3LE8A

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.70 angstrom resolution in complex with 2-(2-((benzofuran-2-carboxamido)methyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
287
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLASSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of the interligand overhauser effect for fragment linking: application to inhibitor discovery against Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 101
structure length 287
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3le8A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3le8A01
1NUQA 2IJGX 3FETA 3ND7A 4XFJA 1TEZA 1KH1A 3INNA 1PG2A 3UMVA 2A1UB 1IQRA 2V0CA 2QJFA 3FIUA 3HMQA 1P7PA 1O94C 3TZEA 2PFSA 4MW0A 2Z3VA 3PRHA 1MOPA 3AG5A 3G6KA 4MVWA 4MVYA 3N05A 3CLSD 4CQNA 1QRTA 2DETA 4H3SA 4L2IB 4F4HA 3OTWA 2CSXA 2AZXA 5HUJA 1I2DA 4Q16A 4QBTA 3IOCA 2VTBB 4YP7A 4TS1A 2DR2A 3KFLA 1U3CA 4YBRA 1O97D 1M8KA 4EG6A 5J5AA 4MAFA 1WXFA 3X1KA 1O5TA 4ZCSA 3CLUD 2D5BA 2PG3A 4EG4A 3IDFA 4U8HA 4F3RA 1WY5A 4DNXA 1COZA 1IQUA 1M1ZA 3ZUGA 4ZCQA 1N2GA 1J70A 2H2AA 3MXTA 4RUKA 3UC5A 1EJ2A 3HFJA 4CT0A 3X1JA 3H99A 4MQ6A 1YUNA 2QTNA 2YY5A 1WQ3A 1MC1A 1KP3A 3FH0A 4EG5A 3CVXA 2BYTA 2ZUEA 1V8FA 1M8GA 3RK1A 3CVUA 1ZH6A 3FWKA 1J09A 3ZJVA 1EUQA 1G8GA 1OWOA 3JXEA 5HG0A 4OUDB 2I1LA 1MB2A 1EFPA 3IVGA 1WQ4A 1PFWA 1KKUA 3IOEA 2E18A 3SEZA 2PZAA 4YP6A 1EFPB 1GPMA 1CT9A 4NAHA 2PZ8A 1M8PA 3PNVA 4EG3A 1G8HA 2CYAA 4DDMA 4PBSA 5FNZA 4XSVA 5DEOA 1QU2A 3CLSC 1MAUA 3H05A 3SEQA 3P52A 4KKVA 1N2HA 3FOCA 1JZQA 4KPUB 2R5WA 3FNRA 4U7JA 1ILEA 1DNPA 1KORA 1QTQA 2CFOA 3D6UA 1J1UA 4QREA 1N2JA 1OWNA 1O97C 1NP7A 4I6EA 1QJCA 1K4KA 1WXGA 1OBCA 1K4MA 1GTRA 3CLUC 5TEVA 4PBRA 1IQ0A 3G5AA 2D54A 1I6MA 3SZGA 4XFDA 3K9WA 4JZYA 4YP5A 4Q93A 5IJXA 1N75A 2YWBA 4UZEA 3CLTD 1JIIA 5K0TA 1O96B 1N2EA 3COZA 4DE5A 4EG1A 4ZT2A 1ZH0A 2IP1A 2DLCX 1V47A 3SZ3A 1TFUA 4MWCA 3KT0A 4ZT7A 2DPLA 5KWVA 1YULA 1S4MA 4I6JA 4EG8A 1WXEA 3QTBA 4MWBA 1WXIA 1TYCA 2A1UA 3LCJA 3RBAA 2G36A 3S3TA 4MWDA 1A8HA 3ND6A 4ZCPA 2GKSA 5TEWA 1IH8A 3F3MA 1JILA 4ZCRA 4OJMX 2A1TR 3KT6A 2E0IA 1TYAE 5EKDA 1OWMA 4L2IA 1U3DA 1KAMA 2NZ2A 1X6VA 4MUEA 2A88A 4MUJA 1VBMA 2VTBA 3UOWA 1TQ8A 2QJTA 2QUHA 4I6GA 1JGTA 4KR6A 1MRZA 3Q10A 4DDKA 1NI5A 2WQ7A 1N77A 5LM3A 1XNGA 1U0BB 5HUHA 2C5SA 2CV1A 2J5BA 4PBTA 3ISJA 3DV2A 2AKEA 2V0GA 1XNJA 3Q4GA 1Q77A 1Q19A 1R6UA 1PFVA 1Q15A 4ARIA 3U1VA 1GTSA 5KHAA 1B6TA 3L92A 1IFXA 3PXUA 1NUUA 1VBNA 1WJGA 1FFYA 2D13A 1MJHA 2WB2A 1O95C 5F23A 2DUMA 3D6VA 2X1MA 1OWPA 1OD6A 3M5WA 3E27A 1YIAA 2DEUA 1F7UA 4EG7A 4MWEA 4RPIA 3H9CA 3MMXA 5AHWA 3A4IA 3CLTC 5DB4A 3IVXA 4HJRA 3A04A 3N9IA 3ZJTA 2CT8A 2CV0A 4MUNA 1QNFA 4OUDA 4DJAA 2DERA 1PFYA 3COWA 2PXHA 1GN8A 1K97A 4PY2A 1T6XA 2QJOA 3RK0A 1J21A 3A2KA 1XNHA 2GM3A 3X1MA 3NBKA 1NURA 4EF6A 4UZFA 3IUBA 4MUKA 3ZGZA 1NUPA 2A86A 1T9GS 2JANA 4ZT6A 1KQOA 3IODA 1M83A 3RHSA 1WXHA 2WSIA 2IELA 4X0EA 3ZIUA 1VLHA 1N2IA 3IOBA 4FZJA 1O94D 1LI5A 3CA8A 4KPUA 4BWVA 2Z09A 3CLRD 2ZUFA 1NSYA 1T6YA 5H7XA 3LE8A 4U63A 3PNBA 5H16A 4AQ7A 1NUSA 1TYDE 4NX2A 3ZXIA 1Y42X 2CV2A 4NDAA 5FO0A 1KQPA 3SDBA 1N3LA 5IHXA 3AKZA 3CVYA 2Z08A 3GUZA 4MULA 1D2RA 1MB9A 2J08A 3I05A 5J59A 1NUTA 3IMGA 3N8HA 4JXZA 1ULHA 1YI8A 1UFVA 4MW2A 1O96A 1KR2A 5DK4A 3DO8A 4J76A 2EL7A 3MLBA 1SURA 1F4LA 3NV7A 4JYZA 2EJCA 1ZJWA 3RJZA 4NATA 4S1OA 2QUIA 3P0JA 3ZJUA 1F9AA 4GU5A 1J1ZA 2TS1A 5KCMA 1Q11A 3G59A 2OV4A 4R2LA 4G5FA 4MUGA 1T6ZA 4ZT4A 1EFVB 2H29A 1KP2A 2OQ2A 3N2YA 1LI7A 3DLAA 4MUHA 4NZPA 2A84A 4WSOA 2PIDA 1JMVA 1NYLA 1G59A 1EE1A 1GAXA 4ARCA 1YIDA 4HPWA 3TNJA 4G6ZA 1GZUA 3FY4A 1JIKA 3L93A 3MUEA 2WQ6A 2QTRA 1WZ2A 3TQOA 2JA2A 1IRXA 1FYDA 3GMIA 4GRIA 3ZXSA 1ZUNA 3IMEA 2J07A 4ZT3A 3SP1A 2X0KA 2E89A 3CR8A 4MVCA 2CUZA 3DPIA 3H9BA 4P2BA 1I6KA 3VRHA 4K0RA 2XRYA 4MW5A 3CLRC 3BL5A 3FDXA 2RE8A 1TYBE 3HL4A 4MLPA 3H97A 2J09A 3COYA 1JZSA 3ILVA 1G8FA 2NSYA 1T9GR 2E21A 2CYBA 1H3NA 1R6TA 4ND6A 3K32A 1O6BA 1QRSA 5BNZA 3AL0C 1HYBA 4CDNA 3CVVA 1RQGA 1N2BA 1JECA 1M8JA 1KQNA 3IMCA 2QUJA 5J58A 2AG6A 4AS1A 3MLAA 1U7DA 2A7XA 1JIJA 2QTMA 5LFAA 3VGJA 1MBZA 4MUIA 5LLTA 3A05A 3FI0A 4CDMA 2HGZA 3COVA 4R2MA 3OP1A 2PZBA 4R0NA 3RFFA 2X3FA 4MW1A 2A4MA 3AG6A 4HK4A 5JBNA 2HMAA 1PFUA 2J4DA 1QQTA 1OWLA 1JEEA 3AIIA 2A1TS 3ELBA 4JXXA 1M8FA 4EFKA 1KH3A 1N78A 4QRDA 5TGTA 4A91A 4MW9A 4ND7A 3TQIA 3VU8A 3HV0A 3IH5A 2RD2A 1VL2A 1KH2A 1WKBA 2O8VA 1XJQA 2DXIA 3LOQA 3C8ZA 4E1AA 4KR9A 1YUMA 2QUKA 4MW4A 1MAWA 1JEDA 1O0CA 2CYCA 1EUYA 5K0SA 3PNYA 3HGMA 4JFAA 3UY4A 3NBAA 5DASA 1J20A 1QU3A 1F7VA 2O5RA 2X1LA 4G5YA 2YWCA 1IVSA 1VBKA 4MW7A 2GOYA 3CVWA 1N2OA 1PG0A 3QE4A 3IVCA 1U7XA 3Q12A 1H1TA 5TS2A 4J75A 3AFHA 2VXOA 2B7LA 4MW6A 2JAXA 1H3FA 2BTEA 3P0HA 1O95D 3FG9A 1KAQA 2YXNA 1NZJA 1WOYA 2ZP1A 4ZCTA 4DDHA 1BS2A 1I6LA 4DLPA 1EXDA 4NAUA 1EFVA 3KT8A 4WNYA 1JHDA 3HZRA 3FHJA 3SYTA 5FO1A 1X8XA 4HJXA 3TS1A 1QRUA 2HZ7A 1N1DA 3GLVA 3KT3A 4MVXA 3IUEA 1OBHA 1R6XA 4KR7A 4K03A 1O0BA 4EGAA 4ZT5A 1GLNA 1H3EA 3QTTA 2XRZA 4MUFA 4YMIA 1LW7A 3TZLA 3ND5A 3P0IA 1IHOA 1K92A 3UK2A
chains in the Genus database with same CATH superfamily
3L0IB 4MVJM 1VXOA 2VCEA 1N7GA 4XFJA 2Y0CA 5LDGA 1Z12A 2CKDA 3TRFA 2C9CA 5HNKA 3VR6D 1VB5A 3EIEA 4Y2XA 2C8VA 2IPAB 5BR1A 3V7NA 2E4VA 1JKMA 3B5JA 4GQAA 2OQIA 1LVUA 3RVSA 3GJ5A 2IL1A 3VMMA 4BO1A 1I1OA 3CC8A 1BD3A 4U5QA 5HEKA 4Q9IA 1ESEA 3F6BX 9ATCA 1MDBA 2ATVA 2DZDA 4B7XA 3A7EA 2DJIA 1DKRA 4D4KA 4D26A 2CNBA 3WLJA 2UYHA 4E13A 4MMXB 3OPVA 1HNWB 4L5BA 5DHTA 4YRRA 3VC3A 1DXQA 4F4HA 1MX9A 3CSSA 5A6VA 2FZEA 2I2BA 1DLIA 3H6GA 5GY7A 2AZ4A 2F3QA 2HXGA 3BGWA 1II8B 1EB9A 4C3UA 4A0GA 4HLUA 3OF2A 4D98A 5HKBA 3F5SA 1QFYA 3ZR4B 3MJDA 4YBRA 1OIXA 3GFRA 5K3CA 1FFEA 1Q6YA 5TT0A 4HYYA 4UU8A 4JASB 3IUPA 3OFVA 4PG6A 4TWBA 2H1FA 4RH0A 3S1LA 3A2NA 3I52A 1E0JA 1YKFA 1QKKA 2JGEA 5JXWA 1FFCA 1C0PA 2JH9A 3O1JC 1WY5A 1HYQA 3EXHB 3K6SA 3H7IA 2P6UA 1E58A 3SSNA 4K9NA 5AK0A 1YBAA 2PNJA 5KTPA 3U44B 3EEIA 5B1IA 3PQ5A 4JLPA 1R0BA 1Y5LA 4CLRB 3RUPA 3ILYA 4MS4B 3RVNA 1ISMA 4FMDB 4E1BA 5IWCA 2R11A 1ADBA 1PT5A 1U7WA 2HPAA 3HCBA 2DFKB 2VXYA 2XH8A 5JSZB 2G82A 3NKVA 1D8AA 4Q3BA 3BD7A 3FH0A 3T7JA 1W35A 5KOIA 1KRWA 2GFHA 2WRZA 4NMXB 1FZQA 3BA1A 3OZDA 3NOQA 4GR9A 1QM5A 2CY0A 2H2GA 3UGTA 4AP6A 2A9JA 2YJGA 1IN7A 1IEXA 3HJRA 4QPDA 4V02A 2LXNA 4F46A 2C95A 4OHZA 4G01B 4A5SA 5C80A 1WQ4A 3MAJA 3BPSA 3QENA 3A58B 1P1HA 1FMFA 2AQHA 4XCQA 3G1UA 4C4YA 2JBHA 4BCBA 2FK8A 5AIBA 5AW1A 2FUKA 3TQRA 1SXQA 5KYXA 3GAFA 1H85A 4NAHA 4B6FA 3VTKA 2O07A 5ED4A 1A9QA 2DFVA 1A3CA 2CJPA 2QORA 3C5WP 1HE4A 3EA5A 3FAKA 3R09A 4W7IA 5SZIA 4YT4A 1AE1A 3Q8LA 1VPWA 4I19A 4JAVC 2XKJE 1S6YA 1SXJC 3BXPA 5ALKA 4MQUA 1IMJA 2CUKA 3B6JA 1X2BA 2JLQA 1RKVA 5B7QA 1Z6AA 5CH8A 2XWJI 2ZYTX 4D8WA 2O50A 3ZWXA 4IXJA 2BMVA 4CWAA 1VRVA 4E2YA 1HEYA 4DLZA 1VPEA 2NO1A 2OL4A 2H92A 2XUZA 5DBIA 2VA9A 4EG0A 1JRLA 2BRUC 1H6BA 1LXCA 1DELA 2OCYC 4KXMA 1VLMA 3IC5A 5F35A 2YY6A 3RJTA 3EA4A 3EW7A 4RPLA 2JARA 2RJ3A 1N6IA 3G49A 1JLKA 1WW3A 1JYEA 1Z5NA 2AT1A 1PW5A 1ACJA 2IY9A 2WFLA 3ZWNA 4PF1A 4QEDA 5F1YA 3SZGA 3NKLA 4UXHA 2YWEA 5I9TA 3VSCA 1O1YA 4Y9RA 4L22A 4M87A 1C8KA 1T4CB 5FQNA 2OFFA 2G6TA 5KTSA 1KEKA 4G89A 1IMOA 4MS1B 4QU9A 3KZOA 3BE4A 1LRKA 1AIPA 1N2CB 1O96B 1WP9A 2IUSA 2QTTA 3VUFA 1RXVA 3P94A 1OF1A 4DA0A 4DTIA 2BZ1A 3BREA 1RWMA 1V71A 2YMQA 1P77A 3E8XA 4JB0A 4UDXX 3TJZA 4C4SA 4DJDC 3M6MD 4G4IA 1L3IA 1R37A 1V3TA 5KWVA 1D2AA 2B9EA 2G1UA 2YOHA 3NUGA 3O84A 1JZTA 3WYAA 1WXEA 4GECA 4F2DA 2VZEA 2R96A 1IY1A 2UZ1B 3GPBA 1QANA 2GCGA 4HNSA 1TYCA 3DAGA 3JQGB 2Z98A 1DAGA 1JNXX 3A7DA 2C3MA 4KDFA 4LSZA 3U16A 3ETGA 4CI9A 1NTRA 3SM3A 2X77A 1E4VA 3L6EA 3G9UA 5IYZF 2F55A 3KV3O 1AUVA 3TSZA 5IJ0B 3M1YA 2OLEA 1MX3A 5I4IA 1TYAE 4L0MA 3AUSA 4FKBA 2J9ZB 2A54A 1C7IA 3DMHA 4WRRA 3VHQA 3WXBA 1TZCA 2Q0SA 5FUVA 1C3JA 5TPWB 3U9LA 3V1NA 4IDCA 3ZIDA 5HF6A 4ER3A 5KNLA 4ZVNA 2FDRA 4PYMA 2EWWA 2ZU6A 5EWLA 1RP1A 3ZHQA 3K53A 3RU2A 1LQTA 1FPMA 4RPKA 2QEQA 4Z8XA 3AHJA 4LWQA 2D8MA 3WWCA 1VCHA 2VBGA 1SXIA 1W2GA 4G8DA 3G0GA 3IP5A 1GPBA 2EEZA 4PM4A 3TXAA 4A73A 5JWOA 3SZRA 3DFFA 4NYMQ 2FMUA 3HZOA 2BMAA 4AN1A 1AMUA 1XCGB 4UTXA 1JQ5A 2ZIEA 3H42B 1ZNWA 2CJFA 3LRPA 2G9NA 1YB5A 1NTOA 3SX4A 3HI4A 1KOLA 5JI3E 2NU9B 1JA0A 3MB5A 1U7TA 5CFQA 1JT2A 2GT1A 3FUVA 2Q4BA 3G2KA 5CNMA 5EGNA 4WOCA 1NBEA 1LTQA 3TG8A 3M6FA 1XVTA 4HUTA 4QOSA 2Z6QA 5K03A 4EHBA 3ME5A 5FPTA 5KSOA 4MI1A 3F5DA 2XKAA 4HPXB 3TYXA 3ZU2A 1Y7PA 3R6GA 2NVUB 1T36B 3C1UA 1Z37A 1A5AB 1QFZA 3GJXC 1TTPB 1V4VA 4LK3A 5ERGB 6ADHA 4MS3B 4XARA 3AJ8A 4DM7A 1B3RA 4ZDJA 3FNFA 2MSKA 3CEMA 1Z8HA 3VPGA 4OI0A 3H9CA 4M1QA 5BORA 4WBNB 4EY5A 1R4ZA 1U7OA 4INAA 5G41A 2RHDA 3FWNA 3OQJA 4AKSA 2BHNA 1OYOA 1JDZA 1UK9A 2NUTA 3R77A 3HVHA 3PUVA 1Z13A 5IVDA 1KRHA 3WNCA 4DMFA 3H6KA 3I04A 3N9IA 4QE3A 3AGPA 4WZBA 2R84A 5AESA 2WPNA 4UM8B 4OJNA 2I2FA 2MYNA 2H1CA 2NV0A 5IK2A 1M6EX 4ZYXA 1WB9A 2JKVA 2GHRA 2V96A 3LC7O 4OGWA 1X1QA 5K4AA 2CMGA 4L5IA 2JCSA 1DPFA 3TTSA 3ZD6A 2IS1A 3SLRA 5HIAA 1PJ3A 1SCNE 2V7TA 1X14A 3X2EA 2AFHA 3K2IA 5EINA 1H2FA 3ZI7A 4M7WA 1PYGA 3O3OB 4HGNA 1S3IA 2DPMA 2QBYB 3E0QA 3FLEA 3RU3A 3UJCA 1WDWB 4FDTA 1JP7A 1R9MA 5AHKA 3HP4A 4IZ6A 3W4IA 3V1LA 4H15A 1QF6A 4ZWNA 1K8QA 1G2PA 1NJ1A 3P7MA 2GR9A 3QVSA 1DB3A 2W58A 3OQMA 2P9EA 5BSMA 1ZM2A 4KWEA 4X0EA 2FP4A 3KXDA 1HFJA 1U8ZA 2IS6A 5KYYB 1Q1BA 2EKBA 3JZIA 4RA9A 2JVJA 3JAWA 3RVLA 1U1CA 4R9VA 5C2JB 1WCXA 3SEAA 3L4BC 4TLBA 4E08A 1PJ2A 3U7JA 1NLYA 4J90A 4X85A 4WV3A 4D97A 1X1AA 3H65A 2D1RA 4NOJA 1HUQA 4RETA 3HBMA 2R6JA 2V6FA 4JEIA 1KQFA 1VCIA 2XXAB 3EZFA 4EYKA 4PO3X 1QHSA 1KZ9A 3H9QA 3LUKA 4G84A 1AA9A 1N25A 4WNAA 5ALYA 3H11B 2HMSA 2MSNA 2R85A 2QW1A 2Z2KA 3H3XA 2NMVA 4XM0A 4YMTA 2HJHA 3IAXA 2IYRA 1UJNA 2JH3A 3V00A 1Z0SA 2Y2UA 1LKZA 1WG8A 2WIBA 3BA6A 3QLUA 1E3QA 4E2ZA 3ZY6A 2D5CA 2P90A 3IKJA 4EHNA 2V03A 3VR3A 3JQFC 2ZPAA 2VZ9A 4N6GA 3DO8A 4Y30A 4OATA 3ZCUA 4D4LA 4LFBB 5LQDA 1NNSA 1OLXA 1XCOA 2WVHA 5BV2P 1U1GA 4I1RA 3Q87B 4ALNA 4FI3F 2D4HA 4C4PA 1YJ5A 3LECA 3K72B 3KR0A 3H4IA 3KOMA 3G0OA 2Y9PB 3DWIA 2G1KA 3E9NA 3R5FA 4NF2A 4HXFB 1P81A 1J42A 3L1JA 3HN2A 3TD6A 2NN3C 2OO3A 1EUDA 1D03A 2HA5A 4REQB 3TFWA 1SBYA 3JY6A 2UDPA 1XMOB 2XYHA 2W98A 1M6YA 3T3GA 1KJIA 4IGAA 4CLEA 1EM8B 1Z45A 3U4DA 3N87A 4GI5A 1L7BA 1EJBA 1AN9A 3P2OA 4DWWA 3INTA 3N2YA 2QVZX 3DLAA 5KDLA 3PR2B 5I4BA 2XWBF 3JWHA 3L49A 2OTCA 1PUIA 3IP7A 4NS4A 1JMVA 3S1AA 4EPXA 2OQVA 4DR1B 4J07A 3IT1A 4XGRA 5KPJA 2ZJ3A 2XW6A 2CJWB 2GPBA 1TVMA 3QBTA 1RCFA 3W6ZA 1FMJA 2FX5A 3DMFA 3TXXA 1GZUA 1U8CB 1HA3A 2H4YA 3NH9A 3NORA 3QPVA 3F6PA 4FHFA 4PGHA 1JHXA 1U04A 4RCZA 4TMTA 5HPYB 1C0KA 4GR5A 1L5FA 3J7TA 2GERA 1WZ2A 2C5FA 4J91A 3ABZA 2AG8A 3GLKA 4GLBA 1JAZA 1IRXA 4OKSA 5BW0B 4FCVA 3V4FA 3URKA 4LJ7A 3N8GA 5ABPA 2UVQA 5KYWA 4IWXA 5EQTA 3R7WA 4E5DA 4V0KA 1BHJA 4XM2A 1PT9A 2E89A 3UPDA 4K0RA 3SMQA 4KIWA 2EL9A 3N53A 4FCWA 3LKDA 3O5AA 4FEYA 4KODA 4OAOA 4PYIA 4YJ2F 3UWDA 2VH1A 2J5XA 4YAIA 1POXA 2ZULA 4TVOA 1YRAA 4OU5A 3UQYS 4ZEVA 2VOJA 4FDLA 4PRKA 5IC4A 2OY0A 3PWSA 1P1IA 2COEA 4RIFA 5D2CA 3VU3A 3QUQA 5GJCA 1EFDN 3C5VA 4TPKA 2X2EA 1U8UA 4HEQA 5JCJA 1WLSA 4F1JA 2LMEA 3TKAA 3VMFA 1LQUA 1SU7A 3W06A 1G3IA 1ODKA 3IURA 2CLOB 1MRNA 3H83A 1RABA 3O38A 4TXLA 3FNQA 3KKOA 4L4YA 1UC4B 1ZG3A 5LLTA 1O57A 1T1JA 2JGDB 5HQTA 4HX2A 1J22A 1SRQA 2W6IA 1TU3A 3ENNA 5L7YA 1HE2A 5EJ4A 3OHPA 2I8LA 4IFTA 4EPTA 4DSAA 2V74B 1BMDA 1L9KA 1K7FB 5DTMA 4DZZA 2PANA 3THWB 2J8ZA 4WX2B 4NVRA 3TVTA 1KTIA 2AMYA 1YVUA 3DE2X 1M0TA 5KMGA 1LH0A 1V4BA 4XWOA 1W73A 1E20A 2QTFA 4KMSA 4EFKA 5EMMA 2XVAA 2ZRFA 3DAYA 4G8JA 4MYTA 1UKBA 2HBYA 3F6RA 4AG6A 1UMCB 2VHYA 2JI6A 2VDOB 1NN0A 2YUIA 2DFNA 3L9XA 3ZOZA 1Z36A 4DAOA 5E7IA 1IDN1 2H3HA 2BGLA 1Z34A 5DGHA 2YWJA 1KH2A 3N8KA 4LGMA 4YRQA 2P6MA 1U0FA 2GN0A 2YYAA 3RHZA 4B17A 3DR3A 4IZOA 2BJWA 4EGFA 4FLMA 3OT1B 1YZVA 1EJ0A 4YP1A 4JNKA 4OOFA 1G18A 2M2IA 3ITKA 4WCFB 2I7CA 3LA6A 4JI2B 1CUBA 4UKDA 2HJVA 3E4DA 2QX9A 3F9IA 1AT1A 4NH0A 2BI7A 2EKQA 2HJRA 3AR6A 4FMCB 4RD4A 2QE6A 2Z83A 4DVJA 2CNWA 1ZINA 1G60A 2HPZA 2OFPA 4HAXA 3MTEA 4JFAA 3RCBA 5C1IA 3UXHA 4N0EA 2JJ8A 1E1CA 1NXOA 1UWLA 2OILA 5F78A 2VHZA 2AD1A 3JVDA 4ENSA 5JD4A 5FTLA 3H2ZA 5ALXA 3UJ3X 2Q5FA 2QLMA 3GJQA 4NMLA 1KDRA 4Y0VA 1PU2A 5EHQA 4PG8A 1WCYA 2Q6OA 5C0OE 4DZTA 3PJGA 2VQSA 1YFZA 1NLFA 3BGOS 2R1VB 4EMTA 3PXXA 3U6KA 521PA 3WK6A 3TQTA 2VYCA 3S4YA 3L1IA 3OD5A 2VUUA 1QHIA 2A5JA 1E6UA 1OTYA 1W0JD 3H84A 5F33A 4KRFA 1OBFO 2SECE 3A2LA 3CEHA 3PR1A 1XZCA 4KBGA 1JW9B 5BWBA 2QTCA 4GXQA 4YT8A 1XCLA 5BWOA 1U98A 1Y4ZA 1YT5A 1M2WA 5C53B 2H5EA 3DF7A 4KPGA 3L1KA 3L1HA 5AVWA 2OO7A 1W87A 3DMTC 3NT5A 2E1PA 5H8WA 1E32A 2JJQA 4E7PA 3RAGA 1V5WA 4ZQFA 2W6JD 2P2YA 5BMVF 1AHNA 1OI3A 2IKQA 3RV3A 3WYGA 1LBQA 3Q88A 5BW6B 4AS2A 3THYB 3KQMA 5CR9A 2GK3A 1GUYA 3FBGA 3H1AA 4IWNA 3KSAC 3CXRA 2A50A 2WF7A 1Y89A 1LW7A 5E95A 1RAAA 5AJXA 2PJUA 3IEIA 3BGIA 2NGRA 1EFLA 2XZTA 3ND5A 1T8SA 4HDRB 2EZ9A 4R4JA 4ARAA 1FVFA 1P18A 1QDLB 4KVGA 1I3OA 1EXVA 3EWAA 1T0JB 3AVUA 1G8SA 3ZU3A 2A5YB 2JASA 2FDXA 4OQYA 4PSAA 1E9EA 1Q0QA 5TPZA 1BGVA 3UMVA 1DEXA 3ZHOA 2A1UB 3QEMA 2V7QD 1Z4JA 3KUUA 5DLYA 5MN4A 1VKHA 4H7JA 4OHOA 4BX8A 1E2EA 4YMLA 4GC5A 4JQZA 5T8KC 3TFOA 3S1SA 4WNCA 3UFXB 3N1UA 3KNZA 3AG5A 2GD6A 2WAMA 3GFTA 5AKJA 5KQGA 1D9XA 3N28A 1RJDA 3ZWAA 1S02A 3EG5A 3KU1A 2CCGA 4H3SA 5AIAA 5MGNA 5DYWA 3WV5A 2J3EA 1G17A 2WIAA 4HQNA 3RJ5A 2GEFA 2PCLA 4O4HF 2PWZA 3H1TA 4KEAA 1V3QE 1BC5A 5EMLA 2DM6A 3S2IA 4XD7D 2QV7A 2CMHA 3QVMA 4E5VA 2IHNA 1CVIA 1FE8A 1M8KA 2AQKA 1XTBA 3CSUA 3A1UA 3NVMB 3E9ZA 3RBZA 3U3KA 4JJFA 4LVNA 4J8PA 3I1JA 3RT7A 1EQ2A 1NRWA 4FZ5A 1ATIA 4OM7A 3VH2A 2NAFA 4FDVA 3NQ41 5KNCH 2AYZA 1L7QA 2VT7A 3IDFA 1P61B 1UFRA 2X0EA 2QD4A 3USES 1XDWA 1KRXA 4LQCA 1TMOA 5F4BA 5JVDF 4S04A 4GD3Q 4Z54A 3UAGA 2Z1NA 5DBGA 2O3UA 2QG9A 2R6HA 3DFUA 2NSJA 5HCNA 3PS9A 4MR9A 5JZOA 1KHHA 3CKYA 2QUAA 4I50A 2C0PA 3QOFA 5G0UA 1J8DA 1JR6A 1C3OB 1EJ2A 1XR3A 3X1YA 2PH3A 4GDFA 3KSMA 1J97A 2W93A 2Q07A 4KFSA 1QYWA 1JL3A 4YJGB 5K8UA 2ZWMA 1N1EA 3CQ9A 3HWRA 1DS6A 1QMPA 1LFAA 5L4LA 4HX5A 2ZSBA 1EA5A 1UOEA 2ZBEA 5FA8A 3L7LA 2D06A 3B52X 1KI6A 3BGVA 3E1GA 1GNQA 1RLMA 4CEJA 2XI4A 3ZYZA 5B3KA 1EB8A 1GZ3A 3HA7A 3KEFA 3UICA 4RKFA 3GRUA 1EVYA 1HG0A 5H0IA 2JHCA 2FJUA 4MLDA 5BW5A 4Y2VA 3UB4A 4KXUA 3CWZA 3PA8A 4GO1A 3VU9B 4AB1A 4Y2SA 4DGSA 3KPWA 1WEHA 1AG9A 4TTTS 2X0JA 1J8MF 8AT1A 1C3VA 4K9SA 1QCZA 4WDRA 1A27A 1EVQA 1XRQA 3C5EA 3E8SA 2OK7A 3GW8A 4HH3C 1KYXA 1RWWA 4BNZA 1C7RA 1ZD9A 2C2GA 4R1MA 4TKZA 2FRDC 3QEKA 2W6NA 3PNQA 4RY8A 5EWMA 3V1UA 3OFKA 4CQLB 2O2XA 3SEQA 3LOPA 3SZMA 1RHKA 1Q7RA 4MVJD 3TN7A 3UJPA 4LDJA 1Y8QA 3FSEA 1PT6A 3ODPA 4FFLA 4G81A 4ILKA 4Y7DA 2AHOA 4RVDA 2GNOA 4O4LA 4CV2A 4FFNA 1S8OA 2G9UA 3L7MA 1E0SA 4CM4B 3R3JA 5A4FS 1MUUA 2PKEA 3IE1A 1HLDA 4G24A 4FE3A 3TOVA 4H7FA 2AJ8A 2E4AA 2RHMA 2VJLA 3EOZA 4TKUA 1GPKA 2B1GA 6CHYA 4J7UA 2AC7A 2WM9B 3CLUC 3JQDA 3UMFA 4UNRA 5FX2A 3F8TA 3TTUA 1BWPA 3KK0A 2QTWB 2QNIA 2L0XA 2EIHA 2ZWIA 2E55A 1DRWA 4C0BA 3HEMA 5JH7B 1HX7A 3AY0A 4AIIA 3ZJ4A 2JHAA 4C03A 1SQGA 4DLBA 3K8ZA 2D7CA 2R8RA 3NVDA 1X80B 1Z56C 1ILWA 2PLRA 4Q47A 3ETDA 4FFMA 4K6FA 3RVPA 4EHLA 2DLCX 1V47A 1NQVA 3W5UA 4QFMA 1NX9A 1E4OA 1ID1A 1V16A 4JUFA 3DAHA 3B9RA 3NM5A 1OVMA 1EZ1A 4BNIA 2JJMA 1CZKA 2P78A 3BHIA 5E6UB 1WXIA 2JBWA 5I51A 2BGIA 1Z0JA 1PT7A 3CUSA 1YB6A 2R6FA 4G56A 5LC1A 5JQWA 2V3VA 1EG7A 1UAGA 3VZBA 3R20A 2PE5A 3MBIA 3TRDA 4BWFB 5LP1A 4EUNA 1J1IA 1JHQA 4BNUA 3RSGA 1B7GO 3IR7A 5TQVA 4HGQA 2ZM6B 3NPMA 4IRMA 3N2IA 4NMMA 3LF4A 3GAAA 4DB4A 2DSTA 4DNFA 3U62A 3EXEA 4NYJR 2XNDA 3IPYA 4K8OA 1GQ2A 1A9XA 1BNCA 1EX7A 2CMFA 2X2PA 3DQQA 3U4QB 3IUNA 1D1SA 1G2OA 3IEPA 4OMUA 1FS4A 1QWSA 2FOLA 4DCGA 3Q9LA 2R6CA 4LXUA 2PJZA 4KE8A 1D0IA 5EWLB 3SYNA 2IZ7A 2IIBA 1N77A 2CBGA 5AUOB 3BXEA 1MA0A 2C5SA 1BWSA 3BL6A 2CV1A 2GJAA 2OD7A 5GZ3A 3DEAA 3E3MA 3OLWA 4C0HA 4HQOA 4RFSA 1KQGA 421PA 1OIWA 2ZYRA 3AUYA 2EXXA 1Z22A 2VP6A 4C2UA 5LWHA 1HDYA 4TL8A 4MVJP 1HNNA 3QJGA 2WHEA 4H7HA 4JCCA 1M1YA 4XQEA 1XUOA 2BPOA 2H85A 4KHPB 2UYCA 3A3OA 4TYYA 4ZIRB 4LTNA 1L6RA 3UHPA 3V1TC 3O9MA 5KNCA 5AJYA 4NSNA 1PHRA 2AWNA 2GSDA 1O95C 1E6CA 2M9MA 3GG9A 5JNWA 2HW8A 4ND3A 2QX6A 3R41A 2Q0HA 5KDOA 4PZCA 3VO2A 1GTJ1 5T5QA 4RVHA 4ZI7A 4JQYA 1UMBB 3E18A 4FYYA 4K86A 4Y2QA 4EG7A 5CLJA 3CF4A 5EPUA 4R8MA 1I5RA 1XV5A 3EXIB 3A4IA 3NASA 4B33A 2BLNA 4D4JA 2Q4EA 5DB4A 1QG2A 2VSXA 2KBFA 4LCEA 4LVUA 2VXCA 3PD0A 3CURA 2C03A 1J8VA 2PWPA 5G1PA 1ZYUA 3QBEA 1LWNA 4RYDA 2NUTB 2HHLA 2VJMB 3AUTA 3I9JA 4KYVA 3TTYA 3WLRA 1ZMBA 4CEIA 4WFJA 4DJAA 4EZIA 3BH7A 4GRDA 4BC0A 4WZBB 2WAYA 4R9SA 3P9XA 5I7SA 1U0EA 1RI5A 3GAZA 3U7IA 4CDRA 4MTCA 1M73E 3FPGA 5GJVC 3ZE7A 1LJLA 3UT6A 1CXZA 2QVLA 2RAUA 1MJGM 1B73A 1M66A 3W34A 3A2KA 5AKEA 4Y7CA 4JBHA 3W5IA 4N5HX 3AEKA 3FOWA 3KD2A 3KPYA 3OJCA 1AV7A 1PQ4A 2A86A 1QQ5A 3DS8A 2BR4A 4F4FA 3T7TA 1AO0A 4BXOA 5HILA 4TMWA 3N07A 2QGNA 3OJEA 4LC9A 3GDFA 4LMBA 2PS0A 4R6WA 5M2QA 2AEJA 2L19A 4J6EA 1DFHA 4ZGWA 4R9UC 4UTVA 3JALA 2VYVD 3LCVB 5JPCA 5H81A 1LI5A 3A9SA 4KPUA 4WZZA 3FCYA 2I9PA 2BSQA 3N0WA 3L1UA 4K87A 5A6SA 4ZTBA 4LGCA 3WLEA 1QC5B 4PHGA 4YAUA 1IB6A 4IS3A 2FE1A 1YC2A 5FO0A 1NUHA 5LYJB 2FZWA 3NNSA 3TEFA 1N6HA 2YWGA 3Q1LA 3BH6A 1EK0A 3JQ6A 1CDDA 2JJYA 2OHFA 2FE4A 3AF4A 4DIOA 3JQ8A 4MUYA 2WF8A 1EP9A 4HZUB 5FBZA 3QVTA 3W4JA 3I9OA 2QM7A 1J2JA 2ZS9A 4B6GA 1FS6A 5I3CA 1W8IA 1E6WA 1WVGA 3LDHA 1S3FA 1UFVA 4IX1A 2QD2A 3EN0A 1K7XB 4J0HA 4MXDA 5HFAA 5B36A 1KR2A 5FFFA 4GEKA 2ES4A 1N5LA 2ZAYA 4FGKA 2GNAA 2B36A 4M8IA 1YCDA 3AB7A 3S8EA 2B5VA 4D9FA 3ESDA 4N49A 4D5EA 1L4KA 4FW9A 2CW5A 1ZGAA 3I23A 5BOSA 4FSHA 5CVTA 1L7PA 4H27A 2QT9A 4ZAZA 2F7SA 4J0IA 3PC6A 2ASEA 4MH0R 1HXHA 1MT0A 1Z5WA 2JBAA 3C98A 1V3UA 1P31A 2JJ1A 2R79A 3N74A 4M0CA 3EBOA 4ZJUA 1D6SA 4IIGA 1KMQA 4ALKA 1I9CA 2MIIA 1T0UA 3LTEA 1WMFA 1YS4A 1EUDB 2WT9A 3FTDA 1ZM3A 2HK8A 4PANA 4IEFB 4RD1A 3N6VA 3PZRA 3EUFA 4PCAA 1I2MA 4X6UA 5BV7A 5HZMA 3L07A 1T25A 3EHDA 2OQ2A 4GX1A 2CJYA 4CL0A 2SHKA 4MUHA 4Q1AA 2LCIA 4BB6A 3JQQA 4DPLA 5ALSA 5FHRA 3S1AB 1U0OC 1D1PA 1K5DA 2NO6A 2AYXA 3R5HA 3WZMA 2P0AA 4HWPA 2DKNA 2P3OA 3N2ZB 2QD3A 5LL6P 4W9MC 5JFOA 3DZBA 4IM7A 4HZIA 3JYPA 4LEIA 1BS1A 2WJ3A 1GZ6A 4RMGA 4MP6A 2Q21A 5JSKA 4BJHB 3S6JA 4BFZA 4EIWA 1QK3A 4BLWA 1O9HA 4ZOEA 1RM3A 4US0R 1V8BA 4E1AA 1PEYA 2J9FA 4MVCA 3VR2D 1HL7A 5F51A 2IYYA 2ZBDA 5KYWB 5LJLA 2O19A 4MCJA 5TF0A 4CPDA 1E3EA 3LW8A 5HS6A 1DKUA 2FX2A 1QIMA 2W9XA 2GPJA 4P7FA 2WWWA 4RM2A 4QEKA 4BV9A 3OD1A 3DE4X 4PLTA 3GFVA 2WWRA 1JZSA 1V11A 2PL9A 1HEUA 3OAAA 4QAQA 4RIGA 2QRZA 1E4EA 3K2BA 1F0PA 2BCGY 3Q3GE 2CLIB 4QBHA 2G25A 4OYHA 1JQKA 1N6NA 1SMKA 3G82C 3EDOA 4HRYA 4XOIA 3GT7A 4IDPA 1RM4A 4M8NE 3JQPA 4QUEA 4B7ZA 1QRSA 1RKXA 3O4HA 3OM9A 4KAAA 3V3KA 4DABA 1F2TA 2ZUVA 5JAZA 1CETA 1FYEA 1JECA 1BS9A 1R2QA 5CFMA 1T9HA 4R3UC 1FP4A 1IL0A 1T5OA 3U80A 3RYFB 1YB2A 1Y3IA 1MBZA 3WRWA 4GP6A 1KYIA 5JAMA 3I9LA 1KTVA 4G25A 2FWRA 5CK5A 1EWRA 2QAGC 4R0NA 3A6KA 2KHZA 3KL4A 3RRMA 4YRAA 3RHFA 5A62A 3T94A 5IJZA 4DCNA 1NVWQ 1P7ZA 2H16A 4RSGA 3KIPA 2RIRA 1PNTA 4FX5A 1SQ0A 1P1FA 3HXPA 4Z0PA 4HH1A 2AOTA 2QSUA 5HF9A 1PFUA 3CZPA 4YRFA 5EMJA 4ND8B 2ZI5A 3R24A 1ZK4A 3G2NA 4FINA 4EHJA 1FLAA 2HC9A 5TGTA 2H7CA 4YMSA 4C0LA 5IM4F 3DCYA 3JPWA 3IELA 5C34B 3N7UA 2JHFA 1ZH8A 4LXQA 3L0SA 3NGXA 4TX1A 1QZXA 1TW2A 4OH7A 1DG3A 3E9DA 3LU1A 3E81A 3GUCA 1B16A 4IIXA 3QP9A 3PNMA 4IXMA 2PVPA 2ASVA 4LDNA 4ENRA 2Q29A 5AVVA 2RGNA 3L3BA 3RWBA 3F7NA 1MPTA 4W9NA 5AVYA 5EHZA 1Z07A 4OAPA 2AQ8A 1OPXA 2OK8A 1C8VB 2OCPA 1QLWA 4A8JC 3BEOA 3OICA 1BH2A 4MIEA 4X97A 3F90A 1PGQA 1WIWA 1PLJA 4WKNA 5EP1A 3QELA 3UJAA 3U7GA 1UPBA 1EZ4A 5CGZA 2C77A 3C6BA 1ULSA 2AV6A 3M4JA 4M0UA 4NI5A 1QGYA 3SF0A 1SQSA 2AFRA 4Z0HO 2CXQA 3R8FA 4LOLA 3D2BA 5K3OA 3RFUA 4AS3A 3A0RB 4E03A 1ONBA 2ZETA 2PSHA 3A4YA 1XXHB 3UXMA 4D2IA 2FCRA 3OT5A 5HCIA 4E33A 3DFIA 1V6CA 1ML4A 3JATB 2OOKA 3QE4A 3TB6A 4EHFA 3WB9A 3FCUB 3HA2A 1SN7A 3Q6NA 3RVQA 1ECFA 2BH9A 2VXOA 3ZHYA 2QLNA 1IXKA 4HS9A 3HZHA 5TY0A 1CZRA 3IP1A 4L78A 3UWSA 1M7HA 3D31A 1BHO1 5JHHB 1RXSA 3U81A 1DOHA 3IAHA 3R44A 2Q0XA 1P2VA 1W5EA 2LUOA 4N6OA 1S4QA 5K2OA 1OU4A 4Z53A 2BEUB 3T5AA 1EXDA 4IGEA 2V6IA 3T8YA 4E6PA 1Q5PA 3T7DA 1JJFA 3GLFE 1YS6A 2YR0A 4ZQHA 4F11A 5EJGA 5HRCA 3W7AA 3DMYA 1GLNA 3S8YA 1SQ6A 2Y99A 4JB3A 1D3AA 5CDTA 3S5JA 1K3FA 2QN7A 4D43A 1XLVA 2A35A 3MFQA 5DK6A 2G9ZA 3ZE8A 3IEKA 1MJ5A 3PHBE 2IYTA 2P30A 4EW1A 3EXFA 1QFJA 3A36A 1P1JA 3FETA 4MP8A 4RZIA 4URYR 2ACVA 2C0CA 4WESB 2J0UA 3NHZA 4DYHA 3ED1A 1CIVA 1F8FA 4FHGA 5JJKA 3DDUA 5AVXA 1A9TA 1NF2A 1Z38A 1M6WA 1B93A 3KEOA 1BOOA 3GPDG 2Y66A 2ZLBA 2A0WA 2R6R1 1BMFD 3GJ6A 3ITNA 1CJVC 3NHPA 4AG3A 3TDNA 2WSYB 1JSXA 1CY0A 4GGPA 1PK9A 5C4GB 1T8TA 3ROXA 3CO5A 3PX3A 4GRAA 2NTNA 1WOMA 2GHIA 3EVEA 4CQNA 3HDQA 4DSUA 4QUAA 2BFDA 3I2JA 4X65B 5FBQB 4ITUA 1PL6A 1GPNA 3DTVA 1KS2A 5FCDA 2V7GA 5HJEA 1GPUA 5DX0A 2I29A 3DNPA 2OXCA 2RJNA 1TJ3A 4EH1A 1CR4A 4CT4B 4RAOA 1UKYA 1YVPA 2FGJA 1C50A 2YV1A 4H1VA 1LVGA 5L95A 2GN4A 4PYOA 2XPCA 5J5AA 1XEXA 2V3WA 2OYRA 3T0GA 1TGYA 1Y4UA 4LX8A 3DE1X 4CV0A 4JVSB 3MT7A 2YQ4A 3PNSA 4P7BA 4TL9A 5FL3A 2D5BA 3N8IA 4YRGA 2ZXFA 5BUZA 3OPYA 5DNUA 1MKYA 1SKUA 2WP8J 3CPEA 4LWPA 3O83A 4RVSA 1XROA 3OEED 2RONA 3QX8A 3K0BA 4MCIA 1XJ5A 2II6A 2TMKA 1LPAB 4RS3A 2Q3FA 3SIWA 1UPXA 4BVKA 2DY1A 3TR6A 4DA8A 4EHDA 1GLVA 3LQRA 4QFCA 2EQAA 4RE6A 3MXTA 4PAWA 4UVGA 2WIGA 3Q3HA 4Q4LA 5L3SA 1IXYA 3WMGA 2YFKA 4P22A 2HSEA 1OOEA 1GV0A 2JRLA 3H99A 4KOAA 2D5IA 4MKZA 4MQ6A 5EL0A 4HAWA 5JNRA 3ORYA 4WN3A 1HYEA 3EBPA 4KVZA 5IEBA 1TJNA 1KP3A 2YIJA 5ENZA 3H5NA 1TLFA 4PZPA 1U8FO 1FFXA 3AP1A 4BMVA 5I5EA 2ACKA 1SOMA 5A7GA 1EUCB 1NSFA 4FW8A 5AKLA 3TAXA 1GT6A 3CBQA 1RPNA 2EW1A 1RWOA 3R3ZA 3WKDA 4ZV4A 3FFTA 3DH0A 1KJNA 2B82A 4NPHA 3R7LA 3NJ8A 4A0FA 2E18A 2IYQA 2JFBA 5A3JA 5LIPA 1C0EA 1E77A 2GEBA 2G9QA 5C1BA 5LNK6 1NAIA 4LJ6A 5JALA 3DL0A 1XMIA 4QTTB 4Q18A 4GM0A 4LYAA 5LQSA 1TQ2A 4AKHA 2ZUBA 2CXSA 2YJNA 2CYAA 2XNHA 5EEHA 2N47A 4B3IA 2C2XA 3AZOA 3KSBC 3WL4A 4Y6QA 2GQ0A 3QLVC 4JP3A 4Q3LA 1E59A 1NPDA 3I3OA 3I01A 4IHJA 5DEOA 5AI5A 3SHTA 5C7LO 3LGXA 1KETA 3ANNA 3UV6A 4D80A 2IPOA 4Q21A 4KKVA 1X7YA 3ORFA 5EWMB 1M6NA 1LDGA 1N5DA 3QE0A 4DV5B 1UM9A 2EATA 1IVNA 3ZHTA 1X9HA 5E1BA 5LZ2A 3ANSA 3K09A 1Y8QB 2JI7A 3KDPA 4QQNA 5KC8A 1NVKA 4YONB 3LQ4A 3DO6A 1SPXA 4YDQA 3MQ2A 3L7BA 1JKFA 1JXAA 4IICA 4H6WA 4O4LB 4TXJA 5IFLA 4BIMA 4G0OA 2OECA 4LY9A 5B2ZA 1PYOA 4OY3A 2JIZA 2UYOA 1MEJA 1C9MA 1RRMA 4X63A 3K6RA 4CTNA 4UEOA 5IJWA 4MDFA 5L6MB 1ZKMA 4HTFA 1MIHA 3ENKA 4TUYB 3HJNA 5SV2A 1NVDA 3QVOA 4CL3A 1OSNA 4PRYA 2JEYA 4YDRA 1CS0A 2I65A 1HQCA 5IDXA 3ROZA 4N4AA 4IIJA 1IJFA 5H68A 3QV1A 4I6JA 4CKEB 3LX4A 4ZV9A 1EM6A 2ETXA 4MWBA 5D3MA 4POAA 2YVAA 4X45A 1ZCBA 1B6SA 1IB0A 3GDGA 4TV9A 3P27A 3JQBA 5T6MA 4R7TA 1MGOA 1NULA 3UJHA 3FBWA 2Y0PA 2OAP1 1VMDA 1QK4A 4OL0A 2ALJA 4H4CA 4ZCRA 5ES4B 3AR7A 3OCVA 3SYMA 5TB5A 2W8BB 1JG7A 3I5UA 5JWRA 3T0IA 2GTIA 2ZDQA 4ZZ2A 3IHLA 4HLUC 3RHTA 4J43A 2DF8A 3PVSA 1XCMA 2DRIA 1AS0A 4GMXA 1G7SA 1T43A 4HAOA 5DTQA 3ZGLA 3EXEB 1A2KC 3AESA 3ZWMA 5AD1A 3S2UA 4CQJA 4X91A 3RVJA 2BFAA 1S1CA 3IESA 2RAPA 2HH9A 1W4LA 2WFMA 4HXYA 3ZHRA 3F6YA 2LDBA 3W2HA 3OJWA 4FEAA 4QJBA 4FCTA 5F76A 4JR1A 3DV2A 4YB8A 2QN9A 4AKTA 2HHHB 2NVBA 1UXGA 1KPGA 2H5JA 1T2CA 2IDJA 1U9JA 2R8XA 3JQ9A 3PF9A 3DZIA 3V2HA 4BTLA 5HKAA 4RFSB 3U1VA 1ZOIA 2C1EA 1D1QA 3HYSA 2B1RA 4ZD6A 4RO0A 3GYGA 4GMGA 1NUUA 3EB9A 4K6MA 1DDIA 2CE7A 2XEXA 2Y1DA 4YPFA 1IM5A 4CCAA 1K3TA 4HZGA 1QPBA 3U17A 5SY6A 5TMEA 3SC3A 1Y9JA 4IDBA 3CUEF 1CY8A 1PV1A 1XEFA 1TZBA 4LCJA 3TE7A 3W2TA 3LDAA 1APBA 4M1SA 5H4HA 3PFKA 3NHAA 2XZLA 1HYHA 4O4IA 4EYGA 4Z4HA 4QUBA 2VQ6A 1YZKA 3AZQA 4ETNA 4IJVA 4M9ZA 4EZBA 1TDJA 2X8JA 2CGEA 5CXSA 5G3ZA 4XJSA 5EYPA 3JX9A 3QE3A 4XWWA 4O63O 3T7CA 1XZNA 1Q1QA 1Y82A 4YRBA 1M34A 1CCWA 1Z5VA 2J6CA 5D6NA 5C81A 4JT4A 1M33A 1KWKA 3DZKA 3L8EA 4OI1A 4Q1EA 5AVOA 1UK7A 1Y7TA 1ZOSA 2G63A 3AY3A 3TSAA 2ZBUA 1OBVA 4Y2GA 4AZTA 4BKQA 5IVPA 3I64A 1VDZA 2LE0A 4RKEA 3TNLA 4RK5A 2XMGA 4CEIB 1F5SA 1SUPA 3COWA 5LBTA 5BW8A 2GN1A 2ON6A 4WXHA 4OGGA 4HH4A 4PY2A 3OQPA 1JHMA 2HIGA 3QQPA 1UMDA 5EP4A 3R3VA 1ZVVA 4N03A 1UBKS 3R3YA 4MEAA 2FSHA 3NBKA 4PTYA 3IV9A 3W2IA 3T15A 4EB0A 5KU7A 3IUBA 4ANFA 1IG3A 4Y0AA 3ZGZA 1PK7A 3OQNA 1RE1A 1OC2A 2QLFA 3NHKA 4QPPA 1QO7A 1KQOA 2WB4A 2JI8A 1AVTA 1LPNA 1WXHA 1QVVA 3AEKB 3P9IA 2F1OA 4V03A 5GAJA 3VJLA 4R1NA 5LXTB 1RS0A 1RPTA 4DIBA 1AF7A 3NPAA 1QGZA 4KX5A 1Z6ZA 5EIHA 4S1WA 3RUCA 4AY6A 3NBFA 1QZTA 4XR9A 2ZJ8A 3E22B 3UWMA 3GPLA 4GVPA 1E9RA 2XRFA 3SNHA 2JKZA 4UUQA 5B1DA 3JASA 4U63A 3H0KA 1NUSA 2YHIA 3A1WA 1UIMA 1Y42X 2BMFA 4B73A 1PJ8A 3HUEA 1P2BA 1EEXB 4PZEA 3IUYA 2W2XA 2OA0A 4XIYA 3VR6H 2DUNA 5ICCA 3WWZA 5ALOA 1P6UA 1Z28A 4WZ6A 2VT3A 4LV8B 5CB8A 3DM5A 3IAS1 5G0SA 5B1HA 4ZREA 4QWWA 3K70D 5DGIA 1XQWA 5HGXA 3PQDA 4DMGA 4WGGA 5ETJA 1UINA 3ZV7A 2P6PA 3CZCA 3UAVA 4F9TA 3COJA 5KREA 1SNYA 3CIFA 5DNYB 4GH5A 1XMQB 3ACCA 1SURA 2P1ZA 4J94A 2MT9A 3DYVA 1YR7A 1EAYA 2HJGA 3K15A 5LB4A 3CNLA 3ECAA 3FMPB 4MWGA 3T61A 1KK0A 2RGGA 4FEGA 3D8BA 8GPBA 2PJRA 3QXXA 2Z6VA 1KY3A 3GCXA 3OF5A 4ENVA 2J3DA 3FPSA 3U4GA 2CXTA 1FDWA 2VK2A 1C9EA 1Z5PA 4LHZA 1QVRA 2C4HA 4MUGA 1VQ1A 2BMWA 2CKMA 2FSGA 3HHEA 4Q66C 5K1ZA 4LE0A 4Q4AA 3WKBA 4C7JA 1II9A 1M9NA 1N8SA 2QVCA 1CJCA 3CH4B 1PDVA 4FNGA 3S7ZA 4WKPA 2R7KA 2Q1UA 1HTBA 4LY0A 3MOIA 4EVSA 3ICVA 4FN4A 1E9AA 3ROQA 1GAXA 3JW8A 1Q0UA 1IUOA 1FBNA 3L4KA 1NR1A 4ZO4A 1FTSA 1SU4A 3MJHA 2QMOA 2ZI6A 3HCWA 2JVIA 2XDQB 2XSZD 2GD0A 1GUDA 4RK1A 4XUCA 1ZCJA 2JDIA 2OC4A 2ROQA 2WPDA 3O3CA 4Y6OA 6REQA 1KA9H 4BLVA 2JA2A 3PDUA 4I9FA 4BUCA 2VDMB 1LV8A 3FDFA 1HFKA 1S3GA 2FSVA 3P2EA 4TTJA 1P6QA 3SP1A 5BQ3A 4BO9A 2FUG1 3Q2IA 2FPSA 4MRRA 3K71B 3AVQA 3H9BA 3M6WA 4R3NA 3VDNB 5FAKA 4QJ4A 1W6UA 2N46A 3PC2A 5CXQA 4ZDKA 2VL7A 1DC3A 3FDXA 3QU9A 1QO9A 5FI5A 1RI3A 3EH2A 4I55B 5EWJA 4CT5A 1DRJA 1HTWA 4QYWA 4W82A 1K88A 4AROA 2X8AA 3JQAA 4ER7A 3C7AA 1YJ8A 3EIFA 4C0WA 4HKTA 4L0QA 5F12A 2IUFA 2W6PA 2HSDA 3B1JA 1G9SA 3S29A 4BNGA 5J2TA 1Z33A 4C1NA 3UJ8A 4P54A 4S1NA 4JUBA 3OO0A 3ER9A 1O6BA 2B9VA 4O3FA 4PAOA 1XRNA 3FUXA 1JLSA 2IKSA 4D9HA 1D2EA 3RSFA 2C7VA 5FUYA 1X77A 4TS3A 3RTCA 1J5EB 2P77A 2H8GA 5LFAA 4L4RA 1A7UA 2I71A 4ZVQA 2WTUA 1I7PA 2O5VA 1RVV1 3AM4A 1BYIA 3O47A 1A7JA 1DSSG 4M98A 5AVSA 4CDMA 5DBFA 2WIDA 4QQRA 3PU6A 4EJFA 4ABTA 3CT4A 1H42A 3K3PA 4Z8YA 2DOKA 5HA5A 3RTEA 2BP7B 1IN6A 4WXMA 3TNYA 4BLRA 2ZRMA 1T5DX 1YDFA 5EA2A 2GAFA 1AQIA 5C8ZA 4QTZA 4D9GA 3CW9A 3OZ7A 2J4DA 3OPNA 1TM1E 2AXQA 2ZR0A 4QQKA 1ITZA 2ANCA 2AOTB 1VL1A 5C5CA 1AQYA 2SICE 3Q40A 1DIAA 2QRLA 3PGVA 4QRDA 4Z7QB 4R05A 1DARA 4RZ2A 5BVGB 3EZLA 4D9NA 3H4MA 3E05A 3KUXA 4LS3A 5F5LA 4B35A 3GFQA 4MHTA 3H2GA 4W5WA 4DJJA 4ALIA 2OV8A 3ASUA 3EC1A 5F3RA 3UB2A 5G4KA 4BDTA 2QY6A 3JVUA 4QLOA 4YRZA 2F1HA 5KQLA 3L4EA 4A36A 3WMXA 4BE7B 5CBPA 1GO2A 4CR6A 2VYNA 3KZXA 5ITSA 1EK6A 1MAWA 4FCCA 5H5JA 1PVOA 1RWKA 3KFXA 4F7WA 4E09A 2O20A 4HNUA 4AXXA 2XX3A 2ADMA 2ZCUA 2IFTA 4JL6A 3G17A 3LCUA 2HD4A 4KXLA 1V2HE 2HAEA 4UDYX 4DF3A 1N8NA 2J46A 1JR3E 6LDHA 3SIXA 3NBAA 3B3QA 5F1OA 4CEHA 4WECA 3M5PA 4JOBA 1G1MA 2HY7A 2Y1OA 3AFOA 1TGVA 5CLLA 3A4TA 4DCCA 3VR6A 1EGQA 1JIUA 1POWA 1WUHS 2Z6UA 2EKPA 3KJGA 1H05A 1Q12A 4LBYA 1JWAB 3AU9A 1NLUA 1PZMA 4MW7A 1OLSA 4TZKA 4O5AA 1RIFA 3U39A 1EFCA 4IO0A 3CVWA 1N2OA 1MJNA 1GSHA 1VG9B 1BCRB 3QU7A 4IH4A 4OMDA 2X0FA 3UAWA 4KFCA 4OU4A 1Y1TA 1WDMA 2FW8A 3ADOA 3OOJA 4KQXA 3AEQA 3ECCA 3OQOA 4C29A 5JANA 3FTFA 3HPRA 1EINA 3L0YA 5BNWA 4Z1MD 2X4IA 1O95D 2ZTMA 3DNMA 4UCFA 4WZAE 1GGHA 1PSDA 4RHEA 1BXGA 2VTEA 1C4XA 3OE5A 3S2GA 3HY6A 4BP9A 5DMHA 3HCNA 5KQSA 3DT9A 2ZB7A 1IZ8A 4MV7A 4NDNE 3T3HA 2FN3A 1KJWA 2WYOA 3PD1A 4I1PA 1N1DA 1NQXA 3TBHA 4TTSA 3IB3A 1WA5A 4ID3A 3D6MA 4LJYA 5AKXA 5K3FA 2YINC 4LDQA 1PJBA 1S2DA 3S2SA 3WC4A 4ZT5A 1YQUA 3PA6A 1YO6A 3Q6IA 4CF5A 4DVGA 2NADA 3B36A 4PXYA 2GZHA 2V5UA 3I6QA 1NF9A 3B7WA 2AXNA 1EH5A 4N9QA 5GV7A 2OV1A 5MFZA 2I55A 3NM4A 3A1SA 3ONEA 1U0JA 3GJYA 3ZBQA 1GYQA 1JYFA 3ROPA 2RBKA 3O1HB 2P2LA 3OU7A 3GQBA 4G3XA 2QRGA 4U2CA 3V7WA 3ZZMA 2VUTA 5JLJA 1D4ZA 3K73O 1GP2A 1ZUIA 4LISA 5DYNA 1KGSA 4RKQA 1MPXA 2BE9A 2PHZA 4JXKA 2XWQA 5AKZA 3AVVA 5CU7A 4YAOA 2O1WA 3G6KA 5CDHA 3I9NA 3E1SA 4FXOA 4YECA 1O4VA 1Z2DA 4MZDA 2I6QA 2UKDA 3UG6A 4DWJA 1G3MA 4JLKA 1RAGA 5HUJA 1SEVA 1NVVR 3DDWA 3ZDAA 5ILQA 3SN6A 2Y05A 3DTVB 1YE5A 3O7WA 2XCOA 1XDUA 3JVIA 4RL4A 5IMSA 1ATZA 1RWQA 1JHRA 3EIQA 1USVA 3GU3A 1HK7A 1Y1PA 3NB0A 4JL8A 4D3XA 2PVCA 3T1OA 3BOSA 3REOA 2A9OA 1YZHA 4OQXA 4YRSA 2ZEJA 4IGIA 4MRAA 2HWKA 4JITA 1P91A 3IUMA 2WD9A 1SUDA 4XGKA 3OQBA 1SD5A 4W8OA 4DT1B 5KX5A 3INRA 5F9HA 4Z3DA 1QLJA 1GSAA 2BBTA 3W8NA 4ZMBA 1EGVB 1JLMA 4FXPA 5COQA 2Z6AA 1MD9A 2R00C 4FFPA 1IRIA 1IWBB 3R7BA 3MQFA 2ZJYA 5K4HA 1UOQA 5FWYA 3NKFA 4MQFA 2R6GA 3OTHA 4B2PA 5B4VA 2XB4A 5ARBA 2DC1A 2BOVA 4ZZ1A 3TG2A 3WNZA 5B1EA 5KNDD 1FJXA 4N5DA 4UHFA 2HNKA 3L6CA 1TAQA 3FYTA 1JFRA 2A58A 2H48A 4J0QA 1YBHA 2R8PA 2VK1A 4E6EA 2ZZMA 4BFLA 1XFAA 2WYVA 2PS1A 2PXCA 2ZJ1A 4EG5A 2I52A 3EZGA 3M1LA 4WJKB 1B8UA 4FFBB 3M6UA 4CUKA 2REXB 2CEAA 2X9QA 3ZGOA 1RAEA 2QAJA 1H0KA 2RJOA 4ND4A 4O4LF 4W9RA 2D3WA 1FYXA 4UNNA 2AN5A 3EE6A 1FFXB 4PQYA 4Q34A 1Y6FA 1NI3A 3T06B 3LAWA 2DLDA 4JLVA 2PYDA 3D9QX 4BVBA 3GLGA 1XXLA 3ZDCA 2VI5A 3GD5A 4F3CA 3U6BA 1M5TA 2ENUA 2E87A 2EQ5A 1KKUA 1NLMA 3K0CC 3K9NA 2OO5A 3QHQA 5FOSA 2BE7A 2ZTVA 3TI9A 4TUYF 1MC4A 3T54A 1H9CA 4XTCS 3RS7A 4JIMA 4RXMA 5KX5F 4RGYA 1GPMA 1KVTA 1B0UA 4YAGA 5FUQA 2B30A 2I7VA 2YZNA 3KVYA 3PHGA 3VJRA 2HK9A 2AC4A 4QT0A 3E3AA 3TX2A 1HDZA 1H6AA 2ICAA 1A9RA 3ZTYA 3ZV6A 2C9BA 1OASA 3NC0C 2IUUA 2FEMA 4CTKA 5B58C 1YZLA 3L8GA 1HZZC 4IHJB 5GV8A 4WIAA 5CVUA 3GZJA 1DMSA 1UQTA 4NMWA 2ZYAA 3O4RA 3QNMA 5L8VA 3AM1A 5ECYA 4Z9YA 4NQZA 1I4OA 2PEYA 3GJ3A 2LV8A 4Q1VA 1X7GA 5SYNA 3HCCA 3WDKA 1OH5A 3D02A 3KC2A 5LP6C 1U4OA 3NBMA 1WXGA 4FMPA 4H3KB 4CM6A 1EUZA 1K4MA 1OX5A 3L0PA 4DA9A 1QYDA 2QQ5A 2QN3A 5TEVA 4CMJA 2V8BA 3PCXA 2JLAA 2ZTSA 3G5AA 3B82A 4OLFA 5TV2A 1MABA 4XFDA 3U56A 4ND2A 2QRNA 4Q93A 2XOKD 3ORRA 2RG1A 4YJFB 3MPUA 4D3DA 4RGBA 4ECEA 1M2EA 1QRAA 1W4CA 4YP0A 3TNDA 5KU1A 1MGPA 4HTFB 3REFA 3WYBA 1N2EA 2X2OA 2E1RA 1TUGA 3NDRA 4OP1A 2ACEA 4DPMA 4GMKA 1UC5B 1VGQA 2VOEA 3I6YA 1EGHA 3I6ZA 1RYBA 2VPYA 2W8ZA 1C9KA 1L5WA 4FKZA 2Y4NA 3LK6A 4OHUA 2QWXA 5GPBA 2K7FA 3T95A 1I14A 1LLUA 2GO7A 2WF9A 3DBRA 2EX0A 1AJEA 4RNDB 2V3CC 3MMZA 5LMZA 4JEHA 3G0CA 4IMJB 4BVLA 2Q3CA 3VBEA 3B60A 2FFRA 3DE0X 4LAFA 1N5IA 1UWVA 1J99A 1DV2A 4LV6A 5GMOA 3OBBA 2YCLA 4TRNA 5FUMA 2P7HA 3C8DA 4G97A 1JEJA 1Z0UA 1WPGA 2RI6A 1T3SA 1GY8A 1KAMA 4OXKA 1A2BA 1PR4A 2X6RA 1UZNA 4IVPA 5T57A 4MUEA 4AMUA 4MV8A 4ZI7F 3DOOA 5E7JA 2GTPA 1VBMA 4M2LA 9LDTA 4F8EA 5KSWB 2RH5A 5IN4A 5J2UB 3ZVLA 3LHSA 1ORTA 2BFEA 3EZXA 4ZC1A 5JJ5A 3OSUA 4KV7A 3PTZA 4CG2A 1F8XA 5HUHA 4FB5A 5IF3A 2ZQZA 3GDOA 1R0KA 4YDHB 4Q3CA 5JDIA 1I2ZA 4CBVA 3NTUA 4UM9D 5F7OA 4BYGA 3QM1A 4WKOA 4X20B 2R7MA 2ZJFA 3VZSA 3WJ2A 3WBBA 1PFVA 3OQHA 3TFQA 3VDRA 3B3JA 3BM5A 3EVGA 3I61A 5L3RA 1UWCA 4R2KA 1KP9A 1ZGJA 1U2GA 1WZCA 3HCDA 4HGZA 4IILA 1ICIA 4MIOA 4R9NA 4WLNA 3N7AA 2P75A 1C3LA 1ECPA 4YCLA 5CTAA 1D5WA 2WB2A 2JLBA 4L15A 5K05A 4F3TA 4U6NA 1J24A 1H8HA 4U7FA 1XZJA 3M5WA 2B21A 1W4ZA 4RTPA 1HZJA 3HKEB 3NVAA 3LNCA 3W5CA 2ORWA 2R8EA 2OBXA 4WEQA 1QR6A 1PD1A 4TXNA 1RMQA 2DBZA 1PNRA 4OO3A 3C6YA 3IJ5A 3NFYA 3RF7A 1G8MA 2GRUA 2X8JB 3V4SA 3ZU5A 4B0PA 1O03A 4GOJA 3C8HA 4AI6A 5EYPB 3VNAA 3A04A 1GAEO 3ORHA 1Q22A 1M34B 1PBTA 2HWYA 2HA7A 2PKYX 3D0RA 1QNFA 4RKYA 2CHUA 4ALLA 2QX7A 3PVCA 1J0AA 1QH1B 2QMHA 4ARUA 4DWVA 1MQ9A 3TRIA 1PS8A 2G83A 2XBLA 1K97A 2YWFA 3BAZA 1T6XA 2JJ2D 2DWOA 4PGFA 1TM2A 4PFQA 3OOYA 2XCUA 3LVRE 3SPXA 1CUUA 1XNHA 1DFIA 3EIWA 1UJ4A 4ZTUB 1CQPA 3QYJA 2G5CA 3VR5D 1KY4A 4AO6A 2B94A 1CRQA 1SOAA 1NBMD 3VPCA 4NY1A 1B0PA 2ADFA 3I5YA 4AF6A 1NUPA 2Z0MA 5EXEA 1XVIA 3BDVA 4V0MA 1P6XA 3T41A 3BB1A 4W1RA 2CK3A 3Q8XB 4RULA 5JYCA 1WSDA 5F5XA 3VQTA 1AKVA 1H2BA 2Q3HA 4QYMA 1MVOA 1T8YA 2AEMA 5FOXA 3UYKA 1JHOA 2LVBA 2P68A 5I7WA 3EMKA 3K1AB 2OZEA 1H6CA 3WIDA 1GG5A 3KETA 2ZDGA 3INGA 4IBOA 5LZ5A 2PGJA 3AI1A 2DWPA 2ZSUA 3NBYC 3HM9A 1PUJA 3M2TA 1KQPA 1HT2E 1FDVA 2MSDB 1G3UA 3BMQB 3PXDA 3QUTA 4RDIA 4DA7A 1E8DA 4OOEA 4ZAYA 3KYBA 1CB0A 1D0VA 2Z08A 3GUZA 3LQ1A 1M6HA 2DB3A 4YNBA 3I30X 2J08A 3MYRA 4J2OA 1VHLA 4Q3AA 3W3AD 4ARSA 3HWX1 3O4VA 2DH6A 4MMYB 2GXAA 4AWBA 4QVGA 4R5MA 3ZZUA 1YI8A 4JEUA 2HBQA 2FHSA 2QAIA 4OV6B 3WGQA 4WPGA 1Y81A 4KYTA 1PJCA 4B0OA 4P2GA 4MWSA 2ZWAA 2FMXA 4YA6A 1JV2B 1TYZA 3NV7A 4K9OA 3RKRA 3P0JA 3KXLA 2WVJA 4D0LB 2G5TA 5E8RA 4KXWA 1UKCA 1LBEA 2REBA 4GU5A 1NVXQ 1V5GA 2QROA 1A5TA 5F9MA 2CXXA 3KB1A 1NBWB 1CEYA 1F8UA 4LYFA 3C0KA 2CUTA 4RH3A 4L6CA 2PU5A 4KQ9A 2OUKA 1JKJA 2DPHA 3GLUA 2POCA 1UODA 3ANYB 4J9VA 4UBLA 3UT0A 1ZO8A 1E0DA 4EDHA 1BFKA 1H93A 4NK5A 1L5YA 3HDGA 4Q4AB 5ESDA 4AKIA 1SCDA 2PIDA 3BWEA 3FZNA 3JS5A 4LI0A 1K7CA 1DFGA 4BO8A 4U2GA 1DBQA 3JPYA 1TPYA 1MV5A 3QA3E 1YVDA 4MRMB 1JIKA 1P2TA 3F97A 3TTWA 1LZKA 3T3MB 3U37A 2NU6A 3F5QA 2VBIA 1UZUA 1ENZA 2IHYA 3AEYA 1KDTA 3OG9A 3VKHA 5AW6A 4QQFA 4YDSA 4Y8VA 3G5LA 5JNVA 2HU2A 2O2SA 2KYRA 2HHAA 3UMJA 4CI0B 2KM1A 2P5SA 2W2KB 3HBFA 2W2NA 4GZ6A 2ZUCA 4ZPXA 3CR8A 5DYYA 4C7XA 4F38A 3TCXB 4MDEA 1YRQA 4I9UA 3D5QA 4XQCA 1AOXA 2OUIA 3TF5A 3GR6A 4ZVRA 1U2SA 3IUSA 3HCRA 4RPCA 1SOUA 4RY2A 5CA0A 2CL6X 3PHIA 4EKEA 5BSHA 4IJ5A 4XPZA 1XVAA 3ZQ4A 3HL4A 5LLDA 4QTXA 3H97A 5BWNA 8ABPA 2FFBA 3IILA 1T8WA 4WLOA 2AJTA 4ZO9A 2PJDA 1UJCA 3MPOA 5EWJB 5AXAA 4PN3A 2YDYA 3MELA 3UGKA 3WOHA 5I4CA 3ZGXA 2HDHA 3JQAB 3F7MA 4M0DA 2MU1A 3SLKA 4AMYA 1R8SA 3EF1A 4DR3B 3I12A 1XLTA 3PENA 1ST3A 2J6HA 3DQZA 1VHDA 2O48X 3L4SO 1HMPA 1TRKA 2FZKA 1LDNA 3KLMX 5E4FA 1N33B 3VGJA 3IBFA 1FU7A 2F1KA 2O3TA 2P9QA 2WSSD 2G70A 4JJIA 4X6XA 2ISCA 1PJLA 1KEWA 3H4VA 4URXR 2D1QA 4WY5A 4E2XA 2JLCA 4Z2AA 1YHZA 4MVJH 3AY6A 3TLGB 4EGJA 1WL8A 1OX6A 2OKCA 1W85A 4P7KA 4UVEA 4YRTA 4I1OA 2YNMC 3ORQA 4U2DA 1UP7A 2P6NA 5DI3A 1BG6A 2HWUA 1OWLA 2GJ9A 3LFUA 5JPIA 3WIOA 3AKDA 4HUQB 3EWSA 3KKLA 3CF0A 3LZCA 1F3OA 5BVHB 3LX8A 3BSSA 1W0JA 4HCJA 4PX5A 5DBOA 1N78A 2Q4OA 5CNJA 1C7QA 4MW9A 5ALNA 4C05A 2AZDA 4DOMA 3EFEA 4DIMA 1JDBB 5AQEA 1BHQ1 3DV0A 3G8AA 3PP8A 1WAMA 1SHUX 1E2QA 3CN9A 1DAFA 4DA6A 4DXDA 1ISFA 1XL1A 3PQFA 1QAMA 3L5KA 3LOQA 2GK6A 1DHTA 2ZRQA 1EK5A 3TH5A 5HIKA 1L5HB 1NR7A 1DO2A 4BP3A 1GQQA 2QMUA 3B53X 1FDOA 1XTQA 4C06A 2W6JA 4PFKA 1N0VC 5AJUA 4TTAA 4E5MA 3LC2O 4G65A 2GA8A 4QKQA 5CBPB 3COPA 1Z29A 2QP4A 4E2WA 1MJFA 4K9QA 5A1TA 1UR5A 2OHJA 1GGEA 3GHHA 1QS0B 3DEYX 4D9BA 2ATIA 4HB0A 1IIBA 2TYSB 2YJ6A 3BILA 3LXRA 1WWKA 1DEHA 4B9EA 4B3HA 1Y3DE 1ZD3A 3AHCA 4R31A 2VWQA 3TQCA 1D7AA 3QVGA 1V5EA 1Y8RA 4Z9AA 5D00A 3NEAA 1KEEA 2CLLB 3KO8A 4CEHB 3DXYA 2FGKA 3T4XA 3S70A 1A5ZA 4G0PA 5JC8A 2V7QA 4OQMA 5SYMA 1IVSA 1Z26A 3LLUA 4QDZA 5HDQA 1P19A 5ADUS 3HYLA 4PNZA 3ZBTA 2UAGA 2XUGA 3AUKA 4EKYA 2V6JA 1XCPA 1I8TA 1FFBA 4GT1A 4D25A 4X1KB 1OLSB 3QKRA 5FPPA 3Q12A 4EY8A 2ODAA 3ROMA 3VOAA 5D1HA 5JR3A 4HDKB 4MW6A 1ZD8A 1XEWX 1FVXA 4KX3A 1THMA 1QRRA 2QPTA 1SUSA 1EP2B 4OHBA 1F6BA 4I81A 1RQPA 3NO4A 3FDJA 3ILXA 3OJLA 4H0CA 4IVQA 4S3MA 2FLVA 4DV6B 1VXRA 2I62A 3MZ0A 1W34A 5DWDA 3CJTA 5EIBC 4ZCTA 5KWEA 2BR5A 4RF4A 4ZOAA 3RC7A 1NIJA 1QBKC 2I22A 3U5ZB 5JW6A 1QRUA 5AJVB 4PO9A 5BPFA 2DTXA 4UVDA 4X61A 3NLLA 2WM3A 3WA7A 4BAZA 1XN1A 4JB8A 2Q8PA 3UWKA 3UAXA 1LEHA 4M9RA 2G9VA 3X3HA 5H83A 4FEEA 3GLSA 3C6XA 2FWBA 3B8EA 4DLLA 1VE6A 3RG2A 3G6WA 4B6SA 5KTMA 2FWMX 4KXQA 1NUQA 3C16C 3ND7A 4O25A 1QXSA 3JYLA 4BLQA 2C78A 4E94A 2IPLA 2G7MC 4BKOA 3GRAA 3R5TA 4I3HA 3I45A 1CF4A 2OM2A 5HE8A 3W6NA 4DLVA 2OG1A 5AK6A 1OGJA 1YUBA 1P33A 1S7GA 1YWGO 2A8YA 1TAGA 3G9XA 3QWIA 1P7PA 1YJXA 2NUAA 4URZR 3R7FA 4R41A 3RFVA 4YUWA 1KYTA 1N9KA 1E5DA 2XIJA 2X6TA 3C6ZA 3R23A 3H2SA 1G9TA 3C8UA 3LK7A 1RMTA 5AI6A 1HOXA 1W8DA 2G1AA 2NACA 4C2AA 3BD8A 1IBSA 1T4GA 2ATXA 4KW7A 4LGVA 1R74A 1RHMA 4NOMA 5IKEA 1AX9A 2CSXA 1FP1D 4P5PA 1BOFA 2JIQA 2FSFA 4RHTA 5DMXA 5EFZA 4BTVA 2BUAA 2W43A 1CUFA 4JLWA 2OXTA 4WDQA 1G19A 4OQNA 4CDGA 3NBZC 3A28A 2BTQA 4MITA 2PMEA 2J41A 4LPSA 3PHJA 3A2MA 1H69A 1TAHA 3DWFA 4NV1A 4PYRA 1WUKS 3HBJA 4WJZA 2CDCA 4O0MA 1Z6XA 3PNPA 3W78A 2H17A 5CFNA 1YS2X 1O5TA 1B4DA 1CUYA 2OGFA 1WHSB 2C7BA 4WXEA 3I9FA 5CH3A 3BMNB 3DBLA 1XFDA 3DOCA 2VP9A 4YJ3B 3RUAA 3JV7A 4MGHA 1VFPA 3GT3A 3WHPA 4ZO6A 1DI0A 1FUEA 4NRDA 2O3SA 5D3QA 4LJ5A 4CF7A 2XB9A 1XHEA 8ADHA 2O05A 4U3JA 1SK9A 1W59A 1SVMA 1W1UA 4BBAA 5LDDC 2QUBA 3UC5A 3VOSA 3RWOA 4MQFB 3GVHA 1OYYA 2B8EA 2NG1A 1FRFS 3NGMA 1N0IA 1UXIA 3LQKA 4IHJF 1RWBA 2VT2A 4Q24A 5CVDA 3OPYI 3QU2A 1FYFA 3HBLA 1GKUB 3CVXA 4BMZA 1JH9A 3NAMA 5DV9A 2Y71A 4EHIA 5ADWA 4UW9A 5DOVA 4L95C 5AKHA 1UDCA 4XX0B 1SVWA 3H4TA 3M4XA 3PCRB 3D7SA 4BS9A 3ZJVA 1EUQA 2HK6A 1OWOA 4JA0A 4K6GA 1UIRA 3QIAA 3MLEA 1ZN9A 3BTUA 3RUDA 3KLPX 3TM4A 1W5TA 5KO2A 4KQ1A 1QB7A 2PT9A 3ZCRA 4L5CA 2ZAMA 3N3BC 4ZAGA 5IT4A 2C9DA 1L6IA 2FDCA 3GJ8A 1XB2A 2C8KA 3PUHA 1YR8A 4AO8A 4EG3A 4PBSA 4BB0A 1T5HX 1J0EA 1BVUA 2J9RA 2IS2A 1GUAA 5JAPA 4ASUD 4QTUB 4LE2A 4IIJF 2MTBA 2H2FA 1CY1A 4FFVA 3P52A 4ID9A 5CVJA 1GGJA 2PUJA 3U7RA 3WL6A 2V7PA 4DCJA 4R1UA 1XF1A 2H6EA 2WUWE 5SYAA 1GTVA 3RGWS 1U2RA 4TV9F 5DCWA 2C5BA 1NP7A 4KTTE 3MCTA 5EVCA 5D01A 4QYSA 5DM1A 3ZZNA 4AMGA 1TA9A 2ZS7A 1T4BA 1E9VA 1YAHA 3IHTA 1YL7A 1V8PA 1GTRA 3AONB 1UADA 3TLYA 3LSYA 5JCOA 1FLVA 4J0EA 1DC7A 5BSKA 1I6MA 1ZFNA 3KZCA 4WQMA 4ZC8A 1FMCA 4UHBA 4BL5A 3ETHA 4RXUA 3CLTD 4FUTA 1MABB 4IKEA 4YCNA 2KBEA 3FE2A 4UU7A 1RQ7A 3BD6A 3RS8A 4DB2A 5CD9A 4XE5A 4AY5A 1NW6A 3D7LA 1SK8A 3KT0A 3PV0A 4R8KA 4ML3A 4TVBA 2IGBA 2CMKA 3D0QA 5K4GA 1KEUA 1X8KA 1XRJA 3DXZA 4B79A 4HEA1 3LHFA 2OSBA 1EMDA 5FQOA 3I3SR 3VVMA 1RTTA 1L3BA 2FQYA 3ET5A 2IYZA 4Q9HA 2PZGA 3TL6A 1S2IA 3SHWA 3LC1O 2OV2A 1ICEA 1SBCA 2VTDA 4U7DA 1AS2A 5DXFA 1KO8A 3UF0A 3DKIA 4Z0TA 1WB6A 2QSJA 4RL6A 1TKCA 2HV9A 3NAGA 1H2EA 1TIBA 2GO1A 3QFSA 4INZA 1FIUA 2NWQA 1WW8A 4RU1A 1EFTA 3G7SA 5E38A 3ZG6A 4HVLA 4Z51A 3BGDA 3L7YA 4CU5A 4ZQIA 2VHWA 3KQPA 1A0OA 1XVUA 4UBOA 3ZHCA 1Z5GA 2CNKA 4K6KA 5HW0A 1U28A 2X42A 4JB2A 4QOEA 1K2WA 1NOIA 1WDTA 3OEHD 4BWYA 4O3MA 4CKWB 3MW8A 3A37A 3JR3A 1PEDA 3E9MA 3RJ9A 3MT0A 3EVDA 2WLTA 2VZLA 2CLDX 3FFXA 1NMQA 3CG4A 3WIBA 4A10A 5FLKA 2I66A 4BTEA 2AG5A 3OMXA 5KOHB 3B2NA 4PBTA 2FNAA 2KS6A 2BFEB 4I2VA 2UUCB 3F4LA 4D7AA 1SC4A 3LBYA 1TU0A 1GNVA 2OP0A 2X5NA 5CYFA 1D07A 4H17A 1GSIA 2BUCA 2DQYA 1D4AA 1JFTA 2BFFB 5DYGA 3H5RA 5F21A 4KIJA 4K9LA 16PKA 2UZ3A 4P7GA 4F06A 1NXSA 3PE3A 2GJKA 1V96A 1ZNXA 4GC9A 4R1SA 2VYVA 4JJ4A 3TW8B 2QN1A 2QI9F 1WJGA 3FAZA 3GDWA 3BJRA 3LT4A 4UAUA 1U0GA 1VIMA 4H4DA 1QGUA 3SC4A 2R7LA 1CFZA 1CUSA 1GTG1 1IEVA 4BZXA 4TVSA 5EAIA 2ZBQA 1LFDB 3I72A 4DSTA 3I9V6 1J23A 2RBEA 4QLBA 4AJJA 2NW6A 1U6JA 2PWAA 3IIIA 4DIUA 1YTUA 4B3XA 1AKUA 1V43A 3IT2A 5A4DA 2YV4A 4XCVA 3ZZ1A 1EDOA 1GGKA 1WDLA 2AZMA 1VG8A 4JSRA 4FZ3A 2XOXA 3HYTA 4QHYA 5KYYA 2IYEA 1FVHA 1P9RA 1YV9A 2R8OA 2XQKA 3K9LA 3O91A 3BTVA 3Q5GA 2Y77A 4I5EA 4RLQA 4EWLA 3ZJTA 1Y5IA 4P98A 2B1IA 2RFLA 1DBVO 2EFEB 4OUDA 5B4TA 4IGKA 3TNFA 1UPTA 3E5HA 4KQWA 1BRMA 2PXHA 4PSUA 2BSXA 1EFRA 2QJOA 5DGTA 4CFZA 4B85A 4IIFA 3J80A 4BQQA 2Q5EA 2SBTA 3DUFB 3I2FA 3VPBA 2VXBA 4U7HA 3T1TA 2QMZA 2GXQA 5NLLA 5CFZA 4CM9D 1Z15A 1J9EA 2J4CA 2WAOA 1BJTA 3VH3A 1VL5A 1CUVA 4EY4A 2CC2A 4IUDS 5AVQA 4ZT6A 5C4MA 2OORC 1G2QA 1I36A 4M99A 2P69A 3RTAA 4YAKA 2QVXX 4QBIA 1E3LA 2VTVA 3TTVA 1FTQA 1USUA 4CZ2A 3LRTA 1E3JA 1RWNA 2I34A 3HYRA 1G0NA 4UEJA 3HKCA 4G9GA 3SDZA 5I4KA 4MWOA 2WICA 3B9PA 3R0JA 3MOSA 4WBXC 1FFSA 3TVDA 1ZXXA 3PNBA 1NGSA 1TYDE 2EARA 3V2IA 1TUIA 5KTKA 1HQYE 4KUHA 2EW2A 3EGCA 1PDOA 3CZMA 3O9ZA 4XEUA 3ND9A 5ESWA 2IYLD 3HKDA 4GIBA 3DT8A 3L0ZA 2PK3A 4NJEB 1Z7EA 4JUDX 4V0QA 5K3AA 1W36C 2X41A 2HA3A 3I05A 1NUTA 4DLXA 1SH7A 5I9LA 1UP4A 2B35A 1CERA 3C3PA 1C1HA 1I2CA 1P9WA 5IARA 3VR2A 1WDKA 3QX3A 2WSBA 3KTAA 1XD8A 4L8VA 1M67A 1ZY2A 4JSYA 1Q7BA 3JVVA 4HEJA 1DWUA 2G4VA 3VFDA 1RCUA 2EL7A 3UHFA 5JNTA 1RE0A 5DZSA 5A5EA 2VDPB 1WUTA 1TKAA 2ZVQX 3G7NA 4IYJA 1SXJA 4Q4HA 2PBLA 4AZSA 1YR2A 2FPWA 4BVFA 5BQPA 5TLSA 5IMBA 4PQFA 5MFPA 1L9XA 3RC8A 1CE8A 1C0IA 2IGTA 3KD3A 1WX1A 3D7NA 3T5MA 3S2FA 1RZRD 1WW2A 2BD0A 3E2IA 4DMCA 5IBCA 1GQRA 2GR7A 1PTJC 2O2ZA 2OV4A 3R0QA 1X8JA 4DCMA 5L9AA 4R2LA 2C3YA 1CW2B 4ZYVA 2BRUA 4ZT4A 2YHUA 5BUCA 4QUHA 2O5EA 3EZYA 1YMUA 3CLHA 3CS3A 5I7FA 4XAQA 2ONZA 3P2JA 4AD8A 3HADA 5ENVA 2AOXA 3DF9A 4WSOA 2H1IA 4ZVVA 3JD1A 5J2TF 2QMYA 1T6BY 1SUEA 1SIOA 3KQKA 3THOA 4LHVA 3BDIA 4CIAA 2X13A 2IRWA 1N2SA 3AJ9A 4FYKA 5C3MA 4JSTA 3KQUA 1UBNA 4YAJA 1DT3A 1QGED 1S01A 4QFBA 2OENG 5G0WA 3UAZA 1LUAA 1DQNA 5EE5B 4AUMA 3VUEA 3EK2A 2NU6B 1LC3A 5J1SB 3LPLA 3FD8A 3PWKA 4MQ4A 4WXRA 5EMKA 3R7SA 5HOEA 1E9SA 2ZRPA 2H63A 1RI2A 5HF8A 3SI7A 4ZCIA 2YX1A 3FVWA 3HHPA 4CW7A 3G88A 1SWVA 5I7AA 3ZHZA 5DM60 4C1BA 1SKBA 1YSCA 2XQIA 4HNTA 2VDRB 2P2NA 3R6LA 4KYUA 1TE2A 4CXMA 5IAJA 2J09A 2R87A 4KBYA 5CA0B 3MWDB 1RLOA 4WKGA 3O95A 3UB3A 3V8QA 3Q8MA 2G9RA 3QSYA 2GB4A 2MINB 3K0AA 4Q0MA 1C0LA 2WLSA 1JDSA 1KPIA 1QIGA 1G2IA 1LPBB 3M6XA 1QYXA 2NO5A 2CFRA 2ZT7A 3PKIA 3TSYA 3HUFA 3DCIA 4PW0A 5AOVA 3QJ5A 1E66A 1RQGA 4QBFA 3RSOA 3DCJA 1FTGA 1SXHA 3IMCA 3JRXA 2QUJA 3EGWA 3K9BA 1KQNA 4DRXA 3U40A 2X76A 4QDT