49A 1T2AA 2IUSA 4PS1A 4AULA 1RXIA 5CGQB 3AY0A 1Y37A 4KGVA 2WB2A 4JX8A 4JLDA 3QEMB 1JIJA 3EPLA 1ZGBA 3ZD6A 3SYMA 2GF9A 2R48A 4B45A 1UFKA 2O07A 5FBRB 3U3MA 3MTBA 2RHBA 4I1SA 1NIJA 2C83A 5EHGA 1MQSA 1FDIA 2VOEA 3BX1A 3FLBA 4ESOA 1NJ6A 2M6RA 3FMGA 3WIOA 1K86A 5J47A 4YVFA 4RETA 1FZQA 1OGYA 2R7NA 1ZSNA 4HAWA 3DPSA 5GMOA 1HDZA 1RYYA 3P0JA 5A1JA 3Q7TA 1Q1AA 4OYRA 1XZDA 4YT2A 1G7TA 1JSCA 1NRXA 1TEXA 1W46A 3JASB 4GUDA 2FB9A 1CLEA 3VR4H 1USIA 2BBOA 2ZUUA 2WYWA 4BMYA 3GZ4A 3FYCA 2W22A 3E4CA 3W5UA 4FE3A 4FGLA 2F8MA 3LJKA 2A84A 3RYIB 4BJ1A 1PZNA 4Q93A 2EW1A 4US2R 2Z5LA 3SM9A 1SJ9A 4BGVA 3HBMA 2A9QA 3ONWA 2MSCB 4PQFA 4B46A 4BZPA 3A6KA 4NESA 2X0EA 4MKFA 4EHAA 4GBJA 4DM4A 1N75A 2SECE 2V97A 3PSAA 3THXB 1H8HD 4US0R 1VHQA 4R0MA 2AN1A 1F0KA 3C3XA 3ZZ1A 1CB0A 4G0VA 5CMLA 2FPPB 1K7YA 5IUJC 5DVZA 1GT91 5DGTA 1XTRA 4OJQA 1CE8B 1T8WA 3PHBE 3F5MA 1CIVA 1WMFA 3VPGA 3THWA 4HP8A 3TMYA 4YRKA 3CBGA 1OT3A 4M60A 4KMOA 2WB4A 4GBGA 1LWOA 3JVDA 3NHRA 4D79A 3G85A 5FI1B 4S04A 2D0PB 3QXCA 5EG5A 4FFBA 1IY9A 4FOOA 3QVXA 1UBSB 2QB5A 4UCWA 1FSZA 3G5AA 4B2YA 2IP4A 1ZCBA 4K8RB 1GXSB 4QXMA 1WDTA 3VFDA 1S2GA 2NUTA 2XECA 3HPRA 1HL7A 5KJFA 4KB5A 4UHDA 5F35A 3H8VA 1CRZA 1YI0A 3OQNA 4GNRA 2HUPA 5ALOA 3MT8A 4B3CA 4DILA 1O57A 3TM5A 1SIBE 1ZQ9A 5ESRA 1SXQA 1O0BA 3OKPA 3NHMA 4JDPA 2XVZA 2BDUA 1LK5A 3S2ZA 1E58A 3QPDA 4NZZA 1PFUA 4BMOB 3WRVA 5A5GA 2NO1A 2C4TA 2ZI4A 3PI7A 1G8YA 2FZLA 3L92A 1JQEA 1I2MA 2FVYA 1E92A 1I8TA 2OCDA 4HGNA 4PSDA 3Q7SA 1I0IA 2ISQA 2C7GA 2GXSA 2X