3LE8A

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.70 angstrom resolution in complex with 2-(2-((benzofuran-2-carboxamido)methyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLASSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of the interligand overhauser effect for fragment linking: application to inhibitor discovery against Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 101
structure length 287
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3le8A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3le8A01
4JYZA 4ZCPA 1H1TA 3TQOA 3CR8A 5AHWA 1QU2A 1O95C 3Q10A 1UFVA 5DEOA 1YUNA 2NSYA 1O97C 4I6GA 5TGTA 3DPIA 3A05A 3KT8A 1O95D 1JZSA 1PG2A 1YIAA 3SZ3A 1Q19A 4YP5A 2C5SA 4K0RA 1BS2A 1R6XA 4ZCQA 3QTBA 1WXIA 4E1AA 1NUUA 5EKDA 5HUJA 4UZFA 4MULA 3NV7A 1N2GA 3ILVA 3RJZA 2J08A 3QTTA 4Q93A 4PY2A 4FZJA 4ZCTA 4AQ7A 1K4KA 1VBNA 2QJTA 3TZEA 2WB2A 3CA8A 1FFYA 1NI5A 3KT0A 5TEVA 5J5AA 2YWCA 1OWOA 1N75A 2A4MA 2D54A 1X6VA 3OTWA 1WOYA 3LCJA 2DPLA 3PNBA 1N78A 3G6KA 2NZ2A 3D6VA 5HUHA 3N2YA 1EUQA 3UC5A 2OV4A 3IVXA 3CLSC 4EFKA 4HJXA 1QTQA 1EFVA 3N9IA 1WKBA 4ZT2A 1JECA 1KQPA 1EJ2A 4MW6A 3AIIA 1YUMA 1R6TA 3IVGA 3SYTA 1LW7A 1M83A 4OUDA 5K0TA 3AG6A 5IHXA 5KHAA 2GKSA 4OUDB 1O94D 1JILA 2QUKA 2A1UA 2E21A 1I6LA 1G59A 5FO1A 3SP1A 1U3DA 2QJOA 1H3NA 4RUKA 2A88A 1JEDA 3CVYA 1OD6A 5LM3A 3RK0A 1VBMA 3Q12A 2CV0A 4TS1A 2Z3VA 4R2LA 1WXFA 2A1UB 4ARCA 3NBAA 1K97A 1JIKA 3GUZA 4MWEA 2D13A 3UOWA 4ZCSA 1EUYA 3COYA 2TS1A 5FNZA 2A7XA 4P2BA 1JHDA 1QRTA 4F3RA 1IQUA 4XSVA 4CT0A 3CVUA 2X1LA 2A86A 1XNHA 1U0BB 3IOBA 1KKUA 1O97D 4XFJA 4ZT6A 3SDBA 1KAQA 3SEQA 3MMXA 3LE8A 2E89A 1T9GS 1IQRA 1N2HA 3ZIUA 3OP1A 2QUHA 2CYCA 1I2DA 3GLVA 4KPUB 3AFHA 3TQIA 1Q15A 1FYDA 1PFUA 4I6JA 1LI5A 1QRSA 1EXDA 3H9CA 3INNA 3ZJUA 3AL0C 3BL5A 3AG5A 4JZYA 2VXOA 1IFXA 2DERA 1KR2A 2R5WA 1MBZA 4G5YA 1Q11A 1MB2A 4HK4A 4GRIA 1WY5A 1WZ2A 1KH3A 1TEZA 4CQNA 3D6UA 1ZH6A 3U1VA 4YP6A 4MW9A 4RPIA 1PG0A 1F4LA 3QE4A 4MW2A 1OWLA 2JAXA 4MVXA 4L2IA 3CLSD 3CLRD 2QJFA 1J20A 1WXGA 1F9AA 2CT8A 5KWVA 1COZA 3TNJA 3ZUGA 2EJCA 4EG6A 4KR6A 5DK4A 3GMIA 2WSIA 4MW4A 1IVSA 3ZJTA 3IH5A 3HV0A 3IOCA 1Q77A 3ND7A 1R6UA 3UY4A 2QTMA 1NURA 4Q16A 3NBKA 1NYLA 3MUEA 1EFPB 2IELA 4F4HA 2VTBA 1WQ3A 4MQ6A 1J21A 1I6MA 4AS1A 1JMVA 3KT3A 3IUBA 1EE1A 1TQ8A 3UMVA 1J09A 3H05A 3ZXSA 4BWVA 4MUJA 2GOYA 1GN8A 4ZT3A 1HYBA 3CLUC 1GAXA 3I05A 3RFFA 1N2OA 1RQGA 4WSOA 1M8KA 3A2KA 3IMCA 2PZAA 3MLAA 1J1ZA 4MUIA 4KR7A 2CYBA 1IHOA 4MW7A 2YY5A 4NAUA 1EFPA 4ND7A 5LFAA 4DE5A 1N77A 4YBRA 2JANA 3G59A 3HL4A 1NUSA 1F7VA 3A04A 5BNZA 2O5RA 2QUJA 4DNXA 2O8VA 4PBTA 2DLCX 2BTEA 1QJCA 3AKZA 1M8GA 1NUPA 1TFUA 1KP3A 2J5BA 5J59A 1KP2A 3ND6A 3MLBA 4EG1A 2CYAA 5KCMA 2X1MA 1KH1A 3CLTD 4A91A 2E0IA 1VBKA 2YXNA 2A1TS 4R2MA 1J70A 2GM3A 2I1LA 2A84A 1JIJA 1S4MA 3CVVA 1N2EA 1B6TA 1N1DA 3P52A 3ZXIA 2AG6A 4ZT4A 1WJGA 2EL7A 3P0JA 3IUEA 3COZA 3M5WA 5IJXA 3DO8A 1P7PA 3FIUA 4MVWA 1T6XA 3N05A 1T6ZA 1NZJA 4U8HA 2AZXA 1O0CA 4I6EA 3P0HA 4YMIA 3FI0A 4MW5A 4MUNA 3L92A 4NATA 1OBCA 4EG3A 5TEWA 1H3EA 3ELBA 1YI8A 1F7UA 1WXHA 4R0NA 2IJGX 1U7DA 3H97A 5DB4A 1G8GA 4H3SA 1QRUA 4U7JA 4MW1A 3ZGZA 4JXXA 3HMQA 1KORA 4MUKA 3DV2A 4OJMX 1MOPA 3IODA 4NZPA 5H16A 3JXEA 1MJHA 1O6BA 3ISJA 2PG3A 2E18A 1TYCA 1YULA 1O0BA 2AKEA 3SEZA 2X3FA 4KPUA 1IQ0A 2CV2A 1ZUNA 5F23A 2DR2A 1O94C 3SZGA 1PFWA 1TYDE 3Q4GA 1GTRA 3FETA 5TS2A 4KR9A 3FOCA 1SURA 4QRDA 3FY4A 4JXZA 3K32A 1N2IA 1M8PA 4EGAA 3X1KA 4MVCA 4G5FA 4DDHA 1MAWA 2X0KA 4MVYA 3RBAA 3IMGA 1U7XA 1M1ZA 4MWBA 1ILEA 4EG4A 2WQ7A 1NP7A 3CLTC 3ND5A 4MUGA 3F3MA 3X1JA 3CVXA 3KFLA 4MLPA 2Z08A 4L2IB 1T9GR 2WQ6A 1OWMA 3IDFA 2QTNA 1TYAE 3E27A 2JA2A 4S1OA 4QREA 4KKVA 3VRHA 1V8FA 1MB9A 1MC1A 1O96A 2YWBA 1NUQA 1MRZA 1KQOA 2BYTA 3X1MA 3A4IA 4JFAA 2PZ8A 3G5AA 4NAHA 1H3FA 2HGZA 4EG8A 4GU5A 1TYBE 1ZH0A 3VGJA 3UK2A 3C8ZA 3HZRA 1N3LA 5J58A 1DNPA 2ZUEA 3IOEA 1A8HA 3TS1A 3PNVA 2PIDA 2PXHA 1GZUA 2H2AA 1EFVB 2A1TR 3VU8A 1PFVA 3N8HA 4HPWA 4EG5A 4HJRA 4ZCRA 1N2JA 4DDMA 1CT9A 1OBHA 1VL2A 1WQ4A 3H9BA 4PBRA 5K0SA 3FH0A 2RE8A 1QU3A 4MWDA 4EG7A 1O5TA 2IP1A 4U63A 4XFDA 4QBTA 1NUTA 3FDXA 3TZLA 2DEUA 1JEEA 1IH8A 1JGTA 2J09A 3ZJVA 4CDMA 4PBSA 2CFOA 4MUEA 2DUMA 3FG9A 2ZP1A 5DASA 4YP7A 5HG0A 4DLPA 2HMAA 1ULHA 1T6YA 1D2RA 3H99A 1OWNA 2CUZA 4ARIA 1G8HA 4NDAA 4ZT7A 4X0EA 1N2BA 1KAMA 1YIDA 4EF6A 3MXTA 2PFSA 3FWKA 3FHJA 4MWCA 1PFYA 1KQNA 3IVCA 2B7LA 1GTSA 3PNYA 3FNRA 4J76A 2RD2A 2CV1A 4ZT5A 3COVA 4J75A 4UZEA 3CLUD 4MUFA 1NSYA 3CVWA 1J1UA 1LI7A 3IMEA 3LOQA 3PXUA 1M8JA 3PRHA 2ZUFA 5JBNA 2QTRA 1KH2A 2XRYA 2Z09A 2OQ2A 2CSXA 2J4DA 1IRXA 2PZBA 1WXEA 1Y42X 2QUIA 2DXIA 1K92A 5FO0A 1ZJWA 4MAFA 5H7XA 1JIIA 1XJQA 1GLNA 1QNFA 1QQTA 2D5BA 2V0GA 1V47A 1OWPA 5LLTA 3HFJA 2DETA 1I6KA 1XNGA 3KT6A 1VLHA 3S3TA 3RK1A 1GPMA 3COWA 1G8FA 2H29A 4CDNA 2VTBB 3HGMA 4ND6A 4DJAA 4K03A 1O96B 4G6ZA 2HZ7A 4NX2A 4DDKA 3L93A 3P0IA 1JZQA 1XNJA 3K9WA 3DLAA 1X8XA 2XRZA 2G36A 3RHSA 1M8FA 1K4MA 4MUHA 3CLRC 1MAUA 1U3CA 4MW0A 4WNYA 2V0CA 2J07A
chains in the Genus database with same CATH superfamily
3BE8A 2X58A 3TQOA 2IHZA 4KYTA 4RPGA 1BCSB 1E66A 5JALA 1N36B 4KR3A 4HYEA 4ILKA 1UFVA 1GPH1 4ER5A 2OHHA 2NSYA 3LYUA 2GPWA 3MTDA 4I6GA 5SYNA 3GLQA 4B3RB 4DUYB 4MV5A 1DFGA 1QHFA 3Q87B 3UXEA 1I0IA 1Z28A 4FOLA 3PXGA 5BOVA 2HWYA 2OAEA 3BD6A 4ND1A 1XDDA 1MVNA 1E9VA 2KMLA 3D8TA 4NRDA 5IH3A 1B73A 4K0RA 1DAHA 4FMCF 2ZIVB 3FZQA 5I4BA 1E5LA 3HS3A 1U9IA 2WJGA 5G0VA 1XA0A 4JWTA 4FHEA 5ADVA 5K0FA 2P2SA 1R66A 1N2GA 2O54A 1MV8A 4HWSA 1Z17A 3QTTA 3QSGA 2W71A 4K9RA 4MTLA 3UH0A 3ULKA 3NHLA 3ZQUA 1TW3A 3HGTA 1LBTA 3LF1A 4YCMA 1Y7LA 3CUEF 1FB5A 3NC1C 1B0AA 1GPLA 4LHEA 3W2HA 4C4XA 5AM2A 2BGKA 4Q3CA 4KLRA 2NW6A 3SHQA 1K6JA 2MSNA 2QBYA 1NM5A 2NUBA 5DKFA 2HHHB 1ECPA 2XNCA 2NZ2A 4IR7A 5HUHA 4RQAA 4K81B 3U1TA 1FDIA 1VKJA 4HDOB 3TOZA 1C9DB 3O4HA 1WKBA 4WESA 5EE5B 2ERCA 3GLGB 1KQPA 3LO8A 4C2UA 3VR4H 4X5OA 1BHJA 1EVYA 3FYTA 3HY4A 4DAEA 3IA2A 5A62A 5EE9A 5JQGB 1TM5E 4BJ6A 3U7HB 4QE3A 1M83A 3VJLA 1YE8A 4YIHA 4DIUA 5IHXA 2HXYA 1A9TA 2JCXA 3R4CA 2B1IA 4FSHA 4XX0B 4TQAA 2GYYA 2G0AA 1JILA 1FNMA 1MJ5A 3H2IA 4CM1A 3PNOA 1G59A 2ZULA 2P69A 4OL0A 3GJ4A 5DHPA 1EE2A 2PD6A 3AWDA 1O6ZA 4GKJB 3PYXA 1Y37A 5E2AA 1M34B 2V6JA 3MD0A 3USCS 1JR3D 5AW1A 3HP1A 4RCZA 5F77A 1W87A 3GUUA 1KSHA 2CFCA 4URVR 3OA2A 2OFXA 3ABRB 2M1XA 1FFHA 5H81A 1S02A 4A1FA 1NXWA 2G67A 3E3MA 4Y7CA 4C6RA 4E6EA 2A92A 4U2BA 2R3SA 2BM0A 4GNKA 5LQNA 2G04A 1HZZA 1M2OB 1E2BA 1QYVA 5DHUA 2VDWB 5THXA 1W96A 4A92A 1JJFA 4BLOA 1ZM9A 8LDHA 5AVJA 3GELA 3RAFC 3JWHA 1DXQA 4LJYA 3ZBTA 5BRJA 4URZR 3WMRA 4EYGA 1R64A 1KY3A 8OHMA 4I50F 2D13A 4EVSA 3DEYX 4JYMA 2XKJE 2BEVB 4LC9A 2C2HA 5FBHA 3V80A 3QYPA 5ALGA 1I24A 5CURA 1TMOA 1M54A 2Q6OA 1L8AA 2YZMA 4M9XA 5EYPA 2C00A 3JQBA 2OQIA 3O75A 4FGLA 2CLCX 4LTMA 3MINA 4OYLA 4HG2A 2WJ6A 4WFQA 4CCWA 5A4JA 5IK2A 3O26A 4L0QA 4PLVA 4BLPA 4ESOA 4WXPA 2C4UA 3G82C 3OU6A 4QRHA 3EFHA 4ND5A 2P40A 3DJFA 2ZJ4A 1QHGA 2BFDB 4Y2QA 3I92A 3MN1A 5CU7A 5CT9A 1HNNA 3H1FA 2Q49A 4FYYA 2XODA 4GI2A 5EUBA 5JE8A 2BAGA 1HI9A 2H17A 4V0MA 3THYA 3DGEC 1HYGA 2JS7A 2QVZX 4X24A 5DPMA 3RJ5A 1SBIA 3CFYA 5B1DA 5BWLA 3AIKA 2HLDA 1M1XB 4H7IA 2KLHA 2XGOA 1GTG1 2HF8A 4KGXA 5FTNA 4GOND 4AC9A 3GGSA 4PYJA 4YUAA 3C5WP 1FFWA 4B3XA 1O4WA 3EVDA 3HVRA 4RTPA 2AFHB 2O2SA 3MEQA 5ALSA 1USUA 5HF6A 3SICE 3ZW7A 4DUGD 3GXOA 1A7AA 3DPUA 1EJ6A 1EG7A 1I4EB 1JWBB 2ILTA 3NANA 1KJJA 2PUJA 2AZ4A 2W37A 3Q3JB 3THSA 2B1GA 4ZTZB 2F62A 3ZY4A 3ZWYA 2XOKD 3VFDA 2QJFA 2R84A 3QVWA 1SZJG 3C5CA 4KIGA 4DZZA 3DTVA 3VO8A 3BWVA 1J7JA 4OI4A 2AN3A 2XB2A 3ZWXA 3UGKA 4OX9Y 4B09A 1WCIA 2NLOA 1BFUA 3RFVA 4KR6A 1IEVA 3GLIA 5DK4A 2FWIA 3O2NA 1YRAA 3X1DA 3ZJTA 2EZTA 2FU5C 4QJ5A 1U1CA 6PFKA 2EL9A 1CDZA 1BDBA 5KUTA 1K8RA 2GNOA 1E5QA 4OLHA 2DFPA 2G3DA 1Q77A 1SCBA 3ZDRA 1HOXA 1K3FA 2JB9A 4GBED 3QMMA 4WBSA 3W3AD 5HR5A 3U13A 2G5GX 3VR4A 2C92A 1JF8A 2H1SA 3E23A 2B7BA 4RYDA 2ZUCA 4HLUA 2J5KA 1GJRA 1KO1A 3AI2A 3ASZA 1JEQB 2A1IA 2CVZA 4UVIA 4ZOAA 1TM1E 3B9BA 3REQB 3P0FA 1DEHA 4S35A 4YLYA 4Y1FA 1R12A 2CNWA 2HPZA 2VNKA 4AK9A 1Z62A 4IIEA 4BL5A 3AHFA 2I7DA 3B6JA 1OXKB 4OG2A 3DR5A 4RGQA 1OZ0A 3A9CA 4B6PA 4BGIA 3ZTWA 2JVKA 1E6MA 4AG5A 4H27A 3OQIA 2QE7A 3RWBA 2FSUA 1QLWA 3QBTA 1GQYA 3RFFA 5BN1A 4IY1A 4DIBA 5IU6A 3N3BC 4WSOA 2FZ4A 2VAPA 3ADKA 3ROFA 1F4VA 2OV1A 3N75A 2PHZA 3RVBA 1WBJB 2MU1A 4MYCA 1OYYA 4NTZA 1MEEA 3T1QA 3KOUA 4J2OA 5G3ZA 1Z0IA 5EHZA 2OOKA 2YQZA 3AB3A 3KBBA 2QSZA 5ES4B 1QZZA 1CEEA 1A50B 1V7PC 2PGOA 1BWSA 4E51A 1Y7PA 3NO4A 7GPBA 2IYRA 1YS4A 1EWTA 1CZUA 1DE0A 2RGCA 4Q7QA 1U8UA 2Q8QA 3OZCA 1FP7A 4LV6A 4IH9A 1J0CA 2GW4A 5ECWA 4OL9A 2XUFA 1Q0TA 3WP0A 3BGDA 2PCJA 3LZ6A 1A2OA 2O8VA 2OHXA 5FTWA 1UP7A 1QJCA 2PA3A 3TRKA 3DYBA 5IKPA 1NUPA 2PWPA 1VL5A 1KWKA 1HOTA 2IL1A 1KP3A 1WB9A 4N40A 2A50A 4KO3S 5JJIA 3GFFA 1SIBE 4X97A 4GX2A 4QO7A 2Z04A 1II9A 1K5HA 3BXXA 3EIHA 3FBGA 3R74A 1THMA 3C4JA 3STTA 3U3OA 3ADCA 3ZY2A 2JK1A 5D3ZA 4BFXA 2J8ZA 3K9HA 1LK0A 5IARA 3HXOA 4MPTA 4D9GA 1SCQA 3K4QA 5JUWA 4XJTA 5A3QA 1G3QA 5F12A 3IUEA 1RQXA 2CFIA 3G8BA 4IYRA 1Y8AA 3JQAD 3O90A 1R2QA 1J06A 1PEAA 2ZREA 4YJDA 1CUSA 5EJIA 2VPPA 3CGGA 3DKVA 3N05A 2C4NA 4C3VA 1T8TA 3GRCA 3MGGA 4J03A 4GE3A 3BBLA 5K01A 4I6EA 3HDHA 1NI4A 4HH0A 4DEVA 1KI3A 4LZZA 5CA1A 4P0QB 1KEZA 4TXMA 3ZZ1A 4CU5A 1LNZA 4RY8A 2IECA 1HA3A 1P9NA 2FOXA 4HN4B 4NC9A 3TFOA 4ZEOA 3B6IA 3PF9A 5KOJA 3O7WA 4ZQBA 3VZRA 1GG5A 3DAOA 2VWQA 4B3TB 3B1FA 2R8XA 2XXJA 3H97A 1VHWA 4JLKA 3H2SA 4KWTA 3CF0A 2WP8J 1QVAA 3UTDA 4D2IA 4YXFA 1MA3A 4F9GA 2EEPA 1YQTA 1KAOA 1YT5A 1A97A 3Q7EA 5LBIA 1JEJA 1NQUA 5ALIA 5HCNA 4EVIA 9GPBA 4KE6A 4TTVA 1LVGA 3ED1A 4Q24A 4EQ6A 1YS9A 5KYWA 3BX1A 2KX7A 2NZJA 4Q1CA 4UTNA 2GDJA 2WTEA 1BE6A 2BEUB 5CT4A 1LNQA 4JQOA 1XLTC 4KJXA 4IS2A 1WXWA 3L0BA 5CH8A 1T2VA 2GLTA 4D0SA 1W4CA 3UYLA 3H2YA 4PLGA 2TMGA 3ND9A 1WD7A 4JL5A 1E18A 1GPBA 4NZPA 4EA6A 4AWAA 3GBPA 2V58A 2OP0A 3CUTA 3Q3IA 5FI0B 3U3MA 5I45A 5C1BA 1N2XA 2YYAA 3QG1A 1P81A 1G0NA 2BDTA 1MC4A 2JKZA 3I72A 1G2OA 1N5DA 5J1TB 3WK8A 1QHSA 1JX6A 1U3FA 1O89A 1ECFA 1UFOA 4LDRA 4NEHB 4D0RA 3CF4A 4M1MA 2J67A 1CVLA 2YXLA 3EJ6A 3H1EA 4Y0AA 5J43A 3OLCX 3UA0A 2CDNA 2CV2A 2O2IA 1JDNA 3K92A 1ZC3A 1JLHA 1S0UA 3OLXA 4M3NA 2UZIR 2GJAA 4FBGA 2V1XA 4RD1A 5E9WA 6YASA 1OFUX 5KWJA 3JD3A 5CW2A 1N2IA 5IAAA 2F1JA 5K3OA 4KMRA 3S55A 1BE0A 4MVCA 3E7PA 4MWTA 5AI6A 2IZ1A 2Q6VA 1XZNA 3TGWA 1ODJA 3KKOA 5GZ3A 4OGWA 2IDJA 3SC3A 5KNCD 4R8SA 5KYTA 4KITB 3HXTA 4AULA 4GL2A 2H31A 3DMFA 2E87A 3C7TA 1YBMA 5LOVB 2HIHA 2C2MA 1B93A 5COBA 5EJMA 4UCWA 1JSLA 1NVDA 2YJ3A 3B5IA 3MWGA 2IW3A 3IPRA 3I6ZA 1ABBA 1G16A 4A10A 1V5GA 4WACA 1YR2A 1XHFA 1MO4A 1W52X 1XWFA 2XT0A 2HHJA 3IFSA 5HCIA 1N7GA 1YI0A 2VDQB 1MPTA 4DV7B 1KVRA 1KYWA 1EM8B 4FONA 4HPJB 1XYVA 2HMVA 2I4IA 3DVQX 3H5IA 4IRUB 4KKVA 5JZMA 3IIMA 2WU3A 3BMNA 3MAJA 1TO2E 2W4QA 1FP4A 5D3KA 1MRZA 1F0YA 1BW9B 1G5HA 2P0AA 4F1JA 1T91A 1WSBA 2I80A 4DLNA 2Q1XA 1HSZA 4B3JA 2LKDA 3G0OA 2C5FA 4JUCA 4GFDA 4ZGGA 3LPNA 4QUJA 3WGIA 3VGJA 3O91A 4QNNA 2Y0PA 2ZUEA 1BN6A 1TIPA 4EB3A 2X8WA 1NVVR 4IDOA 4Z3OA 2Z4SA 3OT1A 2JH3A 1TLFA 2ZAMA 3CT4A 3KD3A 4O33A 3FVTA 3BT7A 5ADWA 5ICMA 2FH5B 5TPWB 1DAMA 1P39A 2C0QA 3ZLTA 1FMJA 3QXXA 1YR6A 2ORED 1S2DA 4ZRMA 3CZRA 1PHRA 1S9DA 1MAVA 3QUCA 4LJ9A 4A0GA 2FMUA 2R8PA 4Q9KA 4XYLA 3ICWA 3OZGA 1YB2A 2R6AA 3H2BA 3FPCA 4P8RA 3TDNA 2PUEA 2G3YA 4MWDA 4V38A 2C5AA 3UT5A 2GZHA 2X9QA 4XFDA 3GFPA 2BMVA 1EKXA 1E4EB 3AXTA 3CUVA 3M4XA 3PQ5A 3UMRA 5CEEA 1JGTA 2JCVA 3CSSA 1JFFB 1NOKA 3DKRA 3MJDA 4LY9A 4B6JA 5HIKA 4KYUA 4PZ9A 1XEWX 5ILOA 1JEOA 4JC4A 1GAQA 3RUFA 1TX4B 1Q95A 1SCJA 1QAMA 2IUEA 3BMCA 1SHKA 1Y1PA 4IX9A 1OWNA 2LTAA 4YI3A 2G25A 2GZDA 4EMUA 1I4OA 5IT0A 1RI2A 2REBA 5DNWA 1MEOA 1N2BA 3H75A 5AOCA 2DWUA 3ZXXA 4C7VA 2XLBA 3RW9A 1HT3A 3UENA 4QFCA 4P33A 3V8MA 2O1EA 5JY6A 3HVUA 4RSMA 4S1VA 1VDZA 3SZOA 2OV6A 4DLWA 5L6MB 4GYKA 1E3MA 1RYHA 3U7GA 2I2AA 4INOA 3CVWA 2G83A 1JRLA 2Q3CA 1L7AA 4NH4A 3INGA 2GFQA 1YB7A 3L1HA 4X93A 2H5LA 1CUWA 3N2KB 3OKPA 1C8BA 1E3TA 3A06A 4FIDA 5DLPA 3D8RA 3VUFA 1NVWQ 1RLTA 2A4KA 3DXZA 1Q6YA 3IA7A 5JDIC 1NVTA 2V6BA 2Z5GA 3EGEA 3MPOA 4HC4A 4G5XA 3EZ9A 4K9DA 4D3DA 4DCGA 721PA 1QQTA 1PSZA 3OPYB 3HGQA 3IQZA 3WWZA 3AJEA 2XQGA 3K0CC 4DGQA 3REQA 5L4NA 2WTUA 2MINB 3TFWA 4B6OA 4TMWA 4I55F 4YRDA 5AM5A 3UK7A 1T5DX 2PL3A 5L8VA 3M6AA 1EM6A 1A9RA 5HOQA 1HG1A 3R8CA 4YJFB 4IXTA 3O0TA 4OXQA 5CDFA 1LU9A 5BW8A 1E0SA 1A72A 1CIPA 2IHKA 1U3GA 4OAQA 4OHUA 2C2OA 1EEXB 1JZQA 3IMFA 4YRFA 4P34A 4E31A 3EE6A 1B41A 1ECJA 1LLDA 3EEBA 4XLTA 3GMDA 4IIDA 1T8YA 1Y3DE 2J9GA 3CLRC 5BR7A 2XE7A 3DYIA 4HAIA 5CFOA 1JG1A 2ZKIA 2PBLA 3EZXA 5I9MA 4A2CA 1BU8A 2QV7A 1NNI1 4KQFA 5AHKA 2XDQB 3K30A 1S2GA 1D6SA 4FWBA 2AMJA 2YW9A 5TGDA 2Q8PA 3RTAA 3T5CA 5LQKA 2J31A 4WW0A 1JH9A 3M9XA 1JZTA 2DCUA 3A05A 2FN3A 3KT8A 1FDUA 2FE4A 2IU3A 2VHTA 2WHEA 5DGXA 4MS3A 5AMXA 3W9SA 3CRNA 2XR1A 3F5QA 3T99A 2HMTA 3UUEA 2YL2A 3G89A 4RKYA 5EXXA 1UZAA 3LP5A 1SHJA 1CFJA 5FWXA 3E35A 4O2BA 4MA4A 2QRPA 4MULA 1Y48E 3GI1A 3QE2A 5JLAA 3F7OA 4EI9A 4R0VA 1KZ1A 4QQ8A 5JZSA 4PY2A 1HE3A 4NIMA 1KPHA 4U6QA 4IJ5A 3KKNA 3UQZA 9ABPA 1P2VA 3C74A 4CMKA 2I4LA 3OPNA 1U9JA 3X2SA 4HYYA 5EKTA 4EYQA 4MRRA 2JGAA 3ZHXA 3S40A 3DAYA 4R8VA 2ZBVA 3RSQA 3TGPA 2J3DA 1JFRA 2BV3A 4CFZA 4RNDB 4LSZA 5ESDA 1NW9B 3SG0A 1OU0A 4BFTA 1WOYA 2ZR7A 4ZANA 4E3ZA 2Y8EA 4JI6B 3WIBA 3NHKA 5KQLA 5DGCA 3ER6A 3NBXX 4L8GA 5E7QA 2GCIA 3JWJA 1YR8A 3TTVA 5T8KA 4KFRA 2ZCJA 1D1SA 2CC2A 2M2IA 3SJZA 1T35A 4N6OA 2WIJA 1E1RD 4IJWA 4EK9A 1CY1A 1L1RA 1YDMA 4A5OA 4MW6A 2HO5A 4ZO8A 4WOPA 1YHYA 2ZRFA 2CLEB 2JGDB 5EP2A 4UM8B 1SQ0A 3B52X 2R6FA 5A4AA 2V7QD 4E1BA 1U7TA 5K0TA 3AG6A 1BCSA 5KHAA 3HWWA 3QOFA 1HRDA 1VI5A 3MCAA 4GWGA 1YVDA 1JS1X 1N2SA 4MPDA 1O94A 2HB6A 4RDHA 5DN9A 4BB5A 4F56A 2RGWA 1T6BY 3BQNB 3P4YA 5EP4A 4LKOA 5B36A 2QRVA 3QOXA 2E6UX 4OM7A 4M1ZA 1VMKA 4Y3UA 5REQA 4JBWA 1I3OA 4ERXA 2R1ZA 3HH8A 3RU2A 4TX1A 3LNTA 1M0SA 1Z0AA 3BRQA 3DOHA 3LOUA 5C5CA 4KC0A 1EFAA 3HKDA 5ABPA 3ACBA 4QDXA 5IDQA 1PF7E 3DL2A 5EXDA 3DMTC 1RHJA 2CJWB 2CV0A 3MTAA 2PH3A 2WSMA 1LQUA 4DPKA 4QTTB 3RM3A 1O87A 2MWMA 3DE1X 2XRFA 3SLKA 1HDCA 1PR4A 2A1UB 1G8PA 1W5AA 1WKCA 3I2KA 3N2ZB 4I46A 2BBTA 3VNBA 4AO6A 1U8ZA 1Z18A 2DRIA 2V03A 3I6BA 1GRQA 4KSBA 1V4BA 3IPYA 1NUAA 1U8TA 1BXZA 3VISA 4Y7DA 3SS7X 4DW8A 5GIPE 3G7NA 2I78A 4MDYA 1CF9A 5KNCH 2P4SA 2QGFA 4U7PB 5K5EA 1IQUA 4QYWA 1MABB 2BM1A 1X1SA 4O2BB 3F8TA 1KKUA 1MHPA 3DFZA 3F4KA 4ZTUB 4BZQA 5JCXA 2XMCA 4PICA 4W9NC 3AKYA 1IQRA 1QM5A 3QPVA 4B82A 1RAIA 1I2DA 1EINA 3ZCQA 3AFHA 3IV7A 4HVCA 1YVUA 3LQQA 4F3KA 4TXJA 5JSFA 1TU3A 5EG5A 2LDXA 3COSA 1SCAA 4EDHA 1ZLXA 1Z8FA 2JCSA 3O2SB 3PC3A 3AG5A 1ISSA 3OJOA 4LCBA 4JQSA 3ZV6A 2RAVA 1XRRA 3PSAA 3LLMA 4JJIA 1WW3A 3VI4B 2BSAA 5KAMA 2XSZA 4MR7B 5BORA 5EIEA 1Z12A 2ALJA 3BHNA 4D4LA 4L8YA 4BIIA 5IH7A 2O2HA 1OT5A 2PMCA 4BX8A 4KXNA 3LF4A 3PGKA 1UXHA 3ETLA 4FGZA 1K88A 3FLMA 3D6UA 4DUPA 2FWNA 1T4CB 1FDWA 3GRVA 3PHGA 2GBFA 3HR8A 3MGCA 3PNLA 4FNMA 1NTRA 4TWRA 2GEKA 1TKRA 1PG0A 4MW9A 4HEJA 1G63A 3G68A 3K8ZA 4RFLA 5GV7A 4KR0A 4R98A 4RVUA 4ALIA 4D74A 4YAUA 2CXRA 5DW3A 2GR7A 3CLSD 1R8SA 2ONKA 3F46A 2OWDA 4H4CA 5JO9A 3LNCA 3KTFA 1Q92A 3DT9A 4BS9A 5IJZA 5K0BA 4QPNA 3G2JA 2JD2A 1ZK0A 5JYDA 3T38A 5CXUA 2IF0A 5D5QA 3GPDG 1WD5A 3ZNPA 4AZ0B 2XAUA 4K3UA 2GILA 5AVUA 4A2PA 3TZ6A 4YS6A 2VJMA 1R37A 2B5OA 5EMJA 3LSTA 5GV8A 4DBZA 1RRGA 4KXFB 4NQZA 3NS7A 3D2AA 1DCFA 2W4MA 1VE6A 2ZR9A 2O59A 4BU1A 4BOYA 2JDID 1WR8A 3TDMA 1W30A 3HY6A 3IIJA 5TQJA 1MDBA 3QEKA 3IQIX 1M6YA 3KYCB 2HQOA 3JAWB 2C8JA 3TLMA 3L1UA 2XVYA 5K3DA 4D99A 3AUKA 1GSAA 1ZP6A 3LH5A 2BY4A 3M6FA 5EQJB 5BYBA 3RU9A 1CY7A 2XYHA 4BJ1A 2WG2A 2HYIC 1SZDA 1YJQA 3CRRA 4N54A 4FNAA 1Q91A 4EJMA 5LU9A 1U80A 4FE4A 4Q37A 5B4TA 4TROA 3WJ1A 4DMGA 1NULA 2W00A 4BMZA 3UQYS 4CL0A 3PL5A 1ULSA 2VIIA 2AC7A 1J09A 4ZU3A 5BSEA 1ZK4A 2BBSA 5CYOA 3R4VA 4UKDA 2Q0QA 3G7SA 1UDAA 4JOCA 3TNLA 5MFPA 3GL9A 1DT3A 1FNCA 2WILA 2QT9A 4EW2A 3DBIA 4LNAA 3W5HA 4PHHA 3UMMA 1DWOA 1E9CA 1ISMA 1P3DA 1YZGA 3NOXA 1TM7E 3ACCA 2H1FA 3PJEA 1VM6A 1H69A 3WHIA 5AI4A 1ZN9A 1EFRD 1SOMA 2H48A 1EA5A 1SEVA 3K1TA 3PGVA 3Q6MA 4H7DA 3B13B 4R6XA 2DUUA 4W5JA 4ZYTA 3EMVA 2NPFA 5EHQA 4DIKA 4YR9A 1M0EA 3DDNA 1QIGA 3R9XA 2CYBA 5B7GA 5KMGB 4RTQA 3RAGA 1RYNA 2FVYA 2EJUA 1Y5NA 2AZMA 4Y1GA 2GTIA 4GSKA 4K9MA 3GEPA 5ALYA 3VZQA 3Q8XB 1HNXB 1ENPA 2NAPA 2VPQA 3PDUA 2IIQA 4KACA 4M8KA 2H18A 2AG8A 1G2PA 4BFLA 4UBOA 3FWYA 1R5JA 1GQOA 3OUZA 3IRUA 5LL6P 2YZ2A 3KLOA 4KDCA 3J7AC 2CNWD 3VSEA 3SJBA 3QPAA 5BP7A 4ID9A 4MP6A 4IQ8A 4ICIA 4A91A 4BE4A 1B8OA 1VB5A 1R0KA 3TMYA 4NENA 1XF1A 1MW8X 1TFRA 4W1QA 1N5JA 1G6HA 3FBWA 1TDJA 3B1YA 4FDUA 3DDWA 4K2AA 2J30A 2JJ2A 5K4GA 3AUTA 3KAKA 3PRJA 3CZMA 3Q88A 1BYUA 1KYTA 1WCYA 3DDHA 5KKNB 3RFTA 2D7CA 4I1VA 2RHWA 2I55A 5CLGA 4BYMA 1Q17A 2PH7A 4X6YA 5HIIA 1KU0A 5AUOB 3R0ZA 1A5TA 5DLYA 3OT1B 4PGHA 5BYKA 4D92A 4COOA 2R7KA 2VYNA 4M87A 5DM70 5ADHA 1C3OA 4L78A 1PYGA 2P6MA 2YZKA 4Q4DA 4BVHA 5EXCA 1HV8A 1AGXA 4XLZA 5KKAA 1NRJB 3DDCA 3R9KA 3RKUA 1GKIA 1CE8B 1VCHA 4BKOA 3HKBA 2BTQB 1Z0JA 3DMTA 3SC6A 2EEZA 1GZHB 4I14A 4PO3X 2M6LA 1JAIA 1M6WA 2IJGX 3A1UA 3UBMA 3WJ7A 4CMIA 1JQAA 4DKXA 2YH2A 1OFHA 2HV9A 1U4SA 4CG3A 5IAOA 3WRXC 2XB9A 1FYFA 1N9KA 3TLGB 3LLSA 1HKUA 1MVOA 4GC5A 4PYOA 1JJ7A 4NCHA 5CVDA 3BL6A 3QKSB 4ACBA 2VAVA 3VYWA 1P1KA 4G1EB 1QP8A 1HE2A 3IQWA 3UVEA 1WQ1R 1HEIA 1TQ4A 1X7GA 4OJKA 4MVJI 3RFUA 5FWXB 2FFJA 4UREA 5HEKA 1IBLB 5DBOA 3PITA 1C9MA 2BHSA 2H3HA 3FRJA 2DJ5A 1K7XB 3HRKA 4MS3B 1R5OA 3ZE9A 3QBVA 1HQKA 2ILVA 2WSLA 1VSTA 3AM3A 5H3LA 3WKEA 1B74A 2G77B 3M89A 1DWUA 4WY8A 2H54A 1Q2XA 3N59A 2X3FA 1OLSB 2B34A 2OBBA 2XUQA 3Q5GA 3W5VA 3K9FC 1TVCA 4GWLA 2NMVA 2JK0A 2Y0CA 1M1YE 3JSXA 2WYHA 1TA0A 4EX7A 4UMVA 2O1WA 3FOCA 1TF5A 1SURA 4W5QA 4UAVA 1Z39A 5ALUA 4O4IF 5CLQA 1UBFA 4OQZA 2J3MA 2GTPA 3A1VA 3CHYA 4LHYA 5FOXA 1CUBA 4M55A 2FA9A 5K0LA 1E3DA 4UVGA 2F1IA 2AR0A 3SBXA 4L5CA 4A9AA 4CETA 4XM2A 3IMGA 3LFTA 5CG1A 1RRCA 4GO1A 1DIGA 2ZUTA 4GZMA 2PBZA 1O2DA 2WQ7A 3PEFA 3P97A 1XTRA 4PZEA 4PG7A 4UBJA 3U9SA 4X85A 3R5HA 1ZVVA 4WLNA 2GPBA 1PVDA 2KYRA 4EKIA 2PKWA 2NGRA 4CIYA 1NU8A 2WWHA 1FU8A 5DTRA 2CBXA 3EQZA 4OHYA 4YBZA 3HFGA 2OFOA 4IGIA 4HDMB 1MORA 4PLZA 4UQLA 4QREA 3FB4A 4QUDA 1V8FA 1MC1A 3BWEA 421PA 221PA 3TRHA 1IHXA 1Q0UA 3S1AB 4QT4A 4EO7A 3EIXA 3K6RA 3FLAA 2J7PD 1UJMA 4DEXA 3HFSA 4R41A 2JGLA 3PHHA 4JBIA 4TV9F 2GLXA 3ETJA 4R2IA 4YJ3A 3VPSA 3WO0A 4EPRA 5FLXA 1PRYA 2ZDGA 3L05A 3MYYA 1TYBE 3IHKA 3PQ4A 2VHZA 3R2JA 4IVPA 4KVZA 4JVLA 5FADA 1EESA 8AT1A 1F6WA 1GT91 1ORDA 2CDRA 2P3QA 3CUUA 2R85A 4DQUA 4O2AA 1HE8B 3E3AA 1GEEA 1N7JA 2BCGY 3W7VA 5LUAA 1ZVMA 2B2NA 4PFQA 5IJWA 2GF0A 2NYRA 3DCYA 1GQFA 3KKZA 4Q7KA 1RC0A 1Y4SA 3PFGA 2W6NA 3WFZA 5JC8A 3N8HA 4M7OA 4DV6B 2OL4A 1MO3A 1NA5A 5DV9A 4CM9D 4DMFA 1GYRA 1WPRA 3WLJA 2B61A 2PS1A 1G8YA 4YLGA 4GF5A 2IP1A 2XA2A 3OCWA 1S96A 4M0FA 2HK7A 1D7OA 4IUDS 4W4TA 1G5RA 3I2JA 4EJSC 1DQYA 4JB2A 3TR6A 2CL5A 2LPMA 1T9BA 2VYFA 2VWHA 2NYAA 2V9ZA 4BNUA 5FR2A 3FG9A 3KXIA 2RHLA 3TXXA 1ZBDA 2J3HA 1DDOA 2Q4RA 2PMEA 3RRXA 5D51S 4JYPA 2E37A 4KX5A 5D87A 3LP6A 1RJDA 4QXPA 3DVRX 4MKHA 2GZAA 4ARIA 4GOMD 1KZYC 3TVYA 2G1PA 4KIWA 1NHGA 5D1NA 2H3EA 4MR9A 1FS6A 2HSJA 4LIPD 1UXJA 3MWDA 1D1QA 3WXMA 4PHCA 3FWKA 1Y8CA 3GGJA 4X1KB 2QRVB 1WSAA 1T3SA 4G5QA 3UK0A 4V0OA 4PLYA 4KO4S 3AJAA 4ETNA 4GXTA 3UAZA 1V9LA 4NXNB 3DM5A 3DFIA 4LWOA 1R9JA 2CZQA 4FOTA 4J1QA 4PAGA 5KNBD 5KOJB 3U26A 1WCWA 3LDAA 3WBBA 2GRUA 3SQNA 2HSEA 4EHIA 2GCGA 4D9MA 1GSOA 1Q57A 1YZVA 4RD3A 5KYWB 4ENTA 1GAEO 2ABWA 2EJVA 2OBFA 4GLBA 4RHTA 3C24A 4GBGA 4MQBA 4YMWA 4JI1B 1CYDA 5KNLA 1U2TA 2ST1A 2ZXUA 1SXJB 1K92A 2FPOA 2LZ0A 5TXGA 3WC4A 1ZJWA 5EPUA 3FMGA 4QGFA 2QJRA 2HWWA 1ZGCA 3HFJA 3O4IA 4DS3A 3BRCA 1FDOA 3EARA 3WS7A 3DE2X 2R7LA 3NNNA 1C0LA 4L6CA 5IM5A 1AV7A 1YR3A 3J80A 3MCZA 5KTTA 1BYIA 2B0JA 3SF8A 3UIEA 1QF6A 3EVZA 4PR0A 2WVJA 3W06A 3HGMA 3TOCA 1QYRA 3DV0A 1CRLA 3BJZA 1QE3A 4YB8A 4LSGA 3WI7A 4BX0A 4G6ZA 3OH8A 3G9TA 4E14A 2BMAA 3RF6A 3H11B 3P9SA 2Q2NA 4B87A 2AWOA 4FCTA 3ZY6A 3PZBA 1Q0RA 4U3JB 3M8KA 1AK2A 1IMOA 3A32A 2QMYA 2HFJA 4HZUB 1NBMD 5F73A 4EPYA 1H1TA 1ZJJA 1E7RA 4MVJD 3C39A 5J2TF 1Y5RA 5IKXA 2CEKA 4RPLA 3I9LA 2RAUA 3CY6A 1EDBA 1CUUA 1YUNA 2Y1GA 3O4RA 4G9EA 5EIAA 3OP4A 3AYZB 3IKJA 1POWA 3QPDA 2O8BB 4MVJE 5KTMA 4TYQA 1JPVA 4P31A 1MUUA 1GIAA 5CJPA 3W8NA 1AKEA 1GXSB 2QM0A 2B8TA 4RHEA 4WKGA 3RQSA 1V2HE 4ZI2A 1QHHA 3AB7A 3KEGA 1TTTA 5J2UB 4NMXB 4QL3A 4DA8A 1MT0A 3PCTA 1EJ0A 4GYYA 4WLFA 3RBXA 3HACA 1CUZA 4EQZA 2P1ZA 1TECE 3R5JA 4FXOA 4KXYA 1XTKA 3A8TA 3TSCA 3C14C 1IOZA 2VJBA 4RFSB 2I9PA 3TZEA 3UC9A 1HORA 2B82A 3H17A 4KV9A 2Z8XA 1YFJA 1A2KC 5T3YA 2JIOA 2JHPA 1ILWA 1FJ2A 5JROA 4NXMB 2I5PO 4ZOEA 1WPGA 2GZRA 3NATA 1QC5A 1UKYA 1CQWA 4K8OA 5KYNA 4PSDA 2P9ZA 3PC8C 4TM7A 1O58A 4FINA 5UKDA 3DZCA 3O1LA 1Y7IA 2AKYA 4ALLA 1CDDA 4AY2A 1JEYB 1XE3A 2XNHA 1OAAA 1MMFB 3EQ8A 4IRMA 2HNAA 4PU0A 2ZSFA 3LHFA 2CFRA 2BEVA 2ZSKA 2BEJA 1RMTA 3FSEA 5T3UA 4AJ1A 4CM9A 3RVQA 1DEAA 3NWPA 1H0HA 5HS4A 1ITZA 1YUMA 3CFFL 1UZUA 1NN3A 5DTJA 2YIMA 1ZIDA 3LDUA 1G2IA 4MA5A 3H9GA 1UC8A 2FKAA 2GYUA 1PK7A 2GKOA 1XEXB 3PT5A 4GX5A 4BX3A 3IDOA 4QWMA 4OUDB 3LRXA 3HBJA 4QPJC 3FYUB 3L0CA 4DSUA 2H5EA 3CZ4A 2QYHA 2NXNA 3A1CA 3K0FA 3AV3A 4RLFA 2ZB2A 4TVKA 4BNJA 1JVBA 2WFZA 5EY5B 3VC1A 5JS1A 3T7AA 3E18A 3K72B 1E2KA 1KBZA 2B37A 3NEPX 5TRTA 3FSGA 4E15A 2JGEA 4CTJA 1KJWA 3EG9A 3I01M 4EF5A 2YCBA 2ZLBA 4DQVA 3PXAA 3WY9A 3WGUA 1XT6A 4LXYA 4OHRA 5E9AA 4CUZA 1Z4KA 1WCIB 4ZYUA 1H22A 4ETIA 3F2VA 2VZ8A 3LX6A 1WXFA 2OV3A 3LW8A 2QLJA 4I0WB 3G5MA 1X7ZB 2IZ5A 3NHJA 2FG7C 3VAZA 1Z5GA 5FAKA 4MRPA 4I4LA 3R6WA 1HM5A 1ENYA 4F3YA 4BNWA 1TZ2A 4PE5B 2QPTA 2MSKA 3PG5A 4J49A 2JZOA 4MJXA 2DT5A 3U81A 2CDBA 2IUSA 4Q4HB 3WADA 2BGGA 2FWJA 2ZBUA 1W5TA 3CR3C 1BROA 4R31A 4P83A 2WHRA 1D2HA 3T1VA 4S04A 1XROA 4G41A 1M5UA 2IXEA 4RD2A 4UE6A 4X64B 2CY0A 3BFKA 1UXGA 3I0MA 2G9RA 3UATA 3ISTA 5B58T 3QIAA 4YQFA 4HNUA 2BPOA 2HK9A 2VR1A 4V0KA 4ZVPA 5JCOA 3OOYA 1C4WA 3I34X 1UDCA 3PGA1 1VE5A 1XTVA 3QMPA 1DG9A 4UAJA 2Y0BA 3V7NA 3EQ6A 1RKUA 1X0XA 4PIMA 5DK6A 4QYXA 1QQAA 4JMLA 4CQMA 1Z38A 3N8NA 3ZK8A 5A06A 1RJWA 4U39A 1SXPA 2ZSDA 3VC3A 4JOSA 2BFFB 4R8RA 1H9AA 1YE3A 2OV8A 4LPKA 3PBKA 1LC3A 3C4QA 3PUXA 4L85A 4QULA 1GUAA 3O8OB 4CQNA 3IDSA 1NUHA 3CEMA 4NF2A 4HVLA 1L4YA 1GGHA 4L6IA 4LZNA 1HNWB 1FLNA 4NU6A 3BJIC 2OMKA 2XCOA 1RWWA 3FUCA 4LMAA 2HTFA 3FPFA 1W47A 1CQIA 2HPVA 3MG9A 4FE3A 3ZW9A 1BX0A 2VEDA 2VJOA 3EFBA 3HYSA 2O3RA 4ZEXA 1XRSB 2BWJA 1A77A 2QF7A 2Y1LA 3GARA 4PYRA 3WOVA 2OUIA 5ITVA 3LVRE 4G4SO 4RQTA 121PA 2AR9A 1ZM3A 1G3MA 3N53A 5H0IA 5K2OA 4MEJA 4MQ5A 3PYMA 2GBIA 2X8JA 2I2BA 3A2MA 1H23A 2HLDD 2FQXA 1KKMA 4W8HA 4MV4A 3MW8A 4WADA 2O7SA 3P32A 4JLBA 4B83A 5DI3B 5CA1F 1DOHA 1ZH8A 4ZYWA 4KPFC 1U94A 2AQIA 1P8JA 4PVCA 2WYUA 3HVHA 3VO1A 2QZ9A 3MBOA 5G40A 2IIVA 1NVVQ 4QEKA 3W2EA 3L0IB 4JEHA 5AK3A 5B6JA 5HRUA 5HS6A 4RVHA 2H92A 2YICA 2IHJA 5EQTA 1IN4A 1UAGA 4GZ3A 2JG3A 3SYLA 4JJFA 2VTBA 4QO8A 4J0IA 4MUBA 4L4ZA 2PSHA 1A8IA 1YS6A 1V96A 2B98A 1L3CA 1ZOSA 3IPXA 4HQ0A 5HVNA 2G2SA 3MWJA 4BMNA 2EFDB 4IBOA 5LLDA 3IUBA 4H1UA 1ZN8A 1M2WA 2ZOSA 2V6GA 4M76B 5G02A 4BNHA 1K7CA 2W2TA 3RVLA 3UMVA 4WLEA 1PGNA 1GTVA 2J46A 5TQ2B 2X9VA 5J4VA 3NOVA 3IP7A 2EVWX 1PX0A 3TIFA 5BWNA 4P84A 5DM2A 3L1KA 1ZHFA 4D97A 4RMNA 3UOAB 3I5MA 2RHDA 2OCKA 3EVGA 1TRKA 4RTJA 1EUDB 2V98A 1UC9A 1B2LA 1VSVA 2VJCA 1JKJB 1J23A 4C4TA 2FEXA 5JANA 5C4MA 3H5VA 3OMLA 4M1TA 3R9IA 1IHOA 4FKZA 4EI8A 5GIOE 1M2JA 4LDZA 3FDFA 1JHZA 1Q0SA 2OOSA 3NM6B 2H51A 2AKAB 1SRQA 1OAOA 3KLNA 2JANA 3M83A 4LZJA 2RARA 4TTQA 4U7FA 2VDWA 3WGQA 4FB4A 4MRMA 3IKTA 1KZGB 1HTBA 1Z56C 5A7HA 5T4BA 3FOEC 2VS1A 1UBMS 1DUIA 1QFJA 4DBLC 3OT5A 2YQ4A 4UUBA 4OJTA 2DFTA 4B2YA 3L7DA 5AVXA 1RVDA 1NMQA 2GVNA 2APJA 3P20A 4QUIA 5J63A 5BV8A 2YHIA 4NOMA 3CF2A 4FJ2A 3I9JA 2GXAA 1PEYA 1CZKA 5F4BA 1GOTA 1XVUA 1IBRA 2IK8A 3A6JA 4R40A 2II6A 4JLPA 3UGQA 3WTCA 4IEFB 3ZYCA 4BEVA 4Q1FA 3E8SA 2Q3LA 2FW6A 1IUOA 1FU4A 3HP4A 3QHPA 3AERA 4RHCA 4U7WA 3MUOA 3EBOA 4IO1A 1IHDA 3FKSD 4KMSA 4V0QA 3G2LA 2GZSA 4BZXA 4NOLA 4JZKA 2FMFA 2OXRA 1XZAA 2YFYA 4O4LA 2H63A 5H4HA 1K06A 4BECA 5HPYB 3UJNA 5KYYA 1QAQA 5J5VA 2Y05A 2IRWA 4G67A 4OHPA 1JR2A 3EISA 4F8JA 1QB7A 1U28C 1TEHA 2OFWA 5MN4A 3V8VA 4MW5A 3GT4A 2H4JA 1DTWB 4TQ9A 1Q0HA 2IW1A 4CYMA 4Q4CA 5JSYA 1LBEA 3TAXA 2YX1A 3ROPA 2R8OA 1ODCA 4J16A 4G0MA 3S2ZA 5T4EA 5EJ9A 1WXXA 2J6BA 1SVNA 4YMSA 3VYVA 5LYJF 3DHVA 1U6JA 4AJNA 4Y6LA 4FU0A 4BMDA 4FS8A 1ZSYA 2OVFA 2O8DA 2O19A 3T9FA 3MFQA 2Z9DA 3FCYA 1SXJD 4OI0A 1V26A 2ZYDA 4E32A 1FL9A 1MRNA 1H65A 2NV0A 1I7LA 4P5PA 5IVHA 2Q3DA 3D2LA 1XA4A 4MGZR 2B0CA 4MW1A 4YP9A 4EHDA 3Q0TA 3H1BA 3WGTA 1UBEA 5LCXA 2ZIWB 3HB7A 4MV1A 1J8FA 1JU4A 2BFCB 3F5DA 5CDSA 4XLLA 1NC3A 2H0RA 2R66A 5KJCA 4O4JF 3P96A 2DY1A 3OCZA 3I5YA 1QV9A 3BD7A 3DXFA 3ITNA 4GLLA 2VDVE 3Q7QA 1G5IA 5K45A 2I4NA 1EGHA 2GD0A 1C29B 4PVDA 1B76A 4QJ3A 2ORWA 3E7WA 5F23A 2BTOA 1SXGA 2V54A 3NGXA 2H6EA 3SDSA 4QRDA 2JAOA 4YRCA 5AVSA 1B16A 3GCZA 4JL6A 3C6MA 4AZ0A 3V33A 1EAYA 3IQDB 1MNQA 4G5FA 4UMDA 1NC1A 4F3CA 2H07A 3RV3A 3RADC 1U1IA 3EC7A 1QR6A 2X0KA 1U31A 3RUHA 4BNXA 1LPBB 3DFMA 3RUIA 4Z0HO 1P73A 4GMGA 3A9WA 4I1IA 2X3YA 4PTZA 1ZMRA 3KKMA 4LTNA 5JOQA 2ACEA 1FUKA 2BP7B 2OCIA 1RCUA 4CTMA 1W2HA 2B4RO 2ZETA 1TJYA 4F04A 4JROA 3MT9A 2F8TA 1Q7TA 3RVOA 2BJHA 4LA4A 2J7PA 3SZMA 3KWLA 3A26A 5DX1A 4G81A 4N6GA 5EERA 1KYZA 2ZSUA 4Q9JA 1D8AA 8GPBA 3B8EA 5ECGC 2Q8NA 3OE5A 2B21A 2KPOA 4IWNA 3VRHA 4UM9B 4A7PA 2ENUA 2YWBA 3LRPA 5K9ZA 3USZA 1MOQA 1A8UA 1Y9AA 2ZU6A 5H83A 3GMSA 1BWRA 1YC5A 2E5WA 4IIJA 4JBXA 4OV6B 1NMXA 2AC2A 3WOHA 1YZKA 4ZAGA 1NBWB 2WG1A 3FPAA 4JVNA 4ER7A 4HZUA 1H2RS 1MO6A 1XPUA 2PUGA 3ZDBA 2NO7A 3TVTA 2ID8A 4Q9NA 1PFKA 4HEQA 4CIDA 1CNEA 1K0UA 4EECA 1M5TA 1JLMA 1UK7A 3AVQA 1BGXT 3D0KA 3IAEA 3M2TA 5I8ZA 2PM8A 2P6UA 5CVUA 2YFKA 2C3PA 3LQYA 4Z1MA 2EWMA 1XVTA 4RPJA 1YKSA 2IYNA 3S2EA 1NBAA 1FVXA 4PEVA 2GCOA 2HHAA 3VU8A 1V1RA 1R27A 3OQOA 4BV8A 5COAA 1LPAB 3IALA 3UV6A 1TK2A 1QS0B 4O4HB 1T1IA 3L07A 3BXPA 2IF2A 4Q34A 4RBNA 5AM0A 3VA7A 4OP1A 1DBPA 1TLTA 5GY7A 1B2RA 3I23A 4AP5A 1UMBB 2YMPA 4JGIA 5GINE 4D9EA 3LDGA 3VZCA 3LK6A 3ZWCA 2HDOA 5DN6D 1PVVA 1ESZA 3SYRA 5KVCA 2DEUA 2GN4A 5JWOA 4NMWA 2IUTA 3TUIC 5KQMA 3L0PA 3DLBA 1QBGA 3E1GA 1C50A 3JTMA 3P9CA 3KQHA 1YK1A 4D5GA 4J7UA 1GFZA 1XC7A 4JC8A 4MPJA 3C8HA 1AHHA 5EYPB 2OXTA 5F7ZA 3K2QA 3ZE1B 1ZJYA 2F4NA 2C77A 5LC1A 4DMLA 2PQ0A 3I73A 1R0CA 4RA9B 4AJLA 2I3GA 4EPWA 3QBEA 5AKIA 4YRKA 5DYGA 3MXTA 3DBRB 4C2TA 3QW2A 5I01A 5KO2A 2QAIA 4RS4A 5CNJA 1C0PA 3LQKA 4RZUA 1I4DD 4ZT5A 3BZBA 3H8WA 3L43A 1XZEA 3TI9A 1E3IA 2P35A 2AE2A 4PC3A 2Q5JA 3KLBA 4QUEA 3W6ZA 1R8JA 3RGWS 4KQMA 4YUWA 4MJ3A 1FBTA 2ZPAA 3L8EA 4RWZA 4HAVA 4DCUA 4JLSA 2QRZA 2BHLA 3AR4A 3OPMA 5DNVA 1ZESA 4JJ8A 2BRUC 1GKLA 2VNHA 4TV8B 1HT2E 2QNRA 4A6DA 5H59A 3FSJX 2ZXFA 3FYHA 4MMZB 4QDOA 4DL9A 5DBEX 4U00A 4PX2A 3L5KA 2I03A 3OQJA 4Q01A 1QNFA 1H2BA 3MK31 4TQUS 1K0FA 4A0FA 1QIKA 1NOJA 2DQKA 1XP5A 5FWAA 1W5BA 1BQ4A 5AJWA 2FFAA 2LGJA 5JSQA 2W2XA 2WIGA 3KT6A 4A2QA 5HM6A 3RBVA 4FKMA 2UUCB 4FZ3A 3VH2A 2IOFA 2Q6IA 2OWEA 4HN2A 1JJAA 3W5IA 3NHUA 4HDAA 4O1MA 5LPNA 1XZLA 4EJ6A 1RM0A 2VTBB 3HEBA 1TCAA 3HA5A 4UDXX 4X54A 3LV8A 4CV3A 3K94A 3P2YA 4N5MA 4DDKA 1G21A 1I3CA 4IVNA 3A28A 3K5IA 3NAQA 2FN8A 4KJZA 3EZNA 1OBOA 4JLUA 3I32A 3KBOA 5EZYB 3KP1A 1LLQA 1UJNA 3UH1A 5CCXA 3X2FA 2ECFA 4C4PA 1SXJC 2WVGA 1BA3A 2Q5IA 3ZQ6A 1AO3A 4MH0R 2CZGA 2EERA 4LWQA 4WJZA 4BNGA 3AUYA 1PD1A 4WCVA 5CNIA 4NABA 3UYKA 4YV1A 3LPCA 1ML3A 3U7EB 4LOLA 5FL3A 3RVKA 3RS7A 2LV8A 4R5MA 4KQ1A 1D5CA 1Z6ZA 3T54A 3WLAA 4EW1A 4YP1A 3V9AA 4XGIA 1A5SB 5PGMA 5CA0F 2C0PA 3CISA 3RABA 4F4IA 1DV2A 1MZPA 2E4AA 4DLKA 3QLVA 1SCIA 5CT6A 4GX0A 4NFYA 1ORIA 2O6LA 2W6JD 2P4UA 3D0QA 4B3SB 1JAHA 4D81A 4E5NA 5JS8A 4LCEA 4PAQA 2IOHA 2JGKA 4E1AA 4FK8A 2AFIA 4YECA 3U5TA 3V8RA 1Z0KA 4PZ0A 2Q27A 5HUJA 2PZJA 1Q7RA 3GVCA 4GOOD 4BWFB 2XUKA 2ZSHA 4TT3A 4QTYA 1OFGA 1RR6A 4TKVB 3VKGA 3N2EA 4H31A 2HHLA 1BZYA 3FVVA 1T5HX 1LTQA 1VBNA 5E4YA 1T3ZA 1CS0A 3RC8A 1N8TA 2DBQA 1H6BA 3LD9A 3LGAA 1XEFA 2ZWPA 1JLRA 3GLFA 1B8UA 4QBHA 5T67A 4LPSA 2G5TA 4ZO6A 3CTPA 3OJCA 1AGRA 2KS6A 1Y4UA 2XCSB 1ZR4A 3ROXA 2IPAB 3AY3A 1C30B 1RS0A 3BKXA 5E1OA 3PNBA 3IVRA 3GDWA 4WKPA 5B7NA 5ENVA 4EENA 3H4IA 5IP5A 4NYMQ 4ESVA 2HBZA 3C15C 1WUYA 4CKBA 1XMOB 3CLSC 1EFVA 5SZKB 2HBRA 4MIYA 4C08A 4FZ5A 2FUG6 1W4AA 1R0XA 1IG0A 2PJRA 1QPBA 1TE2A 1CLEA 5JQWA 5FNVF 4F60A 4MQFA 2LVBA 2PR7A 3V4RA 2PDAA 4KLAA 3VNVA 3RIHA 4YMVA 4N3NA 3UPUA 4BNDB 3L4BA 2O8DB 1FXWF 1JHVA 2JFWA 2Q2VA 3AF2A 3GAFA 2NQTA 4NEGA 3W5CA 4RKEA 2WJJA 4Q48A 4JP1A 4Z3DA 4UNRA 3PQ2A 1MAHA 3I1JA 3GBSA 1ZNXA 3K4HA 4YROA 1IM2A 1L5ZA 4MA0A 4FMPA 4V0NA 4AXXA 2ZI6A 5IWCA 1CZNA 1Q6ZA 5JDCA 2YVUA 3ICOA 2FHSA 2KJQA 1L0BA 2YJNA 4PXSA 4BNIA 4FUQA 4IMPA 4TKZA 1VXOA 4IGKA 2H1IA 3FWZA 2FN7A 3G7UA 4RF5A 1Z5NA 1E9DA 1WV0A 1KC3A 2JBHA 3I8XA 3O7MA 4KP7A 3ROQA 1P6UA 4BUCA 3W6NA 4L8WB 4ZCMA 2HQRA 1M76A 4CR6A 1KEUA 1L4UA 2PGJA 2PKYX 4S24A 4URWR 2WZQA 3ROTA 3CURA 1E2LA 3GEHA 1L5WA 1PR1A 3ZWPA 3BOSA 1W49A 2YZNA 5EFOA 1DIHA 3SMQA 3T3OA 4MCAA 2R00A 4CKYA 3AFIA 4HXYA 3DULA 1CLUA 5DEIA 5EXTA 3QU9A 3TSYA 1DZIA 2FWRA 2VEOA 2XCIA 4WL0A 1ISPA 1HO3A 4Y2JA 3TCXB 2JLQA 5IABA 2C7QA 3COYA 5CR9A 1TUGA 3SLGA 5EP3A 3RROA 1D0IA 2ZROA 5C32A 2RGNC 3ENNA 4CT0A 2BUAA 3RDPA 3SDBA 3SEQA 2PMBA 4V3BA 4DA7A 3MBIA 3LE8A 4XPIB 2QYSA 4P3XA 3L6DA 2TYSB 1XKXA 1XPRA 2G0NA 4KXUA 3IAHA 2NACA 5I9LA 2JGNA 2IPNA 3JWEA 4WFKA 5LQUA 1FYDA 2XGSA 4B43A 4QGHA 2QXYA 2X5XA 2BZ1A 3H9CA 5JHGB 2INGX 3LT4A 1CR0A 3SKYA 3IBYA 4ODIA 1E6CA 4J3NA 2AEEA 5GJBA 2IEIA 5F2OA 3HYTA 1IFXA 2V5VA 2W8BA 4ZAXA 5BRNA 4RJKA 3O03A 3ZZNA 1MBZA 2XOEA 1TJ4A 1CEQA 1PE0A 3EDMA 2PFGA 3R1IA 3L0OA 2XHZA 1WY5A 1FRFS 4YGYA 1NQTA 1P18A 3GLGA 3C3EA 1ZYUA 3OM8A 4BQIA 4NOKA 3DC7A 1URPA 3ICCA 3FGOA 4IXWA 4ZIRA 4JL8A 4GVLA 4TLAA 2WJIA 2X3UA 1IDN1 1R8XA 2C4HA 2ZRHA 4IXDA 4L2IA 2PMDA 2QI9F 1Z63A 1UJCA 4M9SA 1G5PA 1B42A 2VF8A 3B5EA 5CLHA 5H4GA 2P77A 2QT0A 1YBHA 3JQ8A 2ZS9A 2EJCA 5KWEA 4XWYA 5LP6C 3LIPA 4C4YA 1EVIA 1K75A 2J9ZB 2ARKA 2R8YA 1JBKA 2WSIA 4E5MA 4FPXA 5HSGA 4MGHA 3DMNA 1RRFA 4FD3A 4N5LA 4WZBB 3WSTA 1A1SA 2C20A 2QPOA 3HM9A 1T5BA 4F7WA 4Q16A 1U2PA 1WDMA 3GFQA 3MUEA 2IYZA 3NBMA 1QYXA 4N0PA 2DYKA 3AL3A 4MQ6A 3E53A 2QLMA 3HVJA 3GJ3A 4Q1BA 3S28A 3U19A 1UZLA 3JQPA 5ITZB 2I0FA 3NM4A 1XRMA 3PNMA 1P4GA 4ND4A 2NIPA 2ADOA 2H4ZA 1FDTA 4LNHA 1JG6A 2H9YA 5H9VA 3GDHA 4CKWA 3HBAA 1XXHE 3QP9A 2HU8A 5F2EA 1KDVA 4MUJA 2HSZA 4D8UA 1GCUA 3FOAA 4F8YA 2GEJA 3MINB 4C1NA 2FRVA 2RI1A 4RORA 3ZDQA 1VL6A 5L7WA 2ERXA 3O8OA 1TKAA 1ULTA 3L8ZA 4C0KA 5ICSA 4BE9A 1W93A 2CDAA 1D4ZA 1XJCA 2QUBA 2ZQYA 4QPDA 2WABA 4W63A 5CFRA 3T1YB 4XE5A 5AKYA 4YRSA 5BVGB 1J97A 2J0VA 5E6UA 4PC6A 5CHEA 2CFSA 4PRKA 4UHBA 2RK4A 2WINI 1HXHA 3WBKA 3ZGVA 1F2UB 2D5CA 2A2ZA 3NDJA 3QFTA 2VQEB 3X0DA 1V37A 3EXHC 4DSNA 4AN0A 3OZUA 1N8SA 2D6FA 4YBRA 3UWMA 4MYTA 2VDMB 4CM7A 1F7VA 2AG0A 2EIXA 4O4IA 4BKPA 1NQAO 4L9WA 4YRJA 4Q3AA 4D96A 3JQDA 4CEHB 1NKSA 4O63O 2F64A 1U63A 4UARA 5ILQA 4PTYA 3ABSB 2K4MA 4DIOA 3ND6A 5AKXA 1MXHA 3FFWA 3ZU5A 4DB2A 2XMSA 3PFCA 1HETA 3AVWA 5BWBA 4Z7OB 3ZN2A 2NM0A 1Z0DA 2OHIA 5FL7D 4XOUA 5FOVA 2JEOA 2GM3A 2XE4A 3KCNA 1FP2A 1G291 1J8VA 2VUTA 2WAAA 1IMJA 4UOQA 3THRA 3TTYA 1NXOA 3MWEA 5F78A 3RT1A 4CMCA 2EL7A 3D1VA 2WOOA 3TMAA 4YMHA 1UANA 2GM5A 2QJWA 5EMKA 1KHTA 1KO7A 1S4QA 4V39A 3M5WA 1T0UA 2V7PA 2QWXA 3WLOA 1PLLA 3KO8A 4EHLA 3FNGA 1LBIA 5EMNA 3LA6A 3P9KA 2HQBA 3RIGA 3OQHA 2W9XA 1PGPA 4IJVA 4RXTA 5C8XA 2BGJA 2CF6A 2YV5A 1NYRA 3TQSA 3VPCA 2VHJA 3OI7A 1LDNA 1VMEA 3R5XA 2UYYA 2XI4A 3RHZA 3L7MA 2RIRA 1DBSA 1COWD 1QOPB 2D62A 4JLDA 4XGNA 2WWYA 1Z0UA 1WXHA 3Q0IA 4G8JA 1NV9A 4IGFA 3WYFA 3BXGA 4S3MA 4H3SA 1B6GA 3U9TA 1Z7GA 4C4SA 2IH2A 3MTEA 1REQB 2CJWA 2ZIEA 2XA9A 5F2KA 2FP3A 1J2YA 1PLJA 2FB9A 3TQFA 2H0AA 5JJKA 2XZPA 1NATA 3E1KA 3NW9A 4HWPA 1K6MA 3KC2A 3KFXA 4A23A 4PYIA 2O2JA 2BEUA 4OREX 5KOHA 1OAOC 1BMDA 5EXPA 3W2IA 2R1VA 1L1QA 4XB6B 3LY5A 4UHEA 4C3OB 5BNWA 4MUKA 1P72A 3DDZX 4UU0A 2O0LA 3AVOA 4QC2A 1BVHA 2AZTA 3FCEA 5E95A 1JQ3A 1TJPB 4CT4B 5FT9A 2HU2A 4BMPB 1YJBA 4HGZA 2P5UA 4OXXA 4TMZA 1ZM7A 3GJYA 5DNDA 3UANA 4IGAA 3MTIA 3DM9B 2VC2B 4JSTA 1YTUA 2IY8A 1E63A 1N0VC 4XQ9A 1T2DA 2ZATA 3TOSA 1W85A 2CL7X 1ODTC 4CR7A 2HY7A 5EESA 1YC2A 1M73E 2OQRA 3R3JA 4NS1A 5F1OA 5B53A 2C57A 3DBHB 1ZUNA 5BR1A 2DR2A 3B53X 5DYWA 1TYDE 3GPBA 4NV3A 1TGYA 3O3NB 3ADPA 2V0NA 4EA8A 4EABA 3C85A 4KSCA 2WLSA 1ECBA 1UFKA 3NVKI 1KS2A 3HHEA 3KE8A 3TW8B 4RHXA 2AMLA 1ZZEA 2QN2A 5ARBA 2O0JA 5AVTA 5AW8A 1P4AA 2EJBA 4FDAA 4B7UA 4AUMA 5B6PA 4XVUA 4K6MA 3YASA 2VF5X 3TSZA 2XJ9A 5GM1A 1FTSA 2BJWA 3D8UA 5ALFA 2YNMA 4GPTA 4ZC1A 3NU1A 4IH4A 3WIOA 4BQPA 1LBHA 2ATVA 2YYYA 3HDJA 3EODA 1NQWA 1GNSA 3U44A 2WHQA 4L4RA 4MVJF 3ZX4A 2Y1XA 5HF5A 1DRWA 1SA0A 1YQGA 1ZZGA 4UFPA 4YMTA 3LW7A 4JT8A 2JI7A 3VSCA 4R69A 3RS4A 4JJKA 5ER6A 4ND3A 4IWYA 4ZJPA 4W5NA 1DQZA 4FCWA 4MYRA 3K6SA 2GWHA 3I2GA 2BFEA 4REMA 4UNQA 3R6GA 1SCDA 4ZP1A 4H2DA 3RSFA 4ZVSA 2R6HA 4WERA 2CBZA 3KUKA 4AX4A 4KIFA 1TA9A 4L22A 1UR5A 1HK7A 2PGAA 1GZ5A 3H8JA 2CHUA 3ZE7A 3TRDA 5K3EA 3GVXA 1H94A 3FF1A 1XWWA 1DAOA 1K5GA 4JFAA 5EWJA 4OH7A 3WJ2A 3BSFA 3DVAA 1JR3A 2BD0A 4X1IB 3FMPB 3U39A 1NX6A 2F9FA 2W22A 3EEOA 4JP3A 4LK2A 4PQGA 3WLEA 1NZFA 1PJ8A 2JHGA 2UUBB 5A4KA 1N3LA 1VKNA 1U7WA 4RZ3A 1T1SA 1CUFA 1PUJA 4U0JA 3GJ0A 4P53A 2ETXA 2WFMA 2GBGA 2QTLA 1ST2A 3KV3O 3IOEA 2IYAA 3KPJA 4S1PA 3W2GA 1T3LA 3QUSA 2XYVA 2ZYTX 1HH4A 3V55A 5JDIA 3THXB 3NP9A 1RPZA 2WI8A 2R5NA 2C31A 3VU3A 2WJYA 4I36A 1YKGA 4HRYA 1DX4A 3LWBA 4BEWA 3OIWA 4R71A 3I83A 3U62A 4XAQA 2DUWA 1VLLA 1W1WA 1EEHA 2IYQA 2O23A 2P8JA 5J40A 2G09A 3EX7C 3LKVA 3RTBA 3X1YA 1VL2A 1WQ4A 1G7RA 1JYFA 4PBRA 2F90A 5EJ6A 4UULA 3DGFC 5LYJA 1GT6A 1DGQA 1GRRA 1EHIA 1DCTA 2IYPA 3QOYA 2EW1A 4BHRA 1Q20A 3WL6A 4DANA 4LMBA 1J8YF 4EW3A 5SZIA 3HCBA 1Z22A 3CX6A 3GFOA 2CFOA 2DUMA 1HR0B 2JGJA 2QW0X 4HAYA 1J0XO 1LPPA 1NF8A 4A0RA 2O2ZA 3K6JA 4OB7A 3F4LA 4YTEA 1D2RA 2YWGA 4RJIA 3RE1A 3B6EA 5IJ0B 2RAFA 1JW9B 2AFHA 5CJ2A 1FFCA 4BFCA 3A6GA 4UJ5A 2BOVA 5LKAA 1Q7GA 3F74A 3MF4A 2OY0A 3QKTA 1P9LA 4RCYA 2QW1A 3MPUA 4EMBA 4BMCA 3AVVA 4OPMA 1Q0PA 1EDOA 2DPHA 3GUCA 1Z4NA 2EFEB 4ZVNA 2P3OA 2KW5A 4LRXA 2VRNA 4JA0A 3MFYA 5LXTF 5BSVA 2H85A 1XRNA 4H6VA 1UDBA 3NGLA 4NAVA 2ZJ5A 5GOTA 3ZVKA 4Q6BA 4YWJA 1P4HA 3VHQA 1LI7A 3MCWA 3LOQA 1P9OA 4HF7A 3QQPA 3L8YA 1A76A 2V65A 3CNQS 3N8IA 3WVNA 1MJGA 2O1XA 2WWTA 5EPOA 3LUJA 4CM4B 5EVJA 3R3HA 3OC6A 3EG5A 5JDCC 3TBFA 3V8PA 3HV2A 3RWMB 1T5TA 4JXKA 3A2NA 1YZQA 4NE2A 3UA4A 3H2GA 2ACWA 2ISSD 3C98A 5DFAA 5E6SB 4NG5A 1O8CA 4KQCA 1KYYA 2PZEA 5FO0A 4ENWA 3SR3A 3MB5A 2B3TA 3C3BA 3HDGA 3USES 4GRAA 2GN6A 3PFIA 1KO5A 1J07A 5TGZA 3T4EA 2DETA 4GKKB 3HB0A 1VLHA 3WR5A 2QVLA 5LQMA 2DPYA 1JFSA 2QRGA 4BV9A 3GQVA 3RK1A 4FQ7A 5MDHA 2VP9A 4K9QA 2XD9A 3T7CA 5KQGA 2NXEA 2ID7A 2RH9B 1CS4C 3OE4A 2WWWA 1WHSA 2Q1WA 4ND6A 1IXKA 1O0SA 4Y2UA 5E6UB 1ZI9A 3EF0A 4DJAA 5CFQA 3U60B 2AX3A 1DMRA 1YOBA 4GG1A 2Z2IA 2X13A 1SC4A 5CHYA 5DGIA 4BEJA 1I9CA 3R7BA 2FPKA 2Z95A 2M6KA 4GMFA 2DKNA 3C6XA 1T24A 3LWZA 1WE2A 4MCIA 2FG6C 2GPJA 3WYBA 5CVJA 5CIYA 3CPSA 5B7PA 1Q83A 4HH1A 1N4AA 2NZUG 3ONVA 3F6PA 4AYWA 4ZYYA 2OG2A 3L8GA 1CEYA 3CR8A 1Z4JA 4DDUA 4OMCA 2QDKA 4HYTA 4I7EA 1G6KA 3ZLVA 4GYWA 4IHKA 2OV2A 3VTKA 3WMXA 1THZA 1QKJA 3DPIA 4DG9A 1IZ8A 1JU9A 3O84A 4N5DA 3R9XB 2QROA 4GZLA 4ZQHA 3KJFA 3T52A 2QRUA 2XUDA 2XBMA 3H6GA 2OEPA 2JFXA 4CEJB 1SOAA 1OZGA 3W04A 5FR1A 2NUTA 4KFSA 3U0VA 4XWKA 4RTOA 1BMFD 3HM2A 3IAM6 4US1R 4QVGA 1IL0A 1UJ5A 2OGWA 2FMKA 5IMSA 3RJZA 2FFRA 3F6RA 1LQTA 1L1EA 2IWRA 4BVEA 3C1OA 3F5SA 1PJQA 2K2WA 1I30A 5TF4A 1E9SA 3QPWA 1A9PA 3TKAA 2CVPA 1P0FA 4YRGA 3BORA 3TRFA 2D1TA 1R18A 4LHXA 5JPCA 1IOLA 4RVFA 3CI0K 1PV2A 1YBVA 3VVMA 2OHJA 1N4DA 2A4MA 1U2SA 1X6VA 4FOOA 4QAJA 2YMLA 4BRUA 5JH7F 1WHTA 4XYGA 4H1TA 3SFTA 4I9NA 1D1PA 3QEMA 4WZAE 3UC5A 3VPHA 1J8MF 3LC0A 1T26A 1QTQA 3R0IA 2VATA 4FGUA 3W3AA 1YFZA 5I7HA 3H9UA 4CHGA 1E89A 3RSLA 4FYPA 4B6GA 2ZJ6A 3GLHB 4Q0MA 4Q4JA 4C78A 3AF0A 3ZHQA 1R6TA 1QV6A 3KR0A 3EW7A 1DRKA 4HZIA 2B36A 4U7HA 1FP6A 1MIHA 1RKXA 4C03A 4E08A 2SICE 3ICVA 2IZ7A 2BVNA 2BZ0A 2X8AA 1JNYA 3H5NA 4IOJA 5IMBA 1FNNA 1QGAA 3QVTA 3T3MB 2PUDA 1PT8A 2JIZD 4JV5B 2P9JA 2FMTA 3W79A 3D2CA 3L4SO 2KM1A 4K9KA 1PIWA 1G66A 1POXA 5H3CA 1XO1A 3TWOA 3WHPA 1GPNA 3Q6NA 1G60A 4ZWNA 1PJTA 3WK9A 5G2FA 3GN2A 1JTFA 1UPFA 1YVRA 2Z3WA 3B1ZA 1WF3A 1ZO8A 3M2PA 4TTTS 5BO5A 4AVYA 5DHTA 2P79A 4GKBA 2YMMA 3ZCSA 2VYVA 3HZZA 3UFXA 2EYQA 1E4OA 4Q9AA 5AICA 3HI4A 3GLIB 1NWCA 1QZTA 2IVFA 5BN4A 4QM6A 5KYKA 3EJWA 5LJLA 2X7XA 2BKVA 2IP4A 4FNOA 1F8GA 2XYRA 2OLJA 1I6WA 3KDAA 5I7VA 4JSRA 3MILA 2FUKA 3FHLA 2D1FA 3FBTA 3ADDA 3BRSA 1DRJA 1QNLA 1MX1A 1L7MA 1K97A 3MGBA 5B3LA 1CVIA 1DZ3A 1RHMA 3HJHA 4B4WA 2I7VA 4TTRA 4XUGB 1T0PA 3K8QA 4J90A 4Z8XA 2Q7OE 1EUYA 3AP3A 2R62A 3R7WB 1LLUA 2UAGA 4EELA 4KOAA 4XWAA 4LW8A 1F0NA 1KK0A 3FSRA 5K3SA 1TZJA 3LF2A 1JHDA 2H4WA 3GJQA 4XSHA 4YLEA 4FFBA 1U0BB 3ZDEA 2G1AA 3BICA 3E0XA 4X8MA 3R6LA 1AA6A 3EEFA 4ZRDA 1U8XX 1JDBC 2H1CA 3M81A 1LDYA 2IZ0A 3KKEA 3E9RA 1L5LA 2MYPA 5CT8A 2WM2A 1RXIA 1QUEA 5FLYA 3WWYA 2Y9PB 5TVGA 4P36A 4B73A 2AXEA 1F4PA 5K03A 1N0WA 5LOVA 4OB6A 3BMQB 5C8YB 1I4LD 3HB9A 2LBPA 3FCUB 4P3YA 1JLLA 4CL8A 5JQGA 5BWCA 2RONA 1X8JA 4KN8A 5CA0A 4QZVA 3FGPA 2TMDA 1WAMA 5JD4A 1KR2A 1F6DA 1KTVA 2RMKA 4XOIA 4B79A 4F46A 5CGQB 3KX2A 4BQRA 4N5HX 4OQYA 1ZQ1A 5B3KA 2VZ0A 4YVFA 3LUCA 4QUHA 5EWLA 3BH7A 1KMMA 2VK8A 4C89A 2B99A 4L0CA 1X1BA 1HQCA 2BE7A 3OIDA 4MWOA 3LUFA 1FMTA 5EGSA 1NDHA 4A6XA 1SA0B 2PUVA 1KI6B 2GJ4A 2XMRA 3JW8A 4XASA 3TLJA 2HPAA 5L7TA 4DB4A 2SKDA 3FD8A 3TK1A 1J20A 1WXGA 3L77A 5K51A 3TKYA 4H4EA 5ALZA 2BMWA 5H3HA 1AB6A 4ZZ2A 4CMAA 5B64A 3TNJA 4IS3A 1ISHA 5JYBA 4XD7D 3ID6C 1BS1A 5LZ8A 1WSDA 4AMBA 4S05A 4PIVA 5BQPA 2CJFA 4M0MA 1N7HA 3M1YA 3RVSA 2POQX 3WK5A 6ABPA 4DLAA 2JIPA 1I2MA 2QRKA 3R7DA 4GXNA 3QLEA 3BBPA 2HF7A 5TPWA 3IOCA 3V00A 1XCPA 2SKEA 4AJJA 5BN4B 3JSAA 1NFRA 2VSQA 2EOAA 3G23A 3IS3A 1SBZA 2QK4A 1KDOA 1T9AA 4HS9A 1FC0A 2RAPA 3DLHA 4BMYA 1ZONA 4JT9A 1V43A 1QQ6A 3M5DA 4N12A 3L4EA 4GI5A 3TIXB 2BIFA 2DLDA 1AF7A 2I76A 3BXZA 3QVXA 1JXQA 5CBKA 3NT5A 1AS0A 4AJEA 3K2IA 1KY4A 1AG9A 3FFXA 1KMCA 2CLLB 2GK6A 1TM4E 1E61A 4YX9A 1Z6PA 3ABIA 5C1OA 3B7WA 4FGSA 3GEIA 3KR2A 3KOYA 3H8SA 2A14A 4JBGA 5L7YA 4ZI5A 4I2NA 2RETA 1G7TA 2BCEA 2Q1UA 2Z43A 1YXMA 1IM5A 2JLCA 3NDIA 1GCGA 5SY4A 5KS2A 1FDVA 2IITA 1QB8A 3EGOA 2O8CB 2YHIB 2IE8A 4BWVA 4CLRA 1GZSA 1Z83A 3MJEA 1AUQA 1LSOA 4UHJA 4FN5A 5IYZB 4DT1B 2WIFA 2REQB 3T5TA 5TE9A 4RJLA 4DYDA 2NU8A 1PI3A 2CHVA 3K0BA 1MGOA 1U0EA 2CXHA 2DVMA 3B6ZA 4JI5B 4M4SA 5FIUA 2QVGA 3E9ZA 2ZRDA 3CW9A 2R00C 4NBNA 4P9NA 4RD0A 1QDEA 4CDRA 5HMMA 4M7RA 3UCFA 4FZRA 1QYDA 4DGSA 2R4TA 2VTDA 1U9CA 3E9QA 4FHGA 4GHWA 1G19A 2D2EA 1RHQA 1Y4DE 4FDTA 1Q16A 3OOEA 1J9GA 3CNEA 4DR4B 1RKQA 3O93A 3AR7A 1UWVA 2FHPA 3OUTA 1BXRA 2RIPA 3V1MA 4ABTA 1QGYA 2VCYA 3GGPA 1J2TA 3MQFA 5EWLB 1NBME 4RHFA 4PX5A 1NM5C 1Z6AA 1WU8A 2HGSA 3DE7X 3M34A 2IYSA 4IIFA 1GL7A 2YWRA 3BQ9A 2B9EA 1ZG3A 3IERA 4RKFA 3UJ3X 1OMOA 2XNJA 5FEUA 4XEHA 2BFWA 2PSDA 1KH1A 4XUEA 1QE5A 3E82A 1SCUA 5AVOA 1VBKA 2YXNA 4N6NA 3KR9A 4QBFA 1Y6JA 3D4IA 3NYWA 3PHCA 4XD2A 2H2IA 4C2BA 2C1XA 4P86A 2I1LA 5LSAA 5D7BA 3VX4A 3NMUF 4YUXA 1DAGA 4NSNA 2ZK7A 3GPCA 4ZQFA 2WV9A 2PUTA 4ZT4A 1W0JA 2C9BA 2YOFA 4F38A 2R86A 2RJNA 1RPTA 2ZSIA 4G2NA 1XV5A 2CLSA 5ELMA 2PSJA 3QMWA 1HTWA 4RESA 1RYZA 2DWQA 4GDMA 5EZSA 3GWGA 4C0JA 1NZJA 2B7CA 2G9VA 4IZ6A 2NPOA 2NO4A 3R7SA 2VA8A 3VR2D 4F2GA 4NNJA 3V4FA 4AJKA 4IAOA 2J32A 1U02A 1HDZA 2BR3A 3KQQA 4Q12A 3R3XA 2WDPA 4TRMA 2HWXA 5JYCA 4AM8A 4EG3A 1KOGA 2QD3A 4Y2HA 3A1FA 5JAZA 2UZ3A 1K9SA 2E85A 3KUCA 1PX2A 2WSBA 1AU9A 2F1HA 1SVKA 3NORA 3GGDA 4KGZA 5C52B 3O9VA 4LVCA 3E84A 2X6RA 2IT1A 3DE5X 2W11A 1Z37A 4Q4AB 4MB2A 2O2XA 4IHQA 4WKNA 1FFDA 4NU0A 1UMDB 2G6TA 3H9QA 3KWMA 4YGXB 10MHA 2BI7A 4WINA 2CMGA 1J4AA 1GUFA 3KB6A 1VA5A 3ZGZA 4KAFA 1SD2A 4CV1A 3WLHA 1ECCA 3WDMA 2A9VA 1AXEA 3KAJA 3NI2A 2YZ7A 3EDQA 4LDNA 4AO7A 3AHJA 1DLJA 1U99A 2PNJA 5KTSA 4GQAA 3EMDA 3PRYA 3I64A 3FOBA 1Z73A 1N25A 2B6NA 2D1RA 4Q4HA 3WGYA 4YO7A 5FBWB 3IE1A 1U1EA 3PP8A 1DO0A 4PTLA 1TVMA 1LQ2A 1XQ1A 4IINA 3DQZA 4ZICA 4EY8A 3G5TA 1IIBA 5TT0A 4UFOA 1QH8B 2D8MA 4W5HA 5KU1A 1O0BA 1Z2AA 3M33A 3A9UA 2DFLA 3UB4A 3P94A 4LBVA 4R9SA 1ZPDA 3KQSA 2Q7DA 2XT9A 1FMFA 4PC2A 5HKLA 3CFHL 2F8SA 3OKFA 1JEAA 1YRQA 1Z26A 2HJ9A 2JATA 2PT9A 3EDOA 3F3KA 3LJKA 4HQLA 1DSSG 2PAAA 4D80A 1F0KA 5HKKD 1RQNA 4DA4A 1MOZA 2HQ1A 2O2DA 3WYEA 5DTEA 3K0HA 1B0PA 5JECA 1RTKA 2JKYA 1KFCB 3RHTA 4W1PA 1QJ4A 3F90A 3ZH9B 3MOSA 1I0ZA 4DC9A 4G84A 1BVYF 2PZGA 3AI1A 3HUFA 4BZPA 4BGDA 4DABA 3D4NA 2Q0SA 1SKAA 2G6BA 1EI9A 1E4VA 2I2CA 4FYIA 3RYTC 3HU3A 5JR3A 1JI0A 2OPBA 1E2IA 4WGGA 3RTGA 4EY6A 3IBFA 1FQWA 4TVBA 4AY5A 1V5EA 3VR4D 4EVQA 3PQ6A 5EJ4A 2GKGA 3DB2A 3BE4A 1D3AA 3DZGA 3FPBA 1ZK1A 1EPUA 1T2NA 2QP4A 2Z08A 3DLPX 3F98A 1C81A 3JRNA 4IOMA 4X8LA 4HNTA 2G16A 3D3JA 1JQJC 1SUAA 2QTNA 3Q3VA 4NBVA 4WOCA 3W5DA