3LE8A

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.70 angstrom resolution in complex with 2-(2-((benzofuran-2-carboxamido)methyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLASSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Optimization of the interligand overhauser effect for fragment linking: application to inhibitor discovery against Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 101
structure length 287
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3le8A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3le8A01
1KQOA 1KR2A 1OBHA 1XNJA 2GKSA 1F7VA 1N2OA 5DEOA 5K0TA 1VLHA 1G8HA 3IOCA 4CT0A 2EJCA 2VTBA 4ZT4A 3VGJA 3FETA 1JHDA 2CT8A 1K4KA 1N2BA 5FO1A 1K97A 2X1MA 1G8FA 2X0KA 3P0JA 3KT8A 3IVXA 2HGZA 1I6KA 2XRYA 2JANA 3VU8A 2DETA 5FO0A 5KWVA 3P0IA 1KAQA 1V8FA 3N2YA 4H3SA 4EG3A 1FFYA 4MWDA 1GPMA 2A4MA 2D54A 4ND7A 3X1JA 4R0NA 2DXIA 4MUKA 1O97C 5DB4A 3PNBA 4F4HA 1NP7A 3IOEA 3K9WA 1KH2A 2IJGX 3RK0A 3ZJUA 4MW2A 1MOPA 1T6YA 4MAFA 4WSOA 2CYCA 3H9CA 1IRXA 4EG1A 1MRZA 1IQ0A 2ZUFA 1NSYA 4ARIA 4QBTA 4S1OA 2X1LA 3ZXIA 1YULA 4K0RA 1JILA 1OD6A 2CV1A 3IDFA 1BS2A 1Q77A 3PNYA 4U63A 5AHWA 1J20A 2HMAA 2H29A 1J09A 4ARCA 1XJQA 5HUJA 1F7UA 1KH3A 5LM3A 2PZBA 1N3LA 3RFFA 1I2DA 1TQ8A 3TZLA 1TYBE 2DEUA 4L2IB 1JIIA 3FIUA 1JEDA 2QJTA 1N2HA 3FH0A 1OWPA 3A04A 3RBAA 4CDMA 5IHXA 1M8PA 2EL7A 3IODA 1IHOA 3CVYA 1O96A 3VRHA 1O6BA 4MVWA 1Y42X 3L93A 4NAHA 3QTTA 1JZSA 3CLUC 3UMVA 2RE8A 3AFHA 5IJXA 2XRZA 2BTEA 1FYDA 4KR7A 3SZGA 2O8VA 3ELBA 3ZUGA 1GAXA 4KR9A 1PG2A 2CV0A 1GTRA 1OWNA 1TYDE 4JFAA 4MVYA 3Q12A 1WOYA 3Q10A 2J09A 2A7XA 1D2RA 4GRIA 3IVCA 3RHSA 2CV2A 1O97D 1R6XA 2GM3A 3GLVA 3S3TA 4G5YA 4YMIA 3IMEA 1KAMA 1M8GA 1RQGA 1QRTA 4NDAA 3CVXA 3JXEA 2V0CA 2DPLA 4Q16A 3K32A 3X1MA 1VBNA 1QRUA 2CYBA 3A05A 4E1AA 3OTWA 4DDMA 1R6UA 1WXGA 3H05A 4MWEA 2D13A 4G6ZA 1PFVA 1UFVA 4CQNA 1EFVB 5HG0A 4YBRA 3FI0A 4NAUA 1QU3A 2WB2A 2A1TR 1EUYA 1OWMA 1TYCA 2PZAA 2QUIA 1QTQA 4YP6A 1XNHA 3P52A 3PNVA 4K03A 1VL2A 3MMXA 3NBKA 2E89A 5K0SA 2WQ7A 1GN8A 3L92A 3ZJTA 4HK4A 4TS1A 2A88A 3CLUD 3HGMA 1U3DA 2DR2A 4MWCA 1J21A 2OV4A 2Z08A 1KP3A 4ND6A 1GTSA 3ZIUA 4MW1A 2PFSA 4DNXA 3KFLA 3N9IA 3MXTA 1YIDA 1N2GA 1F9AA 1V47A 1J70A 4MUFA 1MB2A 2A84A 3D6UA 4NATA 1WXFA 1OBCA 4MUGA 4HJRA 3N8HA 4MVCA 4Q93A 1NUTA 1KORA 1WY5A 3ND6A 1JGTA 4OJMX 2YWBA 2NZ2A 3IUEA 1YUMA 3GMIA 1TEZA 3TQOA 1EUQA 2HZ7A 1G8GA 1K4MA 1CT9A 1K92A 2OQ2A 1O95C 1U3CA 4DE5A 1LW7A 2E18A 2BYTA 1EFPA 1ZH0A 5EKDA 3RK1A 3HV0A 3MLAA 2YY5A 3X1KA 2J08A 3LCJA 4OUDB 1WXHA 2C5SA 3FY4A 4ZT6A 5BNZA 1H3NA 3CR8A 4PBTA 1JIJA 1Q11A 1M1ZA 2H2AA 4ZT2A 5LFAA 1O0BA 1N2EA 1VBKA 3FHJA 2J4DA 4MUHA 1ZH6A 4MWBA 1XNGA 3H99A 3A4IA 3IMCA 4PBRA 4MQ6A 1O5TA 2JA2A 4DJAA 4A91A 1MJHA 1N2JA 1Q19A 4EGAA 5J58A 1QU2A 1J1ZA 2CFOA 1KH1A 1ZUNA 3CLSC 3CLTC 3IVGA 1ZJWA 3H97A 4UZEA 4AQ7A 3BL5A 5TEWA 3FNRA 3SEZA 1WQ3A 2PZ8A 3KT3A 3TZEA 3P0HA 1T9GR 4ZT7A 3AG5A 1N78A 3H9BA 1OWLA 2NSYA 1EXDA 1Q15A 1PFWA 1NUPA 3LOQA 3FDXA 3Q4GA 4J76A 2A1UB 2QUKA 1MAUA 5H7XA 1N77A 1KQPA 3AIIA 1O94C 4MUNA 1H1TA 1EJ2A 2GOYA 4R2LA 4XFJA 4DDHA 1N1DA 4NZPA 4MW4A 3UK2A 4MUIA 1KKUA 1SURA 1O0CA 1M8JA 1WXEA 4XSVA 2VTBB 1N75A 4ZT5A 5LLTA 2VXOA 3TNJA 4ZT3A 4AS1A 1NI5A 4BWVA 3IH5A 1O95D 2I1LA 3HMQA 5KHAA 4EG7A 2CSXA 3KT6A 1JEEA 3CVUA 2CUZA 1ILEA 2E0IA 3AKZA 4YP7A 2IP1A 4L2IA 2V0GA 1N2IA 2DERA 1EE1A 4KPUB 2JAXA 3G5AA 3UY4A 3SYTA 2TS1A 3NV7A 1IQRA 1MAWA 1MBZA 1NZJA 1H3EA 1IH8A 3M5WA 2DUMA 2PXHA 3I05A 4PBSA 3QTBA 1YIAA 5JBNA 1LI7A 5TEVA 4YP5A 3F3MA 1QRSA 3CLTD 4EFKA 4I6GA 1IQUA 3FWKA 1NURA 4MVXA 3ND5A 4MUJA 3CVWA 3AL0C 4KKVA 4JYZA 4EG6A 1I6MA 4J75A 2AG6A 3MUEA 3SZ3A 2X3FA 4ZCQA 3GUZA 4GU5A 4MULA 1QNFA 3IOBA 1U0BB 1O94D 2QUJA 1MB9A 1WXIA 3IUBA 1COZA 1WKBA 1YI8A 3ISJA 4EG5A 1P7PA 3IMGA 4MW5A 1S4MA 3PXUA 2J07A 3SEQA 1O96B 4EF6A 4ZCTA 1I6LA 2A1TS 4R2MA 1VBMA 1M83A 4I6EA 1EFVA 4KPUA 5KCMA 1JMVA 4CDNA 1TYAE 3SP1A 1ULHA 3QE4A 5J59A 2QTNA 3MLBA 1R6TA 1GLNA 2WQ6A 1HYBA 4DLPA 5TS2A 1DNPA 2DLCX 2J5BA 2O5RA 4WNYA 2R5WA 3NBAA 4G5FA 4U7JA 3ILVA 1YUNA 1X6VA 1X8XA 5J5AA 2CYAA 3G6KA 4ZCSA 1H3FA 2ZP1A 4F3RA 2PIDA 3HZRA 3UC5A 1TFUA 4MW7A 1QQTA 4FZJA 3AG6A 1PFUA 1WQ4A 3A2KA 1M8KA 4U8HA 4JXZA 2QJOA 1JZQA 3LE8A 3CA8A 4QRDA 4JZYA 2QUHA 1B6TA 3TS1A 3COYA 3HL4A 1KP2A 1NUQA 5DASA 3CLRC 3CVVA 1IFXA 1OWOA 2G36A 2WSIA 2YWCA 4RPIA 3DV2A 3FOCA 3C8ZA 3ND7A 4MUEA 1JECA 4MW6A 3TQIA 1A8HA 3U1VA 2QJFA 4UZFA 3ZGZA 4QREA 4KR6A 1MC1A 1NYLA 2Z09A 2ZUEA 2IELA 5FNZA 2A86A 3KT0A 5TGTA 5F23A 2YXNA 4PY2A 1QJCA 4X0EA 3E27A 1F4LA 2AKEA 2Z3VA 1IVSA 3PRHA 3OP1A 3INNA 4OUDA 1U7XA 3DO8A 4ZCRA 1T6ZA 4DDKA 1M8FA 2E21A 4EG8A 1PFYA 2AZXA 4HJXA 1WZ2A 2B7LA 4MW9A 3COWA 1LI5A 3D6VA 3N05A 3RJZA 1G59A 5HUHA 4I6JA 3ZJVA 3G59A 4MW0A 4XFDA 5H16A 4NX2A 4ZCPA 2D5BA 2RD2A 4EG4A 1WJGA 3COVA 1JIKA 1T9GS 3DPIA 4JXXA 3DLAA 1J1UA 3HFJA 4MLPA 1NUSA 4HPWA 3UOWA 3CLSD 4RUKA 3SDBA 3ZXSA 2QTMA 4P2BA 1GZUA 1T6XA 5DK4A 1U7DA 3CLRD 3FG9A 1NUUA 1EFPB 3COZA 2PG3A 2QTRA 2A1UA 1KQNA 1PG0A
chains in the Genus database with same CATH superfamily
1R74A 2ZYUX 2ANBA 3EMOA 3BD9A 3LDAA 4NZNA 3IAXA 1OC4A 1NW5A 1TD9A 1YDFA 4X8OA 4Q21A 1U3VA 4EL5A 1Z7WA 5MDHA 3WKCA 4OLBA 5I9NA 5K3BA 2J3LA 5KSWB 3CM0A 4EITA 3WB1A 4BJ3A 5E38A 3UHAA 3IR6A 4AF6A 1IMOA 1Q14A 2LD4A 3EGXB 4KLRA 3CONA 4RXTA 3FETA 4ZYYA 1EGMB 4BFVA 3GN1A 4AJIA 4HVCA 2G6TA 3NEYA 2IP4A 5GONA 1Q95A 1XQXA 1KE2A 1A2OA 3BMCA 1LA2A 4ZVNA 3T52A 2C9OA 3PQ7A 1KMQA 1JJIA 1UR5A 3PGVA 4KTTE 3JW8A 2RHBA 4J1QA 3JR3A 5KNCD 3QMVA 5SY6A 1TU3A 2QX7A 3N0WA 2D5AA 4Q4JB 5IEJA 4CGZA 1KI7A 3FPSA 1SJ9A 1UXHA 3M6XA 3KEOA 2EU8A 2A4MA 2QMEA 5C1IA 4TSKA 4N41A 3E58A 2RG1A 5JNRA 2HPAA 3RSSA 4OXQA 4MUKA 1MX9A 1SXIA 2QTZA 2AK3A 1IBRA 1J0DA 4F4HA 1N0WA 2WUEA 4BIMA 2QZZA 2PQMA 3FE2A 1QO9A 4CEIB 4RKRA 1VJ0A 3T4PA 3UT6A 3UFBA 4CUZA 2AEEA 1AZSC 2WV7A 3DFFA 4IDDA 5BW0B 1SBIA 2HK8A 4AN1A 2F55A 4IG9A 1Y3FE 1XTVA 3DVAB 1YQXA 4ER0A 4Y2QA 1DT5A 5FBVB 1P2BA 4B4WA 5SYAA 2VOEA 1YCGA 2CCKA 1BS2A 2E82A 2WUFA 2X5OA 3C4QA 2RHWA 3RYCA 2P6PA 2F43A 3SG0A 2AW3A 4Q7LA 5GAJA 2ZYIA 3H1FA 4KNYA 2Q6KA 2O0LA 4OJKA 2OO5A 4HMOA 4S1VA 4B7XA 1ODTC 1CUUA 2XB9A 4G0QA 1XMJA 1G2OA 4UUPA 4NR0A 4P6VF 2YDXA 4P3XA 1FUUA 5F4ZA 5DKFA 5LB4A 3C14C 4RCVA 5HPYB 4TTVA 1LPMA 1MPXA 3FXAA 5EZSA 3MYYA 4UCXA 3NTOA 3VO8A 3OIDA 1U9JA 1CB7A 3LHSA 3R3VA 3MGAA 1A98A 2BGLA 3GJXC 4FC6A 1AF7A 2D62A 4FFBB 4I14A 4BRZA 4LF4B 2EW8A 2HDNB 2J6BA 2BUAA 1OYOA 2QGNA 1E2LA 3GJ3A 3OT1B 4MR7B 1DXYA 4R8MA 1TUGA 1XEAA 1DWOA 2Q7OE 3U9LA 3OZTA 4DB4A 4G0YA 4PC2A 4YJDA 2BMWA 2PVPA 3OCWA 5CT8A 4ZXFA 5IYZB 5JAUA 4L0DA 4M8NE 2O2CA 3HP1A 3MYRA 1RTKA 1OTXA 1EM8A 2R11A 4UHEA 5CJJA 2PRKA 3R8CA 1Q12A 4F5DA 6NULA 3S5UA 5C4IA 3WGZA 2PWPA 4AMZA 2GAAA 4GMGA 1JDSA 1N3YA 2J09A 2W83A 4I8DA 2OHGA 4KZKA 4FJ1A 1KRXA 1DQYA 2FRDC 3JQ9C 3RUAA 3I9MA 1O57A 1JUDA 2NYVA 4UBKA 3DYBA 3ZR4B 3DVQX 3EDRA 3UMRA 3IMEA 4FSHA 1H2XA 2Q99A 3SJUA 4A8PA 1Q57A 2OHXA 2IW1A 3BRQA 4GZ6A 4LG1A 2FPGB 1HQKA 2ILTA 2B6HA 5MF6A 3DA8A 2FFJA 1LNQA 1CE8B 2VHTA 3ZV4A 3R0JA 1L7QA 2HPHA 3X1MA 1OXMA 2CYBA 4E1AA 3ZGVA 5DX8A 1FIUA 4RTPA 4NENB 4ENTA 4D4LA 4R51A 1N0HA 1Z73A 2G1JA 3AHGA 3E5MA 1BE0A 3TUZC 1H2ZA 3SZRA 4C0LA 3GLHA 5FF9A 4YRNA 1LSOA 3VHQA 2VUTA 3IT3A 3LUGA 2JK1A 2VQ6A 3I2JA 1QFZA 3DMNA 3FI0A 3N07A 4WCFA 5FT9A 1QX4A 2FETA 2YV4A 4RETA 4BU0A 1QQBA 4I0WB 3E03A 5ALKA 2QUIA 4F1JA 3K15A 1Z2EA 1AUXA 2PZLA 3H7IA 1WU7A 2XTJA 4JV5B 4OA5A 1UK7A 5FP0A 3EXEB 1GRRA 2YHUA 2FN3A 3G23A 1A7UA 1YR6A 2AN9A 1UMDA 4G4SO 3C3BA 1N1EA 2HIMA 1Z0DA 1EJBA 3AFIA 3M9XA 4QTZA 5B12A 2BMJA 2H1VA 4OBEA 5AKXA 4MVJH 3ZJTA 1CQIA 1FU4A 2BZ0A 2HWKA 2XLCA 4TL6A 2A88A 2HSWA 4YJGA 5FRDA 2XR1A 1UBCA 1SU4A 2Z6QA 1R64A 3HACA 5T4BA 2A94A 5E2BA 2YQ5A 2N0SA 1NE7A 2VHEA 2OY0A 4ETIA 1QCDA 2AUTA 1Z7GA 1XYVA 2OBYA 4XFKA 2PFSA 4L02A 5I48A 3U4DA 4V0QA 1QMGA 1KYYA 5JAOA 3I53A 5C51B 5K8VA 3J7AC 2W4IA 1DJNA 2XODA 621PA 1FUKA 2Y0CA 4PFJA 2DG2A 2EZ8A 3OC0A 4HYQA 1HE8B 2GHQA 1M54A 3CRMA 2I4MA 1KK0A 4HGZA 3PXGA 3WDKA 1ZAKA 1KORA 2WFAA 2PBFA 3E3MA 3OOHA 5I5GA 4Z7OB 4MVJI 3OAAA 2W2QA 1EUQA 1JAXA 1ESNA 1R9GA 3RUHA 5ISMA 4JLDA 2BL4A 1TVMA 3EFHA 3AW8A 1M1NB 2W4MA 5TSDA 1K92A 3ZY2A 1V3UA 3QIVA 3PXBA 3FM9A 2BFDA 1QUFA 1SIOA 4HNQA 2A5JA 4DVGA 2OILA 3C43A 3R5JA 4UD2A 1AMUA 1G66A 3KPVA 2G5TA 5DTEA 2JIPA 3D3NA 1PFGA 3B8EA 4YAGA 3GLQA 1HSZA 1XZJA 1F8XA 4U2GA 4ZVUA 1ZKMA 2ZVPX 4KQCA 1HE5A 1RKVA 5PGMA 4E07A 3AJRA 2QJWA 1CHNA 4UFOA 4B17A 1GPH1 1KIMA 1M5UA 2C8JA 3DWGA 2V5AA 3IPCA 5J4VA 4ABYA 1M2VB 1E0JA 3B5JA 4U00A 4ZZ1A 1UMCB 3NM6B 3ZLTA 3FHJA 2Z6AA 4X1OA 2CVHA 3T61A 5KU7A 3B6ZA 4DR4B 3LXRA 1HT1E 2CHFA 1GGMA 5A03A 4I5DA 3ACCA 5EIHA 2FG5A 1CR1A 1YB7A 4AMBA 1DO0A 3C5HA 1XMOB 4KGZA 4YPVA 3ZVKA 3OJCA 4BLUA 2R6FA 1F20A 2RGAA 3D02A 1RAFA 5A0FA 2GESA 3R8XA 1MGOA 3GPCA 4B74A 4AQ7A 2ZUCA 3QVJA 1L7RA 4TSFD 4G5XA 1DU4A 4G97A 1BQEA 5TEWA 5CVTA 3CB4A 3KZXA 5K01A 1DMRA 3P0HA 5IJAA 2Q6LA 4MTCA 1FQOA 1ADYA 3QOXA 5I7SA 4MP8A 3T5PA 3ZBUA 5DNWA 2UVPB 1XT6A 3SF8B 4QTYA 1VTKA 1ZLYA 3QVOA 4Q34A 2H2FA 5CURA 4A23A 3I0NA 1YSCA 5F5XA 4EENA 3IMFA 4HP8A 4UDOA 5FEMA 3V8BA 4YMTA 2V9PA 2CCJA 4YP0A 3EDYA 2YFKA 5JPDA 5LJIA 2QW1A 1N6LA 4J3FA 3H13A 4YWJA 4C0QC 4LMAA 3VZCA 5F2NA 1CNMA 4NBTA 2ATCA 5K0NA 1E3MA 1U6JA 2OFOA 3ABOB 4DDHA 4XFJA 2ZJ5A 1ZK1A 4BFZA 4FM9A 2FSFA 2Q2OA 4R81A 1EEHA 4X66B 3UKOA 3UM9A 3UOAB 1U1GA 1WXEA 3NH9A 4B2PA 2HW8A 3F8SA 3Q7PA 4AS1A 2CSXA 1HDEA 4MV7A 4ZVMA 2B1GA 4BO1A 2Q3DA 2PJRA 2A67A 3L8ZA 2P3LA 1CK4A 1IMJA 3BJIC 3VPHA 3CVUA 2GX6A 1QHIA 3D4OA 3AVYA 1VIMA 2GLTA 4EJSB 2IP1A 4I1RA 5DLYA 2C54A 1MJGM 2XE6A 4L2IA 5CVUA 1N3IA 4EVSA 2DERA 3LM8A 3WDMA 1E0AA 1R12A 2NUBA 3FKSD 1TK3A 3FUUA 4H4CA 1DAIA 3I5MA 5THKA 5JCJA 2QTGA 4GE0A 4Q3NA 5TNXA 1YCDA 3LDFA 2JPDA 3K6RA 2ZYTX 3ZWQA 2E9SA 2OR3A 3NHLA 2PUTA 4A6XA 1Q2UA 1CS0B 1P80A 5DHFA 4L16A 4CLDA 3OCXA 1PSZA 1PX2A 3QZUA 2IEDA 3N2EA 5TPWB 1SKMA 4O2LA 1XTTA 1YFLA 3R6DA 4RD3A 1W88B 4O08A 5ED4A 2XQKA 1CUZA 1Z74A 3PT5A 3H3JA 1ITZA 1IQUA 3TSZA 1MC4A 2J85A 3FBGA 3SEFA 4LQDA 3Q3CA 4J0CA 4OQLA 1JDVA 4XARA 1ISSA 3P2OA 1N5MA 4IJMA 1T9DA 3W3AA 5KYTA 4JYZA 3K0CA 4BO2A 5JW6A 3SJZA 2X86A 3MUEA 1JWBB 3SZ3A 4ZCQA 5BPHA 3M6MD 4Q4HB 1W73A 4LZAA 1DO8A 5DCWA 4JI1B 3O8BA 4Y2JA 3AO0B 3C3YA 2A9JA 1MB9A 1SIUA 2B30A 5AJYA 1XRQA 1Y81A 3OEHD 3PV0A 2EW2A 3DJYA 4NI5A 1GZ7A 3OM9A 3IUBA 4RPGA 4TXNA 3K9FC 4EFLA 1P4GA 2DFLA 5EOVA 4DHWA 1LZLA 1TCVA 1A76A 1W9HA 1LKZA 1R16A 2XMRA 4E88A 3W5VA 3IIEA 5EXDA 2ZDHA 2GA8A 4FEAA 2VTVA 2GRUA 4IHKA 4TKLA 2D2FA 2ZFUA 3WMEA 3NV9A 1Z6TA 3CWZA 3OWHA 5F3WB 1WU8A 2MWMA 2VSQA 4BNKA 2ADMA 1XELA 1P1HA 4LWPA 1TRKA 2XD9A 2NX2A 2N1MA 2VO1A 2WVJA 4G5OA 1LFAA 1YZHA 5FWXA 3EC1A 1NJGA 4AXXA 5CFOA 5LQKA 4MQUA 1CUAA 1GZ4A 2W71A 4HLNA 1Y8RA 1Z2CA 2G28A 3K1AB 4DLPA 1V8BA 2XNDA 2X1VA 1XD2A 1Z38A 1T0IA 4RNCA 2BDTA 3OFND 4YMSA 4KPYA 3WWOA 3EZGA 3ZZ1A 1UBNA 4HUQA 4GX5A 5ESRA 3OEYA 3HSSA 4LSZA 1RJEA 3AFOA 3TUJC 1XOIA 2QTVA 2WJ3A 2A0WA 3G5UA 1ZR2A 4IFEA 2WINI 5EP3A 3FCUB 1YQ9A 5HF5A 5J23A 4Z7JA 1V7CA 1NUAA 1T8TA 2PWZA 4QWWA 1KERA 3GRUA 2PLRA 3FTQA 4KIFA 3KAKA 4O4JF 1Q7BA 2J5KA 4UM9B 1KGDA 4M8IA 2YVLA 3WLPA 4P0PB 4U6QA 1Q0UA 5HOEA 1JDTA 4GS5A 5AQEA 4KVZA 2P79A 2HSJA 2ZYAA 3IJEB 3PGJA 3SBDA 1HFWA 3ZD7A 3OOYA 3LZCA 1MIOA 1K5GA 1WUIS 3CLRC 2Q0SA 1W4LA 3FMGA 3DEKA 2GLUA 3CUKA 4HRYA 1IFXA 4JYMA 4OY3A 1JNYA 3A6PC 3ZI7A 4GUAA 1DRJA 1W2GA 3NBXX 2O2HA 4NBVA 4MIEA 4Q39A 2BMAA 2GR9A 3TQIA 3BL6A 4U02A 1A8HA 4OXYA 1G8MA 3R6LA 2BEVA 2FPWA 2WMDA 1JR2A 2QM8A 4ZAXA 4CE6A 4WA7A 3VSCA 5IMSA 5L6MB 5JQGA 3IJPA 1ZOSA 1KOGA 3M9LA 1Z0IA 1V8ZA 1DELA 2O20A 4KR6A 1X7ZB 2ZUEA 3WKDA 2X0IA 3UJCA 4ZIRB 4DM4A 4DW8A 2Q29A 2P2GA 1I10A 1EX1A 2UUCB 1H0RA 2FDRA 3B6EA 2WW8A 3FUWA 3G0CA 5A4KA 4DUZB 3G5TA 4X54A 2B34A 2EYUA 5LLSA 3CINA 1KDVA 4QYTA 1GXSB 2OLEA 2B69A 3M5DA 4WDRA 4IXTA 2E6UX 1WF6A 1FJGB 1U7XA 2PY6A 2YWRA 1C1XA 3NQ41 3GZNB 1M8FA 1HTWA 4JYCA 4Q1VA 3AVUA 1NV9A 2AEFA 1JLLA 1GSAA 1ZSNA 2W00A 2X9QA 4QZVA 5JT1A 1QG0A 1WZ2A 3ENNA 4EM6A 3I92A 2OLKA 1TC1A 4E15A 3QOYA 4RD1A 5KJFA 1J39A 3FSRA 3BMQA 3N05A 3PNQA 4X1IB 3CTPA 2HJWA 3PFKA 3SEAA 2C2MA 2C5LA 4RAOA 1GCUA 1XDUA 3DZ8A 2YC2C 3RJMA 4MMZB 5F2KA 1QV9A 1GTL1 2JLVA 1A04A 4EG4A 4HRXA 1ZIOA 3KOZA 3BPSA 5DU2A 5FL7D 3WIVA 3CUWA 3K7EA 3CE6A 4IIFA 4AJEA 4F45A 2VHYA 1XJWA 1D07A 1L4UA 3UJDA 3G2IA 1Y33E 3ROMA 1FUIA 3IC5A 3PF8A 5CDGA 3HTXA 1G1AA 3RU2A 5K0CA 1VIYA 4GGPA 4C6TB 5EGNA 5KYWA 4BMYA 3FG9A 5TX7A 3IEPA 4RL6A 4EBBA 3GLIE 1WZUA 2J9FA 3HBLA 2HQOA 2ZM6B 1FTNA 3IP6A 2QD1A 2NQ8A 1ZRSA 4P54A 4U7WA 3E15A 1GDTA 1KQOA 1X0VA 4LZWA 4CTKA 4Z1MD 5KNCA 2JZNA 3AINA 1BXGB 1VPDA 2FFHA 1YBFA 1YS2X 3GUYA 3O8NA 1FFCA 4P7KA 3K5HA 4Z4HA 5KO2A 3IOCA 1PJRA 2R8YA 2O1EA 2XPCA 1V3TA 4CF4A 1K8RA 1Z0KA 1FZQA 2ZBRA 4XWGA 2XB6A 1JHDA 1GIAA 4H0FA 3C41J 1AKMA 3EZXA 5AVTA 4KN6A 2VDOB 3FGPA 2RDMA 3FYCA 4RKYA 3CH7A 3P0JA 3UKDA 1E0KA 4F3KA 3OKPA 5LXTA 3WFJA 2HEGA 2JNWA 3UZUA 3IVXA 4LYAA 1E3TA 5TJHA 1TW3A 3HY4A 3GYGA 4UXIA 4B3JA 5DN9A 2O2EA 4BNDA 4BX0A 4PAGA 3FWZA 4I1SA 3CW2A 2YCBA 4RVUA 3IKTA 1PT8A 4QYIA 3DEFA 2VJYA 4JJKA 4Q1EA 4N8DA 3WLJA 1G7TA 1A88A 1WSWA 2QD5A 4KIJA 4XX0A 4RK7A 1AHPA 2QT9A 4BB0A 1C50A 1PL6A 4H59A 1KI8A 1PL7A 3RJTA 5L3QA 4MDEA 4KXVA 1C9NA 1ZW1A 1G2PA 3FGNA 4O4LF 3ZCTA 4ESHA 1HYGA 2IPAB 2DPYA 4IX9A 4D3ZA 4J4BA 4L4SA 2OESA 5GM1A 1T6YA 4O2AB 5K09A 3T1OA 4EUFA 4ZVOA 3RW9A 2IHNA 3NBMA 2Y1OA 4CG0A 3FOAA 2H2DA 3K2EA 4G0OA 4DQUA 5IWCA 3RFVA 4B76A 4EB3A 2D8AA 4H4DA 5ECWA 3H2YA 2VDKB 4N82A 2BI7A 1R0KA 2C2YA 4ZA2A 4JI6B 4CL2A 1S9HA 4B46A 4TWJA 3IDFA 3I61A 2JLZA 4LHVA 1ZX1A 1ZHHA 1EFDN 3B3QA 3G7SA 4FQ8A 1D2GA 3P0RA 4WKPA 4ENPA 5KX5F 4BJHB 1H22A 1KU0A 2MJLA 4FDTA 1QGUB 3PXXA 2CMKA 2F9LA 3GRKA 4Y2HA 1UZLA 5KWIA 3BC1A 1EFRD 1FTQA 2CEKA 1MGPA 3IMKA 3F4KA 2SHKA 3O94A 2QVCA 1CUIA 1K75A 1U1DA 1ZU5A 3PX7A 2AC7A 3DVRX 2BFCB 1B0AA 4HATA 2HA5A 3OJOA 4WFQA 4F9EA 5CYGA 2ZBFA 3P9CA 1FJXA 4NBRA 2BM0A 2P4SA 5K6TA 3NEPX 1EA7A 2BFFA 4ZKDA 1P6QA 4NCBA 4EHFA 4WBNB 2J7PD 5BVGB 2JFFA 4H7FA 3QEBZ 1O96A 2C98A 4GEGA 3E2IA 4GWKA 2Y0BA 4AD8A 1Y42X 4TYYA 2HA3A 4O0MA 2UYGA 3CV3A 4C2AA 4BQFA 4EHKA 1VMDA 5BMVA 4CM4A 4XA8A 3TPCA 1XU9A 1R6VA 2C57A 2O8VA 3JYLA 4I46A 3SZGA 4ZK2A 3ZUGA 1GZHB 1YK1A 4QXOA 2YS7A 1C9DB 1LLDA 4XQEA 1Z4KA 4IDNA 1P1JA 2HPZA 1K3FA 4X1YB 4ZDJA 1XTKA 4O4IA 3B3GA 3ROEA 4N01A 3S8MA 3M6LA 3A3OA 2XUFA 1R6XA 2B99A 1BWPA 4MMYB 4Y6QA 4AB1A 3ORRA 3QEMA 2ADFA 5EZQA 1KEVA 3EYAA 3VO9A 4ND2A 2Y0EA 3SVTA 4LMBA 1M8GA 2WWHA 2GQ0A 2ZPTX 3E22B 3GCDA 3SGLA 3T34A 3V7UA 4O8CA 4JLNA 2IDKA 3AERB 4N5HX 5FUWA 3GLGB 1IOWA 1EX7A 1GPJA 1SZJG 2LIVA 3A3PA 3CKLA 3SI7A 3T12A 2DPLA 5BOVA 7REQA 4GWLA 2Z56A 3AY7A 4DDMA 3DC7A 4KR0A 5H0IA 3R9XA 1EP3B 1CEEA 1J5PA 1SHJA 4XDYA 3WLFA 3PPIA 3D8NA 3D7RA 1I33A 2VRCD 4CZ2A 2C7OA 2HWYA 5ERXA 5G0TA 2DTEA 2WAMA 4R1QA 2O5CA 3UVEA 3IEKA 4FR5A 1FSGA 4FTWA 3U7QA 4EI7A 3AP3A 2JLBA 3C1UA 1C4OA 1PTJC 2Y1EA 3PCRB 4S35A 1GPUA 2J46A 2VCHA 4UDYX 3BOSA 5B58T 1TYCA 2GD6A 2PZAA 3LCMA 1QV6A 5TT0A 4XPIB 5AW5A 3TQRA 1DZ3A 2W42A 3P52A 1Z3IX 2DHRA 2VPWA 3ANTA 3H6GA 3PNVA 4NCIA 4OGWA 1SY7A 2NO5A 4V02A 4FJ0A 3HRHA 1EWRA 2EJWA 3MMXA 4COOA 5KNBD 2O8EB 2RB4A 4ZRNA 1QO7A 5EJ2A 3ICCA 2ZK7A 3OTIA 3G8AA 1X1EA 3ASUA 4WZAB 1JMYA 5DJ5A 3SAJA 3I9V6 4XQ0A 1RC1A 3WJ2A 3GFRA 3X2FA 4F2PA 3CRQA 3TD6A 4MWCA 1V7QA 3ZU2A 3K9HA 1RTTA 4IIYA 3UAWA 2A0YA 1HOTA 1KP3A 1KYWA 2HUPA 2PCJA 2Q9AA 3GAAA 3JASA 4H3KB 4GVPA 3AR9A 3WP1B 3V4LA 3U4AA 1C3JA 4ZEMA 4KTVE 2HU5A 1DBVO 2H1FA 5ADHA 1G41A 4M88A 4US0R 4N47A 2BEWB 3GX1A 2EQBA 1DC4A 1SRQA 3B6JA 1POXA 4EKNB 3IEXA 2HREA 3DL4A 1N2XA 1P1FA 1NP6A 2YVQA 4REQA 3EMKA 2WUDA 1U2GA 1N2GA 5AJVB 3UHOA 5JAPA 2VH5R 4ITRC 1G291 2ZITA 1OX4A 5HIIA 1G3MA 5TJ9A 5JSYA 2C5FA 3B7PA 2WTAA 4L3WA 2QE6A 5FLXA 1PZXA 3DAFA 3IVMA 2AEJA 2VHJA 3O92A 3Q2OA 4I4TB 1JGTA 4PLHA 1JKFA 3NT5A 5L3SB 1AUPA 2V1XA 2Z4TA 2GFQA 3DEAA 3IXLA 2G80A 3AHFA 1IN5A 2RK4A 2YWXA 1D2HA 1UJ2A 2IIBA 2XBUA 3EXIB 4OHPA 3T38A 3MOIA 5DNCA 4LRSB 4PX3A 1LQ2A 2XDAA 1LSJA 1UODA 1BYIA 5F51A 2W2VA 3ED5A 1F51E 1I6WA 1WUJS 2KM1A 3E23A 1LW7A 3KPWA 3GEMA 4K87A 1HG1A 5AMXA 5EJIA 5FTMA 3GPBA 2BYTA 3BSFA 2WTBA 3MGBA 1ZCJA 3ED1A 3EGCA 3W2TA 1A0OA 1Y7LA 1Q0QA 2Z43A 1TGYA 5CYPA 3DZJA 4FMDB 1MJFA 1NULA 3HKDA 2QB5A 2G1KA 1BN7A 3CVOA 4DSUA 1K8QA 1UC8A 3V4SA 4UC0A 5C4GB 1N36B 2J3KA 2V9CA 3E0QA 5DP2A 5IS2A 1M74A 1PK7A 2E6KA 3PE3A 4HH1A 1ZYUA 1P0PA 2EKDA 3WR5A 1K5DA 1ULSA 2RBKA 2EYQA 2OGSA 1WTCA 3ZCRA 4YUXA 2PVCA 3O6VA 3EGXA 4P4SB 5B53A 1LLCA 2AX4A 3VOSA 3VYTB 1ZH6A 4HZIA 2JIOA 4IWXA 4MWBA 2AF3C 2RIRA 2YRWA 2ZXEA 3DDOA 3QBJA 2QYHA 3IUNA 4UJ3A 1KDZA 4YJ2F 1YOVA 1W93A 3SIPA 3N7UA 4BKQA 1E2UA 1MO5A 5EI5A 1BCSB 2DHEA 1PR3A 3ZBTA 1D7OA 1WXWA 3OCUA 4O4HF 5J3JA 3HKBB 3AF5A 5CB4B 3F74A 3GFTA 1E96A 4JJIA 5C5IA 4Y9UA 1C81A 2BFPA 2MTBA 4IGAA 1A9XB 4LA4A 3HCAA 4O1HA 2GKOA 3OKCA 3DT8A 5DM0A 3I6IA 5ELLA 1ZD8A 3HHEA 1TPZA 3KWJA 3L6EA 2E55A 5F7OA 2K5UA 1NUPA 4OUKX 5FAXA 4CEIA 1JDJA 1LSSA 2DHQA 4E5VA 4J76A 3EBPA 3UA4A 3AUYA 1H85A 1E2FA 4J2OA 1B6RA 3G0HA 2BEKA 2ODQA 3M2TA 3SLKA 4AF7A 3KOYA 1K5HA 2PDAA 3GCGA 2FGKA 3B5EA 3X0DA 3FKSA 2HADA 1XZKA 5FUYA 4ZZ2A 3RVNA 6CHYA 5AKYA 3THOA 3ZTWA 4DKXA 3L5OA 1AKNA 1PJ8A 2YXLA 1TK9A 4JJZA 4N6NA 2X2PA 5EE1A 1VA5A 1C3OB 1W5EA 3QWFA 3URMA 1FSSA 1ZH2A 5BY2A 2NNLD 1JTEA 3DL0A 3WWEA 1VHDA 4A9AA 3M83A 1WOMA 3X1DA 2IRWA 5A9RA 4PZ9A 4D92A 2AX3A 2OYSA 2R66A 2G9QA 2WIFA 2XUGA 4FCVA 2PKQP 1H4TA 2YQZA 2DBQA 4QU5A 4F86A 1E0DA 1UAYA 4LF7B 4D6XA 4KLNA 4KPUB 1KMNA 1W59A 5FUQA 3EPJA 2RG7A 1XYGA 2TS1A 4FFRA 3NEAA 5JYEA 4FFBA 5DCUA 1TPYA 2RGUA 3UWMA 4C2BA 1ZOLA 2BFAA 3OMLA 4MR7A 1UK8A 1HQDA 3TQHA 3ROFA 3UQYS 5EESA 3G68A 5FOTA 1NFFA 3N2IA 3CUTA 1SXJE 5JV5A 1PO7A 3ITEA 1MW9X 2CXOA 4G4GA 2FPIB 1KR5A 5IYZA 3CSDA 2CLFB 5DP1A 4F0JA 3NDRA 1MPTA 1UEIA 2O14A 2AF4C 1FLAA 1T2UA 3CLTD 4II3A 5AM1A 2IV2X 5BN4B 5KQSA 3AY6A 4DCOA 4RTKA 2P2ZA 3A6ZA 1MZPA 4MGEA 2FXVA 4YAJA 4D8TA 2A57A 2OAQ1 5KTPA 3QKSB 5AM4A 2ZTUA 2QTFA 4YUYA 4JDPA 4IDGA 1BQ3A 4MICA 2AMYA 4PIMA 1FVOA 4BNMA 1ZKDA 4TT3A 3AKYA 3R7SA 2JD0A 2WD7B 4AW9A 4GMDA 1NVBA 2R79A 4GMHA 4UMEA 4HTFB 2FPGA 1GFIA 3HN2A 1FK8A 1HG0A 2MYNA 3JQBC 3KWFA 4PAWA 3PJEA 3SVZA 3NGMA 1CE8A 1SB9A 4RF3A 1LJLA 1JAIA 4PQRA 5EE5B 1THMA 2BJWA 4KSBA 5GJVC 4KYVA 4P7JA 5KTRA 2FZKA 3QA3E 1Q2XA 4ZMSA 1FXSA 3ISJA 5DYYA 5LNK6 2XUOA 1MFPA 2WG2A 1BOFA 3H8JA 3STYA 1L4MA 1S4MA 1L8OA 2PLAA 5F7JA 1ZMRA 4NENA 3OFNA 2A3RA 5GTDA 3WL6A 4GI1A 3WKEA 4ZCTA 2B82A 3ND8A 5J1SB 4QBFA 1A97A 1B15A 4JNCA 2IYLD 1SIWA 2WNSA 4IIJB 5ADUS 3HB1A 2FZLA 2QYTA 2AC4A 3ZD6A 2BKVA 2RHOA 2RK3A 3O82A 5CNMA 3FVTA 3HL6A 1T6BY 1ULZA 3M6VA 2FPKA 3IIIA 2V4MA 3QE4A 4JJ6A 4LXXA 4YREA 4DLVA 1C41A 4PZLA 1YL7A 2IECA 2GRJA 4GPIB 3SBEA 3EXEA 5K8LA 2JGJA 1MC8A 2N42A 2R48A 3FTNA 1XXLA 2J5BA 4FMPA 4LVNA 3ZHZA 1UKAA 3WL8A 4HL6A 3U9SA 3EUEA 5CLGA 3BBLA 3RNLA 4P5EA 5F98A 1X6VA 2XMZA 3Q87B 1U63A 2C77A 2HLHA 3D1LA 4KU4A 4QPPA 3SQNA 3USZA 3L6CA 4PYIA 2J4CA 5I9MA 1V11B 2OAGA 4RHCA 4LCEA 1Q74A 2PZFA 2D1TA 1E92A 4FWBA 4Z5XA 3U7RA 4IMPA 4U8HA 4OMUA 2CXTA 3IA2A 1UPAA 3WE7A 1XV5A 1IZ7A 2XE4A 4K6MA 4KI0A 4QARA 5U1PA 2Q5IA 3THXB 1L4NA 1AK9A 2AXQA 3DHEA 4QJ4A 1EBUA 5A71A 3A11A 2ORYA 4NARA 4DEXA 1BDMA 2Z9DA 1R2QA 3U3ZA 4LI0A 4Q1AA 4E3WA 2PYIA 4IH4A 4W7HA 5BQXA 1PGNA 1QVAA 2UUPA 4ZEVA 3R6TA 2VCEA 2C29D 1LBEA 2OHJA 3LJKA 2X13A 4GBGA 4JMLA 4DRXA 2JGRA 5DRTA 3W1VA 2XUJA 1J2RA 2QT1A 4FFLA 3V8RA 3TKLA 4CIBA 3PQ8A 4F84A 1M1NA 3VI4B 1BEEA 1V5GA 4X92A 1SUIA 1X7WB 3HB7A 4YCAA 3F73A 1P9LA 2CBZA 3VDMA 3ERCA 3RTCA 3IE0A 3RU7A 1PEDA 2DBVO 5C7IO 3GEIA 5JYCA 3MCVA 1F4LA 5KWEA 1T5IA 1WW8A 4B84A 2IBSA 5I8PA 3V8PA 3U56A 3INNA 3MF4A 2FZ4A 3IBCA 3RS9A 4GNKA 3I0MA 3OX3A 3HSYA 3VDNB 2P41A 3LCVB 1CRPA 2VAPA 3RJ5A 4D4KA 1PFYA 2DY1A 2REBA 5DGDA 2YJ4A 4ZD6A 3WWPA 4ARSA 4DV3B 4RZQA 1LPPA 2AZXA 1PZNA 2QAIA 3GUUA 3WZMA 1M2VA 2ZR0A 3LP5A 4OTZA 1UMCA 1IAVA 1PBNA 2JGKA 2XKAA 5JU6A 5M2QA 3CO5A 2WJYA 1E1RA 3AUJB 3PZBA 1C8KA 4IL5A 4KXWA 4XM2A 2X22A 3VSBA 4DNOA 4FBGA 2MYPA 4LJSA 4MWOA 4XFDA 3ZJVA 2PRYA 2XOEA 4JI5B 2JJYA 1F48A 1TYEB 1B16A 1UBOS 2PR7A 3LBIA 3JWHA 4XD7D 2TRSB 4EB0A 1JAYA 4P7FA 3TW6A 4Z1MA 2FOLA 3GA0A 3TEMA 1R0WA 3LC7O 3UJHA 4D1YA 1NG9A 1WBJB 2GJ4A 3KKPA 4AYXA 2OK8A 3R74A 3AVOA 2H1WA 4H7IA 4BZWA 1I3NA 4MV8A 4PPYA 3K53A 2G76A 3SDBA 3DZKA 2HLDD 1R0RE 3ZXSA 1EHIA 1TCBA 2VAXA 2C84A 3CYFA 4QAQA 4A26A 2UVPA 3SF8A 2VDWB 3B2QA 4TTSA 4GI3A 3CNEA 1TOAA 1HDGO 3X2SA 5JMTA 1EFPB 5L7YA 3P4XA 3UV7A 5FTLA 1YK0A 3WGHA 5EHIA 3MMPA 1L8XA 1YR8A 3ASZA 2JGAA 1QTNA 1SBQA 2H59A 2ZS8A 3F7TA 2DTXA 3G0BA 1UK9A 3O1JC 4TTAA 3KB1A 3ZLUA 4F21A 5I7OA 5IN4A 4CMKA 3ICEA 3QHAA 3LAWA 5BV2P 5K8TA 2CNNA 4BLRA 2FB9A 2QN1A 5C53B 2SICE 3F90A 1Z5GA 5EIBD 2OECA 3HEBA 5D5HA 5ALEA 5DYWA 4GX0A 3THWB 3PQ6A 2I1WA 1K97A 1T1JA 5AHXA 1C7ZA 3QENA 2P67A 3GG9A 4YRRA 4IXWA 2JAOA 4YCBA 1VDZA 3B9PA 5KVVA 1FTSA 4D4MA 4YMUA 2IIVA 3ADKA 2DETA 5LBIA 4EJSA 2HFJA 1G3UA 1ZUNB 3NHPA 5GY7A 4M87A 3E7FA 4YI5A 4AAYA 5IXYA 4EG3A 1L5WA 3PUIA 1TMKA 4HAIA 4QDUA 4CM9D 1JP7A 4F71A 3N7TA 2ON6A 2Z2ZA 1OXUA 2MSNA 3OE7D 2ZPUA 1UWVA 1NVKA 2F3TA 2I2XB 4D8VA 2GAFA 1Y7IA 5ALOA 3SHVA 4IZ6A 1NP7A 2HRBA 1FSPA 4BFCA 4DKJA 1EFRA 1KH2A 3H18A 4PHFA 5TPWA 3RK0A 3CI0I 3AR2A 3Q9SA 1W88A 4OPMA 4Q00A 4WSOA 4Y2UA 2BSXA 2O3JA 4DVJA 4OHBA 5GOTA 3WK7A 1J25A 2C8VA 5K99A 1P29A 1FB5A 4ARIA 4WEQA 1T25A 4PLZA 4KQHA 4D74A 1F3OA 2G07A 2F64A 2NM0A 3GEEA 1THZA 3T7EA 3TNYA 4JBNA 5FBKA 2G08A 4ESOA 3OY2A 2YMMA 1YRBA 2XECA 2XF2A 1KBOA 3KQVA 4BMDA 3BDVA 3PYLA 3WV4A 2HLPA 3ROKA 4CKXA 3VYRB 2DOKA 3L9WA 2N1BA 4Y8VA 1J09A 3UG6A 1T2CA 2OHOA 2P90A 2YOFA 3QLUC 2OGUA 4Q4HA 1OYWA 3BTUA 2ZCVA 5FX2A 3D1VA 4A8JC 4DMHA 1N3LA 2JCVA 2M1XA 4LBZA 2W6ID 2CD9A 4FGKA 3FPKA 3DZDA 5ER6A 2C4VA 2ONJA 1M0WA 4AUEA 4F4IA 2RHLA 2VF5X 3QU4A 4LDPA 4DRYA 3PLNA 1MTOA 1YTLA 3OZSA 5ALIA 4BVJA 4YMLA 5CA0F 4DDVA 2QJTA 2DEUA 3V6MA 1W1UA 3T3HA 3R6WA 1EYZA 2NSJA 1PZFA 1TU4A 3F7NA 3NJ4A 1NNSA 4UVDA 2W6CX 3WKBA 1F8GA 3TIVA 4GKJB 2TMKA 2WDPA 1PQWA 2GWRA 4F3NA 3HVRA 3G8CA 4K9MA 1HF3A 3A06A 2CXNA 1OX6A 1H0KA 3IAEA 4EFNA 3I62A 3NWPA 4KDEA 1RXUA 5KQLA 4NU8X 4D45A 3DNPA 1SKAA 4KR7A 2EDAA 1M1XB 5BV1A 1WS6A 3SX2A 5GADl 1OW3B 1ND5A 1PEYA 1JIVA 3RC9A 3DHVA 3K1AA 3QPUA 5AUOB 2G5GX 2H07A 2MSWA 2ID7A 1L8LA 1U9IC 2QT0A 2ZAIA 4M54A 5BR1A 4MPPA 5EQDA 2WB4A 2Y92A 4JITA 2YC4C 5J4KA 4BO7A 5IEBA 4X3CA 4U7DA 2ZBGA 4TKUA 3TIXB 1GFZA 1NQAO 4CM5A 4Q12A 1QRTA 1B00A 3JWEA 3ZTTA 4II2A 1J99A 2X7XA 3JXEA 4M46A 1CJBA 4PZPA 3M4NA 3ZXYA 2JCBA 4JDUA 5EGSA 2JGNA 3AUFA 3F8WA 4BLPA 2CXPA 3MTGA 4ENRA 1G9XA 1LRJA 3BXGA 5ADWA 1KK3A 5EHZA 3PIDA 5AVZA 3ZWXA 4CU5A 3I2YX 4TZ6A 1NJ5A 5K7SA 121PA 1NR5A 3PXDA 5JSUA 1CY0A 1Y34E 4G65A 2YNMD 1NSFA 2ESRA 1KVUA 3HCDA 1EWYA 3S68A 4YUZA 5FA8A 3N8NA 4UHCA 2B5VA 4KE9A 1J90A 2A9RA 4M9CA 3H0KA 4BKOA 3S6JA 3UBMA 2C0QA 1J00A 1W44A 4ZYWA 2WT9A 3AESB 3NAGA 5KUTA 4HAWA 4N6GA 3O95A 1C1DB 3T99A 1WO8A 3OJ0A 1XKXA 1QTQA 4V2IA 1N6OA 3SSAA 4B0OA 1HDRA 2I76A 2X8WA 3AWDA 5HQJA 3WK9A 1YWGO 1KOLA 4EFDA 4W5QA 3UAGA 4BCDA 2CE7A 1EINA 1XDZA 3NBUA 3A0RB 2O2GA 2ZT5A 4FEEA 4JWTA 3WX0A 4ZIRA 2QMHA 4PNZA 4A03A 4LGVA 3L8GA 1JW9B 1YS9A 2FWIA 3VJLA 1A1VA 3CF0A 1Q0SA 3LLMA 3V48A 3V8EA 1G20B 1GXSA 3CNNA 3ZKWA 3Q8XB 1OAKA 1C5KA 1R8YA 2QM3A 3DDNA 4C3ZA 3EGVA 5CDFE 3BGDA 1WCYA 1FDIA 3GZNA 4CDRA 1N57A 2AB0A 3M1AA 4R31A 1MEEA 3OZAA 1ZRHA 4MCJA 3ENZA 3W5CA 4P0QB 2GXQA 5BSUA 2F1KA 4PRKA 4CTOA 1ZUD1 2EHDA 4P7GA 3CX7A 2Q7DA 4KX5A 4X1IA 5T4EA 1JH9A 2ARKA 2XA2A 3DE0X 3R9IA 1F9AA 1Z35A 4O0LA 4HGRA 4UBOA 1XEFA 1MB2A 1PAUA 5ADVA 3TGLA 5HBRA 3N74A 4BDTA 1WBBA 3ONEA 4E2ZA 3GRRA 3CBGA 4NZYA 1GNTA 4BUJA 1A82A 1IZ0A 4IZHA 3KB2A 4MVCA 3G2PA 5IUJC 4JSRA 5K3FB 5DW0A 5A04A 4I19A 3KD3A 1GV0A 5MFZA 1JV2B 1K27A 2V6IA 4R1OA 3KQKA 2YY6A 5DO9A 1D5WA 4X62B 3RO7A 4EWLA 3L0YA 4C6TA 3MWYW 5C8YF 3B78A 1NT4A 3X1YA 3ZE6A 4Q47A 3SQMA 2P2DA 1RNLA 1X3LA 3EDOA 5CGQB 1QOPB 4JSTA 1NTOA 1ORVA 3G9XA 3OX1A 1G19A 3QFCA 1W1IA 2J08A 4N40A 3RS4A 3WOVA 1RYYA 1ZC4A 3K20A 3K9GA 1UXKA 2RAFA 4D26A 3EYWA 5ILQA 4PBTA 1N6NA 1O6FA 2OENG 2I9PA 1A5SB 4FFOA 4IRUB 5CW1A 1G38A 4IQ8A 3KJGA 3DHWC 3LVRE 1VBKA 1CDEA 3DZCA 3WLKX 4DBLE 2QOEA 4ER5A 2ZQYA 5ITSA 5LYJB 1SUEA 5DN6A 1VHTA 3WY9A 1RWXA 3AH8A 4OHMA 4KHPB 4MV9A 3BIFA 4UBIA 1YZTA 4B48A 4EPRA 4MROA 5CFLA 1X94A 4W63A 4BMVA 4P33A 5IULC 5C8ZA 4ZO8A 4P22A 4PYOA 4IOKA 1YVEI 2ALJA 1UDRA 3EIEA 3JQRA 3KZKA 4YDHB 1VPWA 1JSXA 4GKVA 1B73A 2OCPA 1EEXB 1PNRA 2WJAA 2YW2A 3ETCA 5DM2A 4EKGA 1YDHA 4KMOA 3ETHA 5BW6B 1JIXA 4AG5A 3N2LA 4UQOA 1D6MA 1X13A 2QAJA 4XI9A 2AIRA 1SBTA 2CJWB 2XWPA 5DGXA 1NKVA 4JUCA 2D4HA 3K2IA 4OQXA 1HZJA 1JRLA 3TIGA 1M67A 1UT8A 4RXMA 4TQ9A 4AULA 5CBPB 4W5RA 1OA1A 2CF6A 5TPZA 1U0TA 3OZRA 4AZ0A 3RBXA 4EI8A 1N1DA 2E2WA 4R9NA 2ZS9A 1Y1TA 3FUVA 3UXYA 2LMEA 4FHEA 4MW4A 5JVDF 1Z9BA 1SURA 1KGSA 2P3SA 4YRTA 3AF1A 1G6KA 1KXZA 3AF3A 4IFIA 4FWTA 1R5NA 2AR7A 4XSVA 1M73E 4MCAA 1VCIA 3TKYA 4AZSA 4D46A 3QOWA 4N3AA 5AJXA 2XADA 4AL4A 3LWZA 2FPXA 5K3OA 3IJRA 4EG7A 1TQ2A 5ENDA 3ZHQA 2AMLA 2ZSJA 1W49A 2ZDGA 4UUBA 1LBIA 1BU8A 2CY0A 5IC4A 1IN1A 1XROA 2IYSA 2OG1A 1SCIA 4KBGA 5JO9A 1YJ5A 1KQGA 1LRKA 2F3UA 2HO4A 1EE2A 2H57A 4QOJA 3K2BA 3UK1A 4B6PA 5CA1B 3PGLA 3H5WA 1TCAA 4I81A 4Z54A 1E3QA 5DM60 5JWRA 4DV2B 1U1IA 2WSMA 5BVGA 1RI3A 2FHSA 2VT2A 1YBVA 2ACWA 1M6NA 1MBZA 1WHTA 1Z0JA 3I04M 4A73A 2IITA 3TW4A 1RZRA 1V9LA 5IX8A 4PBSA 3F9CA 3B1VA 4LTDA 1PR5A 1DLJA 4JOBA 2OPHA 3A1TA 4MRMB 1XMIA 2OHHA 4JLSA 4KMSA 2O8FA 3BWCA 3U37A 2VRBA 1JX6A 1NVGA 1YJBA 4L6CA 1DKNA 4LXQA 8MHTA 2P9QA 2VQDA 2YJ3A 1KDTA 4X1YA 1ZNXA 4DZRA 1JEQA 1R3DA 2AMVA 1I6MA 3CWQA 4D0NA 3CEMA 1XTIA 4J1SA 2F1IA 5IMBA 5DM4A 4LQCA 3OWOA 3T3GA 2G70A 4HB4A 3WTBA 3SZOA 5FBZA 1Q17A 3QF4B 2BGIA 1XBTA 2EZ9A 4WQMA 1BVHA 2ETXA 5HMLA 3ZCXA 1PYOA 3AERA 4W9MC 5JSHA 3CG4A 2H06A 2PGIA 2QRMA 2ZGVA 2IWRA 1DQZA 3JQPA 4AYWA 2ZW9A 3GD7A 4FMCF 3ZC3A 2AG5A 5H9WA 3Q1KA 5IFKA 1JE0A 4BJ6A 3PXUA 2FAXA 3V9PA 1U5AA 3NZEA 1RKXA 4E2WA 1JIUA 3IQGX 1ZSYA 2ONKA 2VDQB 3EXFB 3TH5A 4ERXA 5HE9A 1GITA 1P6UA 1E7WA 1YR2A 2Q1YA 4RPHA 4TQUS 5A5GA 4ZTUB 4JCCA 2EJVA 5C31A 3T1NA 3KCQA 2F90A 3M82A 4ALIA 1WA5A 3LUPA 4J9VA 1L5HA 3FCSB 3NHBA 1XKTA 2VS1A 5EUCA 2LGJA 5J59A 4QU8A 1X7YB 2WQ6A 3JQ7B 3L0PA 4OK3A 2PTHA 2HCTA 2HUNA 2R5WA 1CVIA 1NJSA 2EXXA 2R1TB 3PS9A 3ZS8A 3FLAA 4CM1A 4G0UA 3O90A 1Z2OX 3T5CA 1G55A 4WZAA 1U8EA 1HYEA 5TARA 5B2FA 3GGGA 4G2TA 3EPPA 2B9VA 5TC4A 3REOA 3WNQA 1IONA 1KAOA 3AXTA 2C7PA 3SDZA 1PQPA 2PRJA 5KKAA 1UEXC 3KQWA 4ALMA 2IVFA 1E2GA 3UJ9A 2NAPA 3NORA 1C3LA 2E49A 4CLXA 1EP9A 4FFDA 4UREA 1N92A 5JE8A 2BEWA 5D3MB 3SSMA 3MCAA 3LE8A 1V0JA 2AD1A 3MAJA 1GKIA 3S2YA 5IH7A 3TF5A 2IY7A 5FPKA 5B6JA 4FYJA 4X60A 4HN2A 4ZOLA 3FCYA 3MTBA 5DASA 5H3HA 5TVGA 4AWAA 4CEJB 1G9SA 1N7JA 4B6EA 5IZCC 4B75A 5HE8A 3PRYA 1OWOA 4W5JA 1AUOA 3L7DA 3PJGA 2ATEA 4UQPA 1Y4UA 1N9KA 3FUCA 2HYIC 3G2QA 4I4TA 4DSZA 3BGOS 4G5GA 1GDDA 1NX6A 1YVUA 3LKDA 4UFPA 4Q18A 2QJFA 4FDVA 4MV1A 4B7AA 4DMMA 2HK7A 1OGYA 2CNDA 4PAQA 1HE3A 4Q19A 4KNWA 5EVJA 1ZXXA 4QDJA 1DKUA 2A0KA 3IT1A 4XOUA 1CR6A 1HBJA 3V1MA 2CFSA 1RRGA 3GEGA 5J5CA 2BIFA 1PNQA 2D3TA 4CHTA 3FWPA 2JFXA 4UCFA 1P1IA 2NTVA 2A5FA 5EJEA 1ABBA 1BVUA 2O7QA 1P17A 3GAFA 3QKTA 3S2EA 2PSHA 4EJFA 1S0UA 2OCXA 2OXCA 1Z6PA 2D5IA 2Q4EA 2HLDA 2JAUA 1SPBS 1L0BA 2YCLA 3KPUA 1VLQA 3MN1A 2JI9A 1WVMA 3O3MB 4N03A 4P4SA 2DR3A 4UHHA 2GVZC 3HP7A 4D3YA 4L9WA 4RPLA 1WUHS 1NJ1A 3ZYZA 4HDQB 2CC2A 1DDOA 3HY6A 3NG1A 4NX2A 2AFIB 2MSKA 2Z3WA 1HV8A 4W6ZA 4ZCPA 4CEHB 4LHEA 1EK1A 4KR3A 1FDVA 1P9NA 5D3QA 1E18A 1IUPA 3HXOA 2G8NA 3K72B 5CB4A 4V3BA 3O21A 1FSZA 2JFQA 1A9QA 4RZHA 2PMDA 1CQJA 2BTQB 2VDNB 4JH0A 4Q03A 4P98A 3LZ6A 1ZK0A 4F8JA 4PSCA 3KL4A 2Q5CA 3T1TA 3QKUA 3OIWA 3VTFA 4EZBA 4RVFA 4OKNA 1Q50A 1L7OA 3RC7A 3KL2A 5IM4F 4BO3A 3CLRD 3OP4A 4A2QA 1VMIA 2FUG1 2LDBA 3K09C 1FVXA 3HKCB 1DT3A 1IJKA 3A6DA 3L4SO 2HDOA 4D99A 2ZYGA 1M34B 4JI0B 1WDMA 2FLVA 4EJ2A 3W7VA 3AETB 4PC3A 2JGDA 1QQ6A 3CI0K 4GYWA 4WZBB 4RKWA 1E4EB 2WU4A 3KLMX 5AHOA 1EX9A 3RWMB 5KDOA 5A0TA 5AW8A 1OAAA 2GN8A 4WY8A 4HAZA 1DWQA 1CR4A 1YBAA 2ZIXA 4K9RA 1R8SA 1E5TA 3W6NA 3TSCA 2QMYA 2PX8A 3L1IA 3BRSA 1KSGA 4IUCS 3UENA 5C1BA 1IOVA 1EFCA 1C3OA 2FPOA 2QWXA 3C48A 2E4VA 4G1FA 4GP6A 4JLAA 3RVOA 4D8YA 1XZMA 3KT8A 1KOJA 2Q5QA 4DJTA 2OKGA 3DKRA 4D7AA 4NV3A 1I7LA 2HD4A 3WFZA 1JQAA 1EAYA 4XCXA 4RSRA 2BBWA 2WQZA 3C0KA 4R9VA 1FFYA 2AV6A 2FF7A 5KOJB 1GPMA 1LV8A 4PSAA 2BRUC 1ZRNA 2EG9A 4JEHA 3SJBA 1RE1A 4FWIB 4R0NA 1HNWB 5CDYA 1BEZA 1MD9A 1ZP6A 1DXOA 4U5QA 3SOPA 1IXYA 1L6RA 3WGTA 4BLVA 4RJJA 4QRHA 1TX4B 3STVA 3QE2A 2POQX 4MJLA 1W581 5JSZB 1JBEA 1PV1A 2FPIA 2Q07A 1HURA 2QF7A 2W6IA 1XI2A 2Q5HA 3DAHA 4LJYA 4DV6B 5AJHA 1MJ5A 4GD3Q 3H9CA 4IX1A 1XMSA 2PX5A 1MRZA 5ULLA 1S2IA 5BN4A 3GLHE 3FN4A 2IS6A 4K0RA 2PUGA 4IO0A 1OD6A 8AT1A 2VPIA 3QKSA 4LQ4A 3FYDA 2FF5A 1GUYA 1HA3A 4QG3A 3Q0EA 5EJ5A 2GTHA 4JOQA 1T8UA 2WD7A 1VPLA 4KN8A 2W37A 3L18A 1Z4NA 1EVLA 3PI6A 3TDKA 1DWPA 3QNUA 1JAHA 3VKHA 2QR3A 2RB5A 5FI5A 1H5NA 4Z86A 2DT8A 3OT5A 4OYLA 1HT2E 1II9A 1LVHA 1M2OB 3EVZA 3PL1A 2IBTA 3GL9A 4OFWA 4XVCA 2BGTA 3JVEA 1ZZEA 4F6LA 4FYPA 3W8FA 4DR2B 1IEVA 3OC6A 2QY9A 2XNKA 4KQMA 3AV3A 4EJ6A 3G1TA 3LUJA 1KKLA 4LX8A 1BDIA 2F00A 2YXPX 3LMKA 4Z0HO 9ABPA 3B2EA 3B89A 3GRYA 4ADSG 1L5LA 3GLFB 3AFHA 1XA0A 2J32A 2RGBA 4RIHA 4DG8A 4XUEA 1ZJYA 4DJ5X 3IL2A 1GVHA 3PC3A 3OT4A 2GCOB 3VH2A 4MVJD 1GAXA 2YXDA 4MGIR 1UXJA 5IJ9A 3K35A 2R4UA 4IKOA 5A4AA 3REQB 1BXRA 1GRVA 3C8UA 3FOBA 4LRUA 3IHTA 1IPEA 3KTOA 1NN0A 2UYYA 3OF5A 3WLLA 4DAOA 5BWOA 1EVEA 2FEAA 5IJ0A 3TRFA 4HUJA 4G0PA 3C97A 7MHTA 1N7HA 2DWOA 3GEBA 4K2HA 4R71A 1D5CA 4UDNA 4E46A 1JG2A 1N6PA 2H9IA 4HDNB 2WF6A 1UFRA 4CMEA 2JS7A 4JJ4A 1V11A 3CVXA 1ICIA 3UB4A 1M6YA 4KPEC 2DZDA 3W05A 2QX9A 4L5YA 1VYTA 1VBNA 4AG3A 1QRUA 2E87A 3W9YA 4R3WA 4Y18A 2X4IA 3THXA 3IIMA 3ZIAD 4B33A 3KQNA 3H1TA 4H35A 1HT3A 3RIYA 2HIGA 1I3CA 2DKNA 1K6JA 1UBJS 2Z5GA 3M4YA 4JROA 4DC1A 4E5PA 1N33B 1P18A 2W6PA 3AYXB 3U1BA 3DLPX 4KRFA 4G6ZA 3DQPA 4EHNA 3T7CA 5KMGB 3O38A 1NP3A 4DPMA 2D6FA 3DM5A 3LSYA 2L19A 2Q3MA 4PN3A 3DCNA 1S8OA 5CEEA 1Z17A 3AWIA 1WCXA 5DZSA 3EIUA 4KLCA 3QXJA 2XOXA 3M6UA 4UCQA 5EC8A 5EIFA 3SFZA 5JNUA 1CP2A 1U2DC 1OROA 2YN0A 3KFVA 5B58C 3HUTA 2Q9BA 4QDOA 1LF5A 2FRDA 2FP4B 1IUKA 2IXBA 4BJ5A 1X7WA 4A2WA 4TVSA 2FCAA 2HQBA 2I2DA 3FMFA 2YDYA 3ZCSA 2Q2VA 1XQYA 3FFTA 3MRTA 1LDGA 1E9RA 2IXDA 1YB6A 4G1VA 4TMFA 3RIMA 1KMHA 4QA9A 3W8NA 2YXBA 3A4YA 2ZULA 4U0KA 2M6LA 2H2HA 5BNFA 3SBOA 2RHCA 3CNBA 3DW1X 4L75A 4B4KA 4KQGA 1P44A 3UCFA 1X1AA 2PAFA 1KAHA 2WJZB 1YGYA 2HF2A 2NO1A 1H8ED 3OPYI 3R0IA 4KV9A 4PSVA 4QDZA 3WISA 5KWJA 1E9SA 2FKNA 3VKFA 1VMAA 4O25A 1E7MA 2WFLA 3BQMB 3V8MA 3E7PA 3OLXA 2J3QA 1FFHA 2NVOA 3ESBA 1OH8A 4NATA 1QPZA 1X1DA 3CTMA 5L95A 1FFEA 1G64A 1IXRC 4ZRMA 4XIYA 1W2HA 1WXFA 1R8XA 4IMRA 1GUZA 4JVOA 2JLSA 4ZU6X 4MAAA 5ER9A 3RAPR 1QVVA 3KQYA 3L2OB 3KOOA 2JJMA 1XC7A 2DBZA 2YWBA 3L6UA 1FRVA 1XQWA 4TXLA 1TEZA 3Q3GE 5ALHA 2IK8A 4E4YA 2WYHA 3MC1A 2IOQA 2O2IA 2X19A 3QWHA 2VF4X 2Z04A 1G8GA 2CUNA 3CSSA 2Q6OA 3AK4A 1IN7A 2VDWA 3KNZA 3H9GA 1L5OA 4R2XA 4QT4A 1TM4E 4GXTA 2BE9A 4IDAA 3H5LA 2OHFA 4M0DA 1EFPA 1BGWA 1LJ8A 5BT8A 1JT2A 1X8LA 3RLFA 3I9LA 2B3DA 4OHWA 3QTLA 4ZAGA 1V3VA 3X1KA 5L40A 1DE0A 3ER8A 2PH1A 1GTVA 3PNMA 3CUEF 4L4YA 4OHUA 5IAOA 3GPLA 2QZJA 2VYNA 3S2FA 4O4JB 2WYIA 5L53A 2R1ZA 3BXXA 3NWJA 1HEYA 1MH1A 1IM2A 1W85B 1AKWA 2X15A 3IEIA 4DLUA 1QPBA 2ZCJA 4IYRA 1KEZA 1RC0A 4GC5A 5DT2A 1PNVA 4C30A 4X6UA 5IVKA 1NM5A 3DEIA 4ISBA 4B3DA 4YRCA 1QIKA 1U0HC 2VWGA 1RJ9B 2WUVA 3QJ5A 4BO5A 4TV8F 1L7VC 4JR2A 4S2UA 1KBQA 5F1OA 3ZZMA 4UHFA 4KEAA 3ITDA 4S0ZA 5JPIA 2B4AA 3H5VA 1ZUNA 4PLPA 4DV5B 1GPAA 1F4PA 3QVXA 4OH1A 1T8SA 1JLKA 1QYXA 2AZTA 4I36A 4N5LA 1CUGA 2GZSA 1T8PA 2WD8A 3KT3A 1PK8A 3MWFA 4V0MA 2A2ZA 2WSYB 2JFGA 4Y6LA 5CH3A 5E9QA 3NPMA 1A8SA 4KRYA 5JLAA 3LPDA 3DT6A 4DA9A 1UPUA 5E2AA 3ZW7A 3DFZA 1W19A 2P30A 1Q15A 2I4LA 4GYJA 3MSCA 5BMOA 1DOHA 5HRUA 2H52A 3HVHA 2Y9MB 3LOQA 3QU9A 2NMVA 1SULA 1YL6A 2A1UB 4OJNA 3SYRA 3ZNOA 1ZITA 3D4LA 4TRJA 1JKJA 5E1DA 2OK7A 3PYMA 4PS1A 2X2FA 1RLIA 3UICA 5AVXA 2H2IA 1X7XB 3ZY6A 5SY9A 2HA4A 3STTA 1SD1A 2PKRA 4RA9B 2YIVX 3JD3A 4ODIA 2FK7A 2IXGA 5CX4A 1KKUA 4XVHA 5AIBA 3BTOA 4HLUC 4RKFA 4QG7A 4XIIA 3SZUA 3TPZA 4EDFA 2XLBA 5COBA 3NB0A 5LB2A 4QOSA 1EK2A 5H83A 3R2JA 5AWFC 3HC7A 2AWNA 4LYEA 4YAEA 1ZG3A 5BQPA 3KOMA 1FNNA 9LDBA 1GD1O 5K0GA 3WXBA 3GZ4A 1G42A 1RRMA 2CF5A 1YJXA 3RUIA 4NFLA 1H2EA 3HWX1 1R5OA 2HXSA 1EFHA 3G2OA 4RK6A 1E5DA 4V0RA 5T8KA 1B3RA 4IJWA 3VR0A 2IYRA 4J4TA 3WYCA 2ZI7A 4HWTA 2VT3A 1GQFA 1E2BA 3LXUX 3DMDA 4I66A 2PSEA 1VE7A 4H1WA 5AVSA 2ZSFA 1XZHA 2EFEB 1EXVA 4OO3A 4LGYA 3TXYA 1K9VF 5I7HA 1GADO 4TTTS 4ZVTA 4C05A 4UE2A 1Q3TA 4GGMX 1DRVA 2I2FA 1MVLA 2IUTA 4BPRA 1PYDA 2IQIA 3ROTA 3E9NA 3FAZA 2IF0A 3IVAA 1VL0A 1U81A 3DWEX 3QTBA 2HU8A 3D3WB 5H70A 2QTCA 1ZIXA 2FZVA 4MB2A 1QV7A 2IXTA 3K1YA 1HMPA 1P33A 1Q1ZA 3Q88A 5LR6A 4X8LA 3AFNA 4HN4B 3GNQA 3G85A 4DR6B 3COSA 3IQIX 1ELOA 5FQNA 1GQQA 1M0SA 2QTTA 4U0JA 4CIWA 2IUSA 1KJNA 4DQDA 4S05A 3MJDA 3NNDA 1H8HA 2DB3A 4J75A 4AWXA 3DOHA 2HHJA 3FFBA 1ATZA 4C0BA 1HZZA 2X3FA 4JODA 1VQ1A 4GU5A 4M2LA 4AKSA 2FY8A 4DBZA 5EXEA 4D9GA 3IOBA 3IBTA 4UE6A 4E12A 3KQUA 4P38A 5L3RA 4RY0A 1T2VA 1XEXB 1V39A 4ER3A 2J6CA 3K0AB 4KXQA 1GLVA 1AQYA 4K86A 2A9VA 1ABEA 1CQWA 1EG2A 4D4IA 3R3JA 3E8MA 1EFKA 3R24A 3CT4A 1XFDA 1MABB 5DI3B 3CUSA 5BSWA 3LPLA 3JS5A 3SEQA 1EI9A 2YWGA 4PLFA 2WF9A 2IYYA 1CY8A 1I14A 4MAMA 3ZX5A 1D4OA 1V1MA 2A0FA 1P7WA 1T9CA 3OIGA 3PQDA 4O4LB 1RXWA 2EKPA 1FXUA 2CBGA 4I1UA 4NMHA 1Z2NX 3A10A 1ZBQA 2F3PA 1THTA 3QUTA 1EK6A 4YQZA 4DGSA 2OQIA 1GG2A 5A5VA 1V43A 4L8VA 5ERYA 4OGFA 1TYAE 2FMFA 1QE5A 2WF5A 3BX1A 1YQTA 2EQAA 1E3SA 3DFIA 1E2MA 4MGYR 1EZZA 2PQ6A 3LX4A 5I4CA 3FRJA 1UKVY 1ZDMA 4H0NA 3FYUA 4J4HA 2PT5A 4XVRA 3RFTA 1EB9A 4H17A 1FU8A 4IHAA 5KX5B 3WV5A 3MRVA 4INZA 3URKA 1E64A 3G6KA 4ITUA 4CR6A 1Z88A 3FTPA 4E5KA 3MTAA 5DXJA 3CU5A 4GLOA 4A8JB 4D82A 4FK8A 4GXNA 4IJ6A 4EY4A 3CZAA 1TGVA 1W0JD 2CDNA 2RAUA 5FI3A 3CEHA 3L4BA 3HPQA 3LFUA 4CVNA 2Y77A 3HDJA 2G9VA 4U5XA 2V55B 5ITVA 1M8KA 1EA5A 1DAPA 3T3DA 4BLSA 1JZQA 3DWFA 5KYGA 1ZMBA 3EG5A 3SFTA 2ZSEA 4W5NA 3OZ7A 2UYCA 4BMOB 4KREA 1JB9A 3M6AA 2WP8J 2GM9A 3AB3A 1CCWA 4FUTA 4XYEA 1VGVA 1M7GA 2BHNA 1HL7A 1PZEA 2E1RA 2FMXA 1Q1BA 2I3GA 1R5JA 2IUYA 3NBQA 4LXIA 5AI6A 3R20A 1KZGB 3AHCA 4HNAB 4NESA 1NRJB 3MTIA 5JH7F 2X42A 4AKGA 1EBBA 3IAFA 1XZ8A 1BJTA 3ND7A 3KSRA 5KYYB 2R1VA 1AGNA 4H7PA 1E1DA 3H2BA 4K6CA 4M1TA 3RS8A 3WYDA 5HEKA 3KJNA 4AMVA 1AKQA 2H6EA 3IFSA 3QPBA 1R4NB 4ZOCA 1DSSG 2AN3A 5LQNA 2NO9A 4BQNA 1K06A 3PQCA 5TGTA 4LE1A 3K9NA 1ONOA 2EEZA 3LOUA 4BAZA 4BB5A 1QIEA 3GD5A 3KR2A 1FY2A 1AZLA 3CURA 4HH0A 2FEOA 4L5AA 3SPXA 4MQEB 4RC9A 5A7FA 1A8QA 4UBNA 1XLUA 5DOZA 1KMIY 3ZCQA 4KCGA 2FPPA 4GPBA 3CC8A 2ODPA 3UAVA 1T1EA 1JJVA 2XWJI 1LQUA 4J0FA 3RQIA 4C0WA 5JR3A 4BZXA 4KH1A 4TYPA 2QL7A 4E5NA 3VZSA 4FC7A 1DL5A 2PH5A 4K28A 2GJ8A 1RR6A 2A53A 4FN4A 3PEFA 1SOVA 3G8DA 4L08A 4M0MA 4GKAA 3U6BA 5ENZA 2QKYA 4Q3BA 1KRWA 1EX6A 4DR5B 3TTUA 1ENZA 1KHTA 4URVR 5K3AA 2FU5C 1JQEA 1L5GB 3TCXB 1JSCA 4MRAA 1KC1A 1Z7EA 3EFOA 3IOMA 4HBGA 3FBWA 4N3GA 5HDBB 4XWOA 4NCJA 4JXXA 3SJ7A 4MJXA 3TOCA 3WK8A 3HFJA 3TLXA 2P9BA 3VU9A 1CEQA 4LTMA 1A8UA 1ZXBA 2G7MC 4XJXA 1O9HA 2NXEA 2FJ0A 4GXQA 3UWDA 4PLWA 1DINA 3LFHA 4CODB 3ILYA 4B6FA 2IW3A 4NBKA 5AR1A 2CJWA 2R4QA 1AXEA 1XDBA 3L8EA 4HEHA 4JL8A 4LCJA 3A6HA 4X64B 3BCRA 2AI2A 4AX8A 5JRJA 5FHQA 1ZESA 5AVKA 2AZDA 1M7HA 1JZTA 3N5CA 4FXPA 4XGKA 2MCFA 3T7AA 5CBPA 1TM5E 7GPBA 1DIOB 1OBHA 3BFVA 5DBHX 2GEJA 3LIPA 5C0OE 4F9TA 5MN5A 2CGEA 2BGGA 1JHZA 1PVDA 1GPWB 1N2OA 1OTYA 1SVSA 2Y66A 3OIFA 4BNVA 5F21A 1G8HA 4QEZA 3DFKA 1GNPA 4TMXA 3B53X 5P21A 1NKTA 3CX8A 1E5QA 2MOKA 4HVTA 5CG1A 4E1BA 4NBLA 4PO9A 1I3KA 3BMNB 4ZZ0A 3OZVA 1K4KA 1XJ5A 1YRLA 4RK5A 4ZARA 5FO1A 3SHFA 3CZRA 1B1AA 1EJ0A 4I1OA 2WKRA 2BGKA 4QODA 1N5RA 2ROQA 2F8LA 2FQWA 2G09A 1GAJA 3NOQA 3T3EA 3UB2A 2PHZA 5JADA 4WXPA 3U3XA 1I6KA 5SYMA 3VU8A 5EQTA 4H0CA 4HC4A 5FADA 4ENUA 2QV7A 1NSTA 1N2ZA 2PEZA 1YL5A 2YN4A 4DV4B 1I4OA 4PW0A 4Q3EA 3VDXA 3N2YA 4GPZA 5CA1A 4C4OA 2E5FA 3GDFA 2BJVA 2CLCX 2COKA 3IBGA 4GLBA 4MLZA 3DPUA 3VPXA 1RJDA 1RYZA 1SUPA 2QW8A 4PSDA 1XXHB 3BE4A 4KK3A 5CVEA 5KYVA 5T41A 4ZDKA 5F9HA 4PS0A 4UAUA 1KZ6A 1QAMA 3S0JA 1JA0A 5EERA 4DZTA 2EFJA 4RSGA 5G2FA 2VG8A 1X8JA 3A9VA 4WN9B 4Q9IA 4MRMA 1ECBA 2O8DB 1KPGA 1JVSA 3CB2A 1MKYA 3W5DA 4NDZA 1UBHS 3TRIA 1KYIA 3WSWA 4ZGGA 4MV5A 4UASA 2JJ2D 4XJVA 3LC1O 1RYEA 5T6MA 2X8BA 1GRCA 4LSGA 1PFQA 1R3UA 5HKBA 5KINB 1I4WA 4UTVA 3OETA 4LZJA 5B2ZA 5T4FA 2B8EA 2YMPA 3H19A 1UPFA 3ZHCA 2WV9A 2VL7A 1Z56C 2H29A 3AM5A 4FGSA 2Y9PB 3QU5A 1LJUA 4YJ2B 3RJ9A 3BA1A 3C3PA 4JI4B 1AH2A 3BHIA 2ZUVA 2K2QB 3D5TA 4YACA 2L42A 1LVUA 3ESXA 2ZLBA 1I2DA 1AGXA 3A37A 4O4HB 4F96A 1IDN1 3EIFA 2P35A 4J0GA 1PHPA 2V65A 2J5XA 2AC2A 2X41A 4E13A 2V5VA 4B1FA 4F12A 1YDGA 4FR2A 3ICQB 3TKAA 1OWPA 4BQRA 3NASA 4C21A 1CLUA 1FFWA 1V5WA 5DM1A 1IHOA 4Q6BA 3KJFA 4M21A 4EG0A 3K8ZA 2HA7A 3GMSA 5K6RA 4JX8A 3RAEC 3DFUA 3EXFA 2PFGA 1RADA 1OLOA 3GA5A 2JI4A 1CDOA 2RFLA 3HO8A 4L0CA 4PE5B 4AP5A 4BV3A 2C9DA 2OD2A 3BDAA 1FL9A 1V1RB 1ZL2A 3JV7A 3KWLA 4JP1A 5A7HA 1MX3A 4KP7A 4MQ5A 2QTWB 4AJPA 1K7SN 4NZZA 3WQRA 1XPRA 4OK6A 3O7WA 2V8OA 4MYCA 1PG2A 2Z2IA 3FSEA 2IX9A 2ZATA 1X7YA 3WGLA 4XDZA 5AM3A 1ZJ5A 1OWNA 2W6JA 4DCSA 2ENUA 2W6NA 3SCZA 1FYFA 2OAEA 2A7XA 2Z9BA 5AJZA 1G8YA 4N65A 3I04A 2BUBA 3FPEA 4QXMA 4FB4A 5JEEA 4I2VA 4R01A 2O1WA 4URHA 2IP2A 1LK0A 4GR5A 2EP7A 3CZ4A 2R0QC 2BPOA 2ODEA 3ZVNA 3KHUA 5HA5A 1P3Y1 5BSMA 3HYCA 1PKXA 2OO3A 2WIKA 2XOKD 3OZEA 1E1YA 2C03A 3G5MA 1GPNA 4UPVA 1BD3A 4LDZA 2WTXA 2WAAA 1PT6A 3RVMA 1NZDA 3LQKA 3NC4A 4D4JA 5D3MA 2UUBB 4JFRA 4G5RA 4BEJA 5F35A 2IOFK 2VJDA 3DH0A 5ARDA 5JUWA 5FORA 4WERA 1I32A 3BD6A 3ELDA 1BYUA 3IESA 3Q40A 4HCJA 3SQXA 5AVVA 5F4BA 4P9NA 1ISGA 1O5OA 1NOIA 1ZMXA 3IB6A 4HHEA 4J7UA 3W04A 4CEJA 2RH8A 1Q44A 3DD1A 2G4CA 4QVIA 2Q41A 5DLQC 2IH2A 2I2AA 3H3FA 3ZOZA 1U0OC 1YF3A 4B35A 1QU3A 4CCYA 5L51A 2A1TR 1DARA 1KSJA 2DUJA 4L8YA 2X2OA 1GKUB 1H8EA 1PV2A 3S40A 3STHA 3LGXA 1Z68A 5CUQA 3TI7A 5BT9A 2A6PA 4B83A 2EARA 3O9MA 1GILA 1IHXA 3EQZA 3QVUA 2D3WA 4PZDA 4R84A 2ICAA 2FZGA 1TM2A 4NE7A 3KC2A 3VR6H 4ML3A 4G0ZA 4H3HB 5HQ3A 4JWKA 5KAMA 2OV4A 1J07A 4ENQA 1E32A 1L3IA 1S6YA 4COKA 2WKQA 2WRZA 4YMGA 1CPYA 1UM9B 4ZMRA 3U16A 2WWIA 4RU1A 3I5UA 2EZ4A 4A5OA 3QKRB 1R0SA 4ESEA 1N34B 1NN5A 5HCNA 3QGMA 3GGCA 5EZYA 4WN3A 5F1YA 3TOVA 5AJTA 4BC0A 4FE4A 3BEOA 1JB1A 3LDUA 4QSMA 2AFIA 2QTAA 4K9KA 4DAEA 3HJFA 3W4JA 3NRBA 1PTJA 1E62A 2ZUUA 4R8KA 4WTOA 3CR7A 4QSHA 4UEJA 5T4HA 3QXXA 4R2IA 3LC0A 5EP1A 4B6SA 5GP1A 1AV7A 1ENOA 3ZHYA 2NZ2A 5EE3A 2OGFA 2HSZA 3FMPB 4B79A 2VXBA 1UANA 1J8QA 5AW6A 1YDWA 3QBVA 1VKOA 5JISA 2PFKA 1CXZA 2FSUA 1N0UA 2C9YA 3OX4A 5HJ7A 4HKTA 4ZEXA 2VQFB 2ZBEA 4XLZA 5B4UA 3ILHA 2QR2A 3M2PA 4Q7KA 1AX9A 3NX4A 3R7DA 3UYLA 4M86A 5D84A 2J5RA 2JHFA 3O4HA 1DIHA 3RRMA 3HKCA 3RIEA 2WWVD 1QAOA 4CQLB 1VSQA 2Y1CA 4LJKA 3AETA 1BMTA 1G21B 1L3CA 2CDCA 4OUDB 2I7DA 1NVUQ 1PCXA 3HWRA 4JP8A 1E4EA 2X9LA 1CC1S 3G9QA 4WZBA 1OFUX 5JCXA 1DG9A 1XTBA 5BWMA 2M32A 1TF7A 4GPTA 4D0SA 2R6CA 3Q8WA 5LFAA 3T5TA 3C16C 4A3SA 2RC5A 4LXYA 4RIGA 1F8FA 1HH4A 1P5RA 2NU9B 4PG4A 1UINA 2NUTB 3OHPA 4DUYB 1YR3A 5CJ2A 4G01B 3AIMA 1YI0A 4INJA 4XIGS 3BJEA 3NNSA 4X6LA 3Q0IA 2FZEA 1FDUA 2CVFA 1O89A 2G0TA 3QW2A 4YQFA 2G3YA 2QYOA 1NDUA 1UJCA 3VNVA 1IATA 1Q84A 4F93B 5KOJA 4MCHA 3HUFA 3IELA 1C7QA 4HGYA 4YDSA 3MS4A 1LY1A 4FGZA 4GEKA 4DIKA 1DB3A 5COAA 1FLDA 3H2KA 3X3HA 8ATCA 4MK4A 2O8CB 3A14A 5HKAA 4RJLA 5TMEA 3UJAA 1LPOA 1U4NA 3IIJA 1THGA 1KO5A 3FDXA 2YS6A 3DAGA 4K26A 1KO1A 2VZ9A 1XJCA 1Y3HA 4FDUA 5EUMA 5AKGA 5H7XA 3VMFA 4YUWA 4FB5A 4RJTA 4PQGA 1UXIA 1XCBA 5BXQC 3KEQA 3WB2A 2CVZA 1FXWA 2RKOA 1L4LA 3GGOA 4HGQA 4NS1A 4R2LA 1A4IA 2LKCA 4XSHA 3P7MA 5HNKA 3RS2A 2YN2A 2RIPA 4NZPA 5EIAA 2YFQA 1KI3A 4FP9A 3TTYA 1NT2A 2PE5A 2BFEB 3X1WA 1KQFA 3QVWA 3ZNNA 1W0CA 3DBRB 1J2UA 1UZAA 3H5IA 1CJUC 4KXNA 2C61A 2DQSA 2CNBA 5EQJB 3H9JA 4Q05A 4HNVA 3TZCA 1F6DA 1WDKA 3HMQA 3RGGA 1SAYA 4OREX 1QHXA 3UJ3X 4LKOA 2VVTA 4PZYA 1CUVA 1XU7A 1EAMA 2PH7A 4MQMA 5CM2Z 3NHAA 4DPKA 3GDGA 3AHJA 2XEDA 1V2GA 1ISFA 3ENKA 3ZHTA 3M81A 4RZUA 4CETA 1XE3A 1V5IA 4YJ3F 4ZVPA 1M2OA 4Q9LA 5EYPB 4E7PA 3JTEA 3QV2A 4Y9RA 1L5YA 1BWSA 1X1TA 3T4EA 2HQRA 4MVJG 4AJ1A 1VJTA 2QGFA 1OVMA 2UZAA 4FD2A 3AF0A 1WPQA 4W5WA 3LGAA 2OO7A 1QRDA 3P9PA 1NLMA 4WNAB 2PBRA 3GVIA 4JEMA 5IUNC 1KFCB 1L5ZA 1YBHA 3GLFA 2WYOA 4BNUA 1YIAA 4QJ5A 4C7MA 3Q6NA 3E9QA 2AR0A 5EXXA 2JJQA 5F73A 5LDHA 2GCOA 3IS3A 4V0LA 3D3KA 3I12A 3DTVD 3GGDA 4WRRA 4D8XA 5L9AA 4ENVA 2J3DA 3SK0A 3ND5A 3H04A 3ZHXA 2O57A 2NWQA 4MS1A 1I4LD 2MSLA 2QDXA 1XL0A 3F67A 3HB4X 4R2HA 4URFA 4MJ7A 4YI3A 3SHOA 1VKNA 3EDCA 4IWNA 3CSUA 2AJTA 4NOKA 4NPAA 2D0OB 1FMTA 3NR2A 4OB7A 5E6UA 4EO4A 1G3RA 4TKMA 4M9UA 1FP7A 1MXHA 2OLJA 2ZSAA 2X0FA 4HDNA 4XQCA 4NP6A 5THXA 2IEYA 4OIFA 3NFYA 2R6HA 4RFLA 4M83A 3EVAA 3NXKA 1D4ZA 4UOZA 3O47A 4WJLA 4UVGA 2UXBB 3RDPA 3HH8A 4GOLD</