3LE8A

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.70 angstrom resolution in complex with 2-(2-((benzofuran-2-carboxamido)methyl)-5-methoxy-1h-indol-1-yl)acetic acid
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
287
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLASSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantothenate synthetase
publication title Optimization of the interligand overhauser effect for fragment linking: application to inhibitor discovery against Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 101
structure length 287
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3le8A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3le8A01
1TFUA 3ZJVA 4QBTA 5K0SA 1V47A 2YWCA 4HPWA 3MUEA 2XRZA 1U7XA 4MULA 4NAUA 1TQ8A 1R6XA 1NUSA 4GRIA 1T6YA 2H2AA 4ZCSA 3CLTC 4S1OA 3MXTA 1WY5A 2QJFA 4YBRA 2QTNA 1XNHA 1VBMA 3VRHA 3ZJTA 4ZT3A 4I6EA 4ZCTA 3CVYA 3P52A 1GAXA 1YI8A 4ZT4A 3FOCA 2NSYA 3QTTA 5FO0A 2CV2A 1VLHA 4MLPA 1O6BA 1UFVA 1TYDE 1WKBA 3IMCA 4F3RA 3CLTD 1IFXA 1G8FA 4U8HA 4J75A 1N3LA 2IELA 4EG8A 1S4MA 2J09A 2PZAA 5FNZA 4WSOA 3CVXA 1PG2A 1N75A 4I6JA 2EL7A 5J58A 1I6MA 1RQGA 4U7JA 5BNZA 1NP7A 1U3CA 2PIDA 1EFPA 3IVGA 3LOQA 1WOYA 1O0CA 2BTEA 1K97A 1SURA 3UK2A 1H3EA 2WSIA 2CFOA 3IMEA 4DDKA 1MAUA 1PG0A 1QQTA 3QE4A 4JFAA 1YULA 1N2EA 4J76A 3TZEA 2QJTA 4MW0A 3TNJA 3D6VA 3FH0A 3UMVA 2D5BA 3SP1A 1QJCA 2DEUA 4EG1A 1YIDA 2X1MA 3K9WA 3MLBA 4EG5A 3H05A 2VTBA 1IHOA 3HL4A 3PNBA 1A8HA 3A05A 3UOWA 2H29A 2CUZA 2B7LA 3IVCA 3PXUA 3Q4GA 3SYTA 4F4HA 4MUKA 1LI7A 1QNFA 3P0IA 3SZ3A 1PFVA 2O5RA 3ZXSA 4ARCA 2WQ6A 3IODA 2YWBA 1GTSA 3HV0A 4CDMA 4KR6A 3N8HA 1O94C 3Q10A 1G59A 3SEZA 1JZSA 1K92A 1YUNA 1P7PA 1B6TA 3E27A 3IDFA 4MUIA 4EG7A 1U3DA 5AHWA 2YXNA 3FI0A 3CLSD 4TS1A 4KPUB 2Z3VA 3FWKA 4ZT6A 5F23A 2CT8A 3HZRA 4KR7A 2D54A 4BWVA 1N2JA 3IOBA 1T6ZA 5KWVA 2IP1A 4MW1A 4NZPA 5J5AA 2CV1A 4EF6A 3FNRA 3LE8A 1F4LA 3NV7A 1OWPA 3KT8A 5DASA 1KQNA 1N2IA 3CA8A 3TQOA 5DEOA 1Y42X 1JIJA 2DPLA 1PFUA 4MVXA 1OWNA 1X6VA 4EFKA 2A86A 4ZCRA 4FZJA 1NUTA 3CVVA 1NSYA 1I2DA 1O0BA 1Q19A 1U7DA 1N77A 2DR2A 1TYAE 1MRZA 1WZ2A 3RK1A 2XRYA 4R0NA 2ZUEA 4XFJA 1JZQA 4YP7A 1IH8A 2PZ8A 4MVCA 5EKDA 1ZJWA 4K0RA 4JZYA 4MW5A 4OUDA 4OUDB 1FYDA 1TYBE 1I6LA 1TYCA 1EFVA 3A4IA 1EFVB 1X8XA 3FHJA 3CLRC 1T9GR 1WXEA 3G59A 4RUKA 2J08A 2WB2A 2BYTA 4MQ6A 4YMIA 3NBAA 3P0JA 2QJOA 2V0GA 3AKZA 3C8ZA 3IH5A 3IOEA 1OWOA 1EJ2A 3OP1A 1NZJA 3TQIA 4L2IA 4DDMA 1O95C 1XNJA 2OQ2A 2OV4A 3CLRD 1ZUNA 1EFPB 4R2MA 3CVWA 3KT6A 4MW9A 3ISJA 5TS2A 3IUEA 2QUKA 1MJHA 4WNYA 1JHDA 3G5AA 1GZUA 1MOPA 3CLUC 4CDNA 4DJAA 1O95D 1OD6A 3LCJA 1KKUA 4PBSA 3COWA 2C5SA 3ELBA 4XFDA 1F7VA 1D2RA 4MUJA 1COZA 3KT0A 3Q12A 2RD2A 2TS1A 4AS1A 1KQOA 1WQ3A 1JEEA 2A84A 3IOCA 2PG3A 1EE1A 1FFYA 2VTBB 1GPMA 3RBAA 1BS2A 4ZT5A 1NI5A 5IJXA 3CLUD 1KH3A 3H9CA 5TEVA 4MWBA 4NAHA 3ND5A 3QTBA 3UC5A 4DLPA 4MUGA 1VL2A 3ND7A 3FIUA 1KP3A 1O97C 1WXHA 3PRHA 4UZFA 2CV0A 1YUMA 2PZBA 2YY5A 1JEDA 4EGAA 2EJCA 1NUUA 1OWMA 2I1LA 1ILEA 4H3SA 1KORA 3DV2A 3ZXIA 1R6TA 3IUBA 2ZUFA 2G36A 5J59A 1NURA 1MB2A 4ZT2A 2GKSA 1KH2A 1O97D 3OTWA 2CYAA 2IJGX 1VBKA 1N2GA 1IQ0A 1DNPA 3M5WA 5DB4A 1PFWA 5LLTA 3MMXA 1O94D 2DXIA 4PBRA 4MW7A 3AG5A 5TEWA 3P0HA 3CR8A 1KAQA 1I6KA 1J1UA 4I6GA 4UZEA 4HK4A 4MUHA 1HYBA 1Q77A 2Z08A 4YP5A 2NZ2A 2PXHA 4MUNA 3GUZA 4CQNA 3SEQA 1J20A 1KAMA 2QTMA 1QU2A 3TS1A 1ULHA 4DE5A 1LI5A 2QUIA 3VGJA 1VBNA 2E18A 1J70A 4Q93A 4JYZA 4ZCPA 4K03A 4MWDA 1JGTA 4ZCQA 4DDHA 2X1LA 2CYCA 4HJXA 4JXZA 1WXIA 1YIAA 3HFJA 3L92A 1XNGA 2GOYA 2QUJA 4GU5A 4EG6A 4EG4A 1QTQA 1KP2A 2A1TR 1IQUA 1T9GS 3ZUGA 1JIKA 1N78A 3TZLA 3SDBA 3FY4A 5HG0A 3N05A 2J07A 2CSXA 3COYA 1OWLA 2A1UA 3VU8A 4CT0A 1G8GA 2A1UB 2CYBA 1U0BB 3A2KA 1MAWA 3HGMA 3CVUA 3KT3A 2J5BA 4PY2A 1WXGA 1MB9A 4XSVA 2HMAA 1V8FA 2JAXA 1J1ZA 1GN8A 4YP6A 5DK4A 2V0CA 5IHXA 2Z09A 4PBTA 2VXOA 3DPIA 3FG9A 4ND6A 3ZGZA 1GTRA 1PFYA 3X1MA 4L2IB 2X3FA 5H7XA 3DLAA 2A4MA 3X1KA 1M1ZA 1N2BA 2R5WA 3HMQA 1M83A 5H16A 1N1DA 4AQ7A 4A91A 4R2LA 4MAFA 3PNVA 3IVXA 3RFFA 2J4DA 2JANA 1M8FA 4NX2A 5FO1A 4JXXA 3NBKA 3SZGA 2AZXA 1IQRA 1K4MA 2DETA 1Q11A 3AG6A 4NDAA 1NUPA 3H97A 1R6UA 2PFSA 2ZP1A 3ZIUA 4MVYA 2E21A 2WQ7A 4ARIA 1J09A 3FETA 2O8VA 4MWCA 3I05A 4KR9A 3K32A 4ND7A 1OBHA 1ZH0A 1JECA 4E1AA 4MUEA 3UY4A 1JILA 2QUHA 3INNA 4G5YA 3COZA 4MVWA 4QRDA 5KCMA 1KH1A 3S3TA 4G6ZA 4HJRA 4RPIA 3ZJUA 1KQPA 1MBZA 2E89A 3A04A 2DERA 1IRXA 1LW7A 1F7UA 2D13A 1IVSA 4MW6A 1XJQA 2DUMA 1JMVA 1G8HA 3RK0A 3U1VA 2DLCX 4P2BA 1WXFA 3RJZA 1M8JA 5HUJA 3BL5A 4G5FA 3JXEA 3N9IA 2HGZA 3ND6A 5K0TA 1GLNA 2HZ7A 1K4KA 3L93A 3PNYA 3AL0C 3COVA 4Q16A 3N2YA 1QRTA 3RHSA 1NUQA 1OBCA 4DNXA 1WQ4A 3X1JA 1QU3A 4EG3A 3IMGA 3D6UA 1EUQA 1EXDA 1F9AA 1T6XA 2JA2A 3GMIA 1H3NA 3KFLA 1QRUA 3AIIA 3H99A 3CLSC 4U63A 2QTRA 1J21A 2X0KA 5TGTA 3F3MA 2AKEA 1TEZA 1H3FA 1M8GA 5JBNA 1KR2A 1M8PA 3DO8A 4NATA 1NYLA 2A88A 1H1TA 4KKVA 4X0EA 5HUHA 1N2OA 1JIIA 3G6KA 4KPUA 1O96A 2GM3A 5LFAA 1O96B 4ZT7A 3H9BA 1EUYA 5KHAA 4MW2A 1QRSA 4MUFA 1CT9A 1Q15A 2A1TS 1N2HA 2A7XA 3GLVA 1M8KA 3FDXA 5LM3A 1MC1A 4OJMX 2AG6A 1WJGA 1O5TA 4MW4A 2E0IA 4QREA 4MWEA 3MLAA 3AFHA 1ZH6A 3ILVA 2RE8A
chains in the Genus database with same CATH superfamily
1NMSA 1UWKA 3B6KA 2ORWA 1JG7A 1D0IA 2FLVA 3K0FB 3VJMA 1I32A 1GPYA 2XRZA 3P2OA 4YFVA 3B3AA 4LJYA 3LVQE 3SYKA 3V8BA 1DAFA 4MITA 2BONA 1SXJD 1PHPA 2JGDB 2R3SA 1MHTA 1EU1A 1XP5A 3FGZA 2C42A 1ATIA 3LO5A 2BAGA 2A0WA 3JQAD 1Z7GA 1ZPDA 2CBZA 1Y1RA 1A82A 4BLOA 2ZKIA 4C5CA 1FMCA 4PX9A 2XKKA 2YRXA 2ONZA 3P5SA 3OF5A 4KZPA 4RHYA 3TLXA 4ZGBA 5MGNA 4TTTS 3HLKA 1F06A 1N3BA 5A6SA 4RCYA 5JFOA 4A0QA 2GO1A 1M75A 5TE9A 1U2TA 3RFXA 5JJLA 1L4GA 3IDZA 4J0FA 2ZUDA 4RHCA 3R7WA 3QEKA 1MNQA 5IN4A 3HBAA 1ORHA 4JOCA 4OX9B 4MWSA 1DXQA 4U9HS 5D00A 4AM8A 3B6JA 3HABA 3WGYA 4G0OA 3Q3VA 5HF8A 2DTEA 4Q5IA 1D9XA 1ZVKA 4ZMSA 2WYHA 1H05A 4RH3A 8ABPA 5MFPA 1JWAB 4OI2A 2X6TA 1E1CA 2QL6A 2ZXFA 2AUMA 4AJ2A 1RXIA 3NWOA 4Z4EA 3VDQA 3NDRA 2FR8A 2MYTA 3BJIC 3NHFA 1CETA 3AQIA 2J31A 4D8WA 2P5TB 1N75A 1G5FA 2A58A 2VDOB 1OXUA 2ARKA 4E5UA 1CJSA 5BV2P 4CEIA 4TYPA 1W76A 1EK2A 1IHXA 1L5OA 2J3QA 2OY0A 3O8LA 4MQBA 4CCYA 4URXR 5LIPA 2F8MA 1K66A 3MS4A 3KS9A 3D3KA 3G0HA 2W2VA 4E21A 1LPNA 1B6RA 1LSOA 3JYNA 4AN0A 4Z7NB 2HYDA 1TJ4A 2YIVX 2Y77A 4M54A 2XCLA 4LWQA 3KDSE 2EAUA 2C7QA 2B3TA 3KTAA 4IG9A 1T4CA 3CUEF 1U7PA 1NNUA 5KQGA 3BEOA 4JFAA 1WOMA 3WMEA 1UDRA 1U1IA 3GLKA 5CNJA 1ZY2A 2JBAB 2NZ8A 3S40A 1N4DA 1PJCA 3CZAA 3VYSB 5KQSA 4EFNA 1T5OA 4HN2A 1J0AA 4J4HA 1YS6A 2I6XA 3BXHA 2XODA 4LOLA 2CJWA 2AN4A 3DD1A 4F6CA 3GP3A 4O2AF 5KNDD 1L4KA 2R6ZA 2XE4A 3K2QA 3MJTA 3RC3A 1KI1A 5K3OA 3QLVA 4J3NA 1ECFA 1IHOA 3GDGA 3WAKA 4BFSA 4DSUA 1AM4D 1KSJA 4ETMA 3ADDA 3PJDA 1Y81A 3JZIA 5I4KA 3EG9B 4CDRA 4CKYA 1XLWA 1Y5NA 3BJZA 3O1HB 1QS0B 3Q4GA 1I5OA 1Q92A 3BZBA 2PZFA 4MVJD 1AHNA 1XI2A 2QV0A 3O21A 2PQ0A 3V4LA 1NW4A 2B4KA 1SGWA 3E58A 1LF0A 4EM6A 2PV7A 2PU7A 1TX4B 4CEJB 1Z12A 3UT6A 3CKKA 1KO5A 2Z2XA 1OW3B 4FZVA 3HJNA 4DLTA 1G3MA 4H1WA 3KQLA 2QN7A 3F6PA 5J3JA 2FOLA 5B58C 4QQKA 5C8YB 3PFWO 1OBVA 4HUQB 4TVSA 2HO5A 3WK4A 4BX9A 1UWCA 4RENA 4QE3A 3VR5A 3AHCA 1YQQA 3RGGA 1WSWA 1MT3A 2I22A 2AUTA 4HQ0A 1HDIA 4P3XA 5THXA 3Q7IA 4QXAA 1QKIA 4KVFA 3K73O 4P98A 5ITVA 1U3TA 2Z3ZA 5C1OA 3WGIA 5A6VA 4LZNA 1BW9B 4NJEA 4LGMA 3MGBA 1VI6A 3GIDA 2CV1A 3PDWA 4BX2A 4M21A 2X9GA 3WMGA 3H1EA 4BMPB 1G7RA 1JU9A 2YY6A 4EECA 1NKTA 2C7VA 4WVFA 4DJEC 4RJTA 3VR3A 2IX3A 4YRKA 3PV0A 3I64A 5E3IA 4N03A 2VNHA 2VQ6A 1Z83A 1YZVA 3ETHA 4UMDA 4Y6PA 1R1DA 4BZWA 5HVNA 3CQ9A 4V0MA 2O8EA 2WTUA 1DS6A 3AR4A 4CPDA 1A9QA 1GA4A 5LU8A 2KPOA 3FR8A 1ZXXA 5TV2A 4JLAA 1CZKA 2WV7A 5PNTA 3DQPA 3ESYA 2PZLA 1Q19A 1BDJA 1U7DA 3A1EA 3FHCB 1M0WA 4WKPA 4X1KA 1JLMA 4BNJA 2GF9A 3PJRA 4JLKA 3G5LA 3Q3CA 3SVTA 1ENOA 3OJFA 5B57C 2C5HA 2VSOA 1V8DA 3QNWA 2HWWA 4Y9RA 5C46F 5C8ZA 3DQZA 2V7PA 1NXPA 5EKDA 2UVDA 3FMFA 5G2OA 2GXSA 3IAHA 4MS1A 4EY3A 2QZJA 4K9PA 3RJTA 2R6DA 3OKCA 1W34A 1MO3A 2ATXA 2RHBA 1OA0A 1L7DA 2V3WA 2OMEA 3BGDA 4G4JA 4I3GA 4YTEA 2NNLD 3T9CA 3M1IA 1T26A 1J22A 2OK7A 3LIPA 2EEPA 4R2KA 5EXDA 4R69A 1EFVB 1HETA 4A6PA 4GOMD 3UOGA 3Q7RA 4FILA 5TMEA 2P40A 4CMEA 5DBOA 3CLRC 2GPBA 4QEZA 1TIPA 5CFPA 3D6MA 2H4ZA 5CEFA 1P2GA 5CCDA 3PVZA 2I0FA 4BHTA 2FN7A 1Z5PA 2HK7A 2FE4A 3IA2A 3D9QX 5FPSA 3TE7A 2QJOA 3K35A 4A16A 4B75A 1LC3A 1P7VA 4L73A 4Z9BA 4Z3OA 1VJ5A 2R7KA 4BBAA 1LF5A 4Q19A 4L3VA 4MWTA 3KJQA 4ZI3A 3D7MA 3ZQUA 2E55A 4RJJA 4L2IA 3S0JA 2FPGA 3AF4A 4PONA 4XQGA 3ORHA 5F76A 2GZAA 2XBMA 3MJSA 3CNOA 4NLLA 4D25A 5EIWA 1DKNA 3ER6A 3OOYA 1QP7A 2AFHA 2DQYA 3MM4A 1OF1A 1XSEA 4JODA 1KYWA 5H8WA 1F8UA 2VPXA 1NBME 4U2FA 4WJZA 4I8IA 4GLJA 5AM5A 3DOHA 5GTDA 3CGWA 2EGHA 4RAOA 4AS2A 3QBTA 2HQSA 3EA5A 1L7QA 4TZKA 2QN6A 4G2TA 1R8XA 2PUEA 4GZ3A 3OURA 1DBSA 2VUTA 3LBNA 1EFHA 1CZLA 3HFRA 2ZI6A 1TD1A 1IIBA 4L9RA 3L8ZA 4N01A 4Y2PA 1P62B 3COWA 5ALFA 5G0VA 2IWRA 4B6QA 1IIRA 1G66A 2AGVA 2J7KA 1X1BA 1XD9A 3P2MA 3KWFA 3W5UA 4FI3C 1IZZA 2VF4X 5TGZA 5HF5A 4PLGA 3KKKA 2C2GA 4QUJA 5DNWA 3KC2A 2JLQA 2HLDD 3T1HB 4EYEA 3LFUA 2PFKA 1QVWA 1PWZA 5TEVA 3KKLA 3T7TA 2X8JA 1F4VA 3EMDA 2RH8A 4LHEA 5LYJA 4DRXB 1AMNA 1IOWA 4ERNA 5A3SA 3UC5A 2IWHA 4HMOA 2R8YA 1Y63A 2VHCA 3IJPA 3NONA 3QKRA 2G9QA 2Q1YA 4M38A 5FPYA 5BVHB 1Y37A 4TXJA 1WHTA 3AMVA 1HZZA 5CFQA 2HN9A 4E5SA 5GONB 1V39A 2Q4DA 4EHHA 4ESEA 3BMNB 2G7ZA 1KRHA 1WX1A 4KDRA 4F84A 4ZVQA 4E7PA 3WNZA 1AV7A 3EWAA 4LXXA 2GAFA 2EKPA 2WD8A 3AJRA 4Z4FA 5LP6F 5J2TA 2HWXA 4MUMA 3S1AA 2AWNA 2B34A 2PDAA 1Y5MA 1ZISA 2I2BA 4YRCA 2BM0A 4F2GA 1C81A 2QD2A 1NV8A 2XEXA 2BP7A 3P27A 1CD5A 4BZXA 1BGWA 1FPQA 5H5JA 5JS7A 3I9V1 1L8LA 2P1ZA 1G5TA 3PXAA 4JQCA 5DB4A 4AG6A 1MO2A 3RYFB 1IBSA 1I30A 2HNBA 2JH9A 4QDOA 4QDUA 2H59A 2XE7A 1E79A 3O9MA 3OAAA 4WMLA 1C3VA 1YC5A 1Y3DE 2FF5A 2KLBA 3KYCA 3PQ4A 2VT2A 4ISCA 3U13A 3UJBA 1AO0A 5BMVB 2V0NA 4Z1MA 4UC0A 3Q2OA 1PD0A 1SXIA 4YGYA 3Q0EA 1XJWA 4FOTA 4HAOA 4L6AA 1M7BA 4W6ZA 1PSWA 1SCKA 2VPIA 4KXWA 1M33A 1K8XB 4J7XA 4O1MA 5JAQA 4ARZB 1B16A 1Y3AA 3LQ2A 4II2A 5H9WA 2A9JA 1BDHA 1G6HA 3ZBPA 4AIIA 4E7OA 1OI4A 4RJIA 5DM2A 1K7CA 2NZ2A 3JATA 1N2SA 4L0MA 1U2GA 2WZCA 2SKCA 3T5BA 2BEJA 1HM5A 2JGJA 1C7JA 3TVYA 1Z6QA 3A25A 1LV8A 3HDQA 2GKGA 2XZLA 1IMJA 1XCGB 3QKTA 4W4TA 3VUEA 4PC7A 3NV9A 2D2IA 4YEDA 5IG2A 1YWGO 1MX9A 3DBLB 5CNIA 1DQNA 3FVQA 4O1HA 4Q6WA 4F8EA 1E0AA 5BO5A 1WXIA 4KMRA 4OP3A 4X7PA 3GCGA 1GTJ1 1IG3A 3N7TA 5L3RA 3RWBA 1PI3A 2GJ4A 2MMCA 3UUFA 1KDRA 5TQ0B 3E9RA 3L1IA 4UTRA 3AKEA 3STYA 3TIIA 2EERA 4B45A 2XUOA 3A4TA 2ORYA 5FORA 1L5WA 1XQ6A 1PUIA 2R4UA 4Y6OA 5ETJA 4HDKA 2QMZA 1I2BA 3HVKA 4ABTA 4L85A 2OCDA 4PFKA 2CSXA 1L4LA 3IKJA 3Q5DA 3GPBA 1C50A 2FZ4A 1G8GA 4QPNA 2OFFA 1BXRB 1MAWA 5BVGA 1Z4MA 3G2JA 4HDQB 2B9VA 2J5BA 4FC7A 1RXCA 4FMDF 5JPDA 2J3LA 4TUYF 4V1CA 3W5BA 3HJGA 5K8VA 3NHYA 3BMCA 3DZCA 3RSOA 4LXGA 3LLSA 4B6JA 3DZIA 2X4LA 4IOLA 2OVBA 2ZTUA 1V26A 3RBXA 2IQIA 3GGJA 1ZC3A 2I6UA 2QMUA 2VPYA 4M3NA 4XX1A 1HNWB 1AZWA 1YVPA 2GPAA 1BGVA 5D85A 3ZNOA 2PUBA 2LCIA 4XM1A 3AGQA 1KEZA 3UT5B 1YJBA 1CE8A 1HYHA 2IHYA 2ODBA 2X86A 2ONKA 3R3UA 5AOVA 1LBQA 3S2SA 4D4GA 5IAOA 3K16A 4URUR 2ACEA 4LK3A 4RZXA 4BRUA 4MAFA 2VP5A 3H2SA 2EG9A 1VA4A 5GJVC 3AXTA 1XL1A 2V6JA 3EIEA 4EDFA 2WMDA 5EINA 1T2UA 1E2NA 1R5OA 1HNNA 3NCTA 4DKJA 3R0QA 2DUJA 5BSVA 4NU6A 1IQRA 1QDUA 4P3PA 3R7DA 2B4TO 3O2SB 1RCTE 2P77A 1CJBA 2QTAA 2IW1A 1UWVA 3OUUA 3BXEA 5D6NA 5DHFA 5FBWB 4BPRA 2E4ZA 2BMFA 1HT3A 2P9QA 4XWKA 4CFYA 4GDFA 2CDNA 2FWAA 2NQTA 3I39X 4L4YA 3RUDA 1WMEA 5JQWA 4F11A 4OAQA 1NL3A 5A1JA 3KSAC 1CVIA 5AXCA 4CMGA 1T0IA 4EUSA 5BR4A 3RCBA 4MICA 3TB4A 4F71A 4OLAA 3UUEA 1RKBA 4C3VA 4HFMA 3BIOA 2BI4A 1IULA 2JDID 2XWSA 4B7UA 3F7MA 1RMTA 3KHKA 2HT1A 4ARVA 4QD3A 1NIJA 3LCCA 2CZGA 4MR7B 3DA8A 3PXBA 5FTMA 4D45A 4TSFD 1LSJA 2FW1A 1T1GA 1IWPB 5DTMA 2NU8A 1DVRA 1E0DA 4WLEA 4LDRA 1IHYA 1YR7A 2QRNA 5AUOB 4ZN6A 1OQAA 1HE5A 3B2QA 4INAA 3FN4A 4IDBA 1G2QA 2R7AA 4UXHA 2V7EA 1HDCA 1YCFA 2I4LA 5ES3A 1XHLA 2I1VB 4DMHA 1XA0A 4NABA 3PHBE 1RXUA 1WW3A 3CJTA 4S1NA 3UMMA 5LD2C 1EUCA 2FY8A 2XUKA 3B9QA 4DNXA 3H2YA 4EG3A 2XA1A 5D3MB 3ANMA 3CNBA 3FPHA 5AK0A 3V4RA 4AKHA 1E7WA 5A9SA 4TL9A 1AIPA 3R40A 4NCIA 5FH9A 2UVPA 1DO0A 5FOQA 3QE9Y 4HQOA 2BOVA 3LL7A 4PO3X 4M37A 4CV2A 5F9HA 1VPEA 3NYWA 4A26A 1F12A 2HCRA 2AKEA 2XYRA 4WVLA 5FFNA 5FB3A 2I2CA 3L0IB 2IYWA 1EP1B 2HLHA 3IO5A 3KKPA 4LV5B 1F2VA 3NVMB 4FX2A 4Q4JA 2NXNA 5DGCA 1YHNA 1C30B 3KZCA 5AKEA 2FQQA 3K9FC 2NYUA 4X0EA 2ACWA 2HHLA 3VYVA 5KUTA 5IUKC 4MWGA 5IKXA 2ATEA 3A31A 3EYAA 4LYGA 5I7UA 3MWGA 2VF2A 1RJDA 2LBPA 3L9XA 1DAKA 4AY3A 3HWSA 1XJ5A 2X0IA 1Q1EA 2CCKA 1PEYA 3LUAA 5FWAA 3ZWBA 3EISA 3DT8A 1JKIA 2R751 1NBMD 1SM4A 3QOWA 3I76A 3L0ZA 3MWFA 4DCJA 5HRUA 2NU9A 3N8DA 1M8KA 2I4RA 2O1EA 2N1MA 1GQ2A 2QYHA 1IDOA 2Y1CA 4NZNA 1WJGA 4WCFB 3SYRA 1SKYE 1AKTA 1R5BA 5I48A 4F3NA 4K9RA 4QREA 1AGPA 2Q2NA 1CUSA 1G6KA 3TXXA 1EWYA 3RSFA 4O63O 2NZYA 2OFWA 2YHAA 4DV4B 2BCJQ 4JB8A 2HY7A 2NPIA 3KXDA 4MI3A 1M0EA 3PD7A 3RUHA 2MIIA 4ID3A 2HQBA 2Q9UA 1RRGA 2QSYA 2RIRA 4XLLA 5J4VA 3U56A 3ZJVA 2GH1A 3CZ9A 2D0IA 5LYJF 3MERA 2VQEB 4CMCA 2GBLA 4HH3C 4HX9A 4BX3A 1JEQA 3DBIA 3QVUA 1A72A 3UFXA 2X7HA 1CJVC 1RZ3A 2Y71A 1T8RA 1YACA 3FBGA 3V4SA 1IRIA 5EZSA 3I2GA 5F3RA 1C0LA 2AXQA 3Q8WA 4FR2A 3FA2A 1DWUA 2QRJA 5HMLA 3L02A 1ATZA 4RL6A 2PUTA 3CRW1 4BGEA 1GKLA 3OY2A 5J2TF 1ZX1A 5AW4A 3HHEA 1HE2A 1MEEA 1V8BA 3R3ZA 2ZRFA 5SV2A 4MI1A 1X7XA 3FJ1A 3F7TA 3P52A 3D43A 1P60A 3GRZA 4GE3A 1VJGA 4MV3A 4WCVA 5LLSA 3H8SA 3LP6A 2R48A 1V35A 1BH6A 3B89A 3G8DA 4GPD1 5AUPB 2ST1A 3JSXA 3R3YA 3WYFA 1S2OA 5E95A 5KVQA 3CJRA 1P17A 5AW5A 3FVWA 3AY3A 3C6ZA 2X0DA 2YJ3A 2K6GA 3BL8A 3EULA 3F5SA 2CJPA 3JSAA 3NDIA 3NRJA 4OGLA 3FYSA 4LFAB 3V8MA 3NI2A 1G9SA 2QRVB 5AVYA 2YHIA 3SSAA 2OYCA 3AIMA 3PUWA 4NZYA 4U7JA 3RVRA 1XCOA 3RRZA 3G85A 1BFKA 1NF9A 3M4XA 3ZZNA 1B8VA 2V9ZA 2VDUE 4NAVA 3KQQA 3IXLA 1W85B 1Y89A 4AY5A 1TMKA 3G1WA 3PLRA 1WOYA 1R5NA 2AS0A 2OCXA 1J0XO 4NIMA 3BSSA 2VWGA 3PXCX 4ZZ2A 1ZWLA 2C8LA 1PJ3A 2IEIA 4M1YA 4G5OA 2QLFA 3MG9A 3T41A 4AZTA 4BQEA 1KIAA 2XT0A 3C3YA 1KJIA 3GB9A 3VTAA 1PJLA 1PR0A 3GAFA 3ZYZA 4EBFA 1YULA 2F3RA 5IK2D 1SXPA 1GTMA 5TR9A 1UODA 3JQGB 5EFZA 3EEYA 3VV2A 3WHKA 3LOPA 4RCVA 4BMCA 2X4DA 1E8NA 1QJCA 2P9FA 5A7GA 4NNPA 2PSHA 5IDVA 4KPEC 3KKQA 3DOIA 3GFQA 4I4TB 2VQSA 5JD3A 4D9EA 4CI9A 2YX1A 5CVTA 2YVQA 3S70A 2JJ2A 5AW7A 1PK9A 4XQ0A 2I3GA 5LQAA 2CVZA 2C4MA 1FRVA 2WU0A 2Z2JA 4G5HA 1RYEA 2HJRA 2QLMA 1DX4A 4NZ9A 2KHZA 3KVRA 3T9FA 4BVAA 2N75A 5FLKA 4QKQA 2B8EA 4UTOA 3DC7A 1SU8A 1J4AA 2VT6A 3G0IA 3II6X 3TLKA 1XU7A 2ASVA 2BMJA 1BVUA 1KO7A 3MQFA 2XZPA 3SU8A 3KYDB 3WWEA 3NNDA 1WB4A 3GARA 1LC0A 4BO6A 1YHYA 1Q5PA 1TUBB 4FS8A 2Z04A 1EYZA 1OYOA 1ZFNA 1L5HA 1VB5A 5M3BA 1XAGA 3O0DA 3WLTA 1H2XA 3MMSA 3PEFA 3RR2A 3JQ8A 3PSAA 4IFTA 2G3DA 5DP1A 3RUEA 1A3CA 4CGYA 2AQIA 1J9GA 1OBFO 3OCCA 3TJZA 3HZRA 3QPVA 3IAUA 5IJAA 1DRVA 3ANTA 1HUQA 3OIDA 1BWRA 1VSVA 2FPPB 1LQ2A 2EQBA 4BNVA 3E05A 3HCEA 1T1SA 4IWNA 5J5AA 1PK7A 5SZIA 1NFRA 3T4XA 5EZ5A 121PA 5JH7A 1QP0A 3RVLA 4DV2B 4Q7MB 4RIHA 2AC2A 2WAYA 3IIIA 3Q3EA 1RWNA 3N53A 5DM70 1X7WA 4BQOA 1AA6A 1JR3E 2NX2A 4IRMA 1GILA 1Y42X 2H1RA 2JLRA 3DMDA 1DIAA 2ZIWB 3JWJA 1GPH1 1VXRA 2UUOA 1EVJA 1D4OA 1Q91A 2CDCA 2VJCA 3E18A 4J0GA 4L15A 3S5JA 2JBHA 1UKEA 2Q4TA 2WJPA 3KHTA 1SCQA 4K7JA 3R75A 4DNQA 2I91A 3IUSA 4JXJA 4DIMA 4ZOLA 4D3ZA 5LWHA 1QSGA 2JI7A 1OROA 1TYAE 1WZCA 1WZ2A 1G5QA 4FW9A 5JWHA 1BZYA 3ZCVA 2QTZA 5DGIA 2Q6LA 3UC9A 3W9UA 4R6WA 4EPYA 2UYOA 1E3DA 5CUQA 3O3CA 5H02A 4BATA 4AUMA 5LNK6 1KQGA 1QF9A 3EMKA 1SG9A 3OU6A 4L0QA 1GP2A 4HLCA 3RVQA 1RLOA 1YOVA 1F2UB 3LG2A 4F4FA 3ZH9B 2O54A 2P3QA 2H52A 1Y8QB 1TYBE 1ZIDA 2VPWA 3QXXA 5F1KA 1REQB 1TL7C 2NU7B 3GA7A 1ZH8A 3F71A 1Q3TA 2O2HA 4L5JA 1O6CA 1XMXA 3H18A 1XV5A 3C48A 5DX1A 5AKKA 3B38A 4HRXA 4DV7B 1GY8A 4OG2A 2C7OA 3VNVA 5L4LA 3ITDA 1TCBA 1XMOB 4V2UA 4FC6A 5IS2A 1SUEA 2JIQA 3WIBA 3ZHQA 1ZD3A 3FF4A 4YMIA 2ZR7A 1FU8A 4C6RA 3VC7A 3H83A 5A4JA 4CKCB 2V0GA 5DNYB 5GVSA 4I66A 1K7EB 4MO2A 1AGRA 2BHTA 1XT6A 3IEUA 1ESDA 1VCOA 1E77A 3HG7A 3T15A 1N0VC 2VBFA 3UMBA 3STXA 2QLNA 1BHJA 3BEDA 4I4NA 4QFDA 1MOQA 1QFZA 4BVFA 2Q5EA 3T3EA 2CCGA 4HXGA 1DDIA 2OV4A 2QTBA 2A9VA 2GZ1A 3CZ5A 3P9ZA 5DFAA 5JVDB 2Q5JA 5EKUA 2ACKA 2O8BA 5DEIA 3SXUB 4BE7B 2HI0A 4J1QA 4LXUA 3K0CC 3AESA 4MW9A 4BRWA 2Z1MA 5EXTA 1E1QD 5I01A 3T06B 2DHDA 3FDZB 2H7YA 3B78A 1WLYA 3FUCA 1OZFA 1C9YA 5BV8A 4CEHB 3SDSA 2Q9BA 3OFVA 3VZBA 1L9KA 4OK6A 2AOUA 2R5NA 1EK0A 1HEYA 1G21B 2NOAA 3ELBA 2NQ8A 1WEHA 3TZKA 5C34B 3V46A 2UXBB 1GRNA 1Q57A 3OPNA 3IQIX 2EYQA 1U5CA 2IOFA 2M6RA 1J8DA 5CGZA 2RD2A 3GAAA 2COEA 1Q20A 3BH7A 3PC2A 1YNOA 2QVXX 3WRYC 2G77B 3D5TA 4ZC1A 1EE1A 1Y3BE 1QTRA 3RBAA 1FY2A 3H2JA 4YJ2A 2CL5A 4FJ0A 2C0PA 4IOMA 1RHQA 3PTZA 2CLLB 4MWBA 4P4LA 4UHBA 1QO0A 2OZLB 1DC3A 2G88A 3A1FA 1T8TA 4FYJA 2FOIA 4RH0A 3NDPA 2VHEA 5HXAA 2ZYGA 2E4UA 1PQUA 1YUMA 4H27A 1JIUA 4NECA 3O3MB 3OZXA 4LE2A 3VPHA 3OQBA 1FOEB 3NUGA 4OSPA 3U7FB 5CNMA 2KI5A 1KMMA 2NUBA 1QYWA 2YWDA 3OEWA 2DBYA 3VOSA 4WINA 5JXWA 1CDZA 3KOWA 4XM0A 3PNQA 2XUGA 2X8BA 1N2CA 3G1TA 4FB5A 5JWOA 2H06A 3BRSA 5C4MA 3G0BA 3V48A 2JIZA 1MOSA 2ZSKA 3STUA 1D5CA 3PGKA 4RVOA 5D1NA 4TTPA 1OFTA 1U99A 2JHFA 5C0OE 4O4LA 3KTOA 2B25A 2ODAA 2VSQA 4S05A 2G70A 1XKTA 3R5SA 1DEHA 4NCBA 4Z49A 2X2PA 3DBRA 4PXSA 4GX2A 4EATA 1NVFA 4Q1CA 1O6ZA 1V95A 2X19A 1K89A 3A9TA 4PBRA 4UASA 1DHRA 4QSHA 1FX0B 4CKXA 1KOFA 5I4IA 5L3QA 2PSDA 2CXTA 1KEUA 3GC6A 1OXKB 2OK8A 4UZEA 1NBAA 2HF8A 1UXKA 1TEHA 1HYBA 3MB8A 2H65A 4LUCA 1Z2PX 4UXIA 4D5EA 1VIDA 3MTAA 5FJIA 3HXMA 4X6LA 2UU9B 3ESAA 3FPEA 3OPQA 1J20A 5IYZA 3T38A 4YCSA 2WNSA 4M1WA 2QMHA 4UBLA 1G5RA 2ZBVA 2ZB3A 3EE6A 2XQVA 4KQXA 4EY6A 1T36A 4YDSA 2DULA 4AICA 1Z0IA 3M4YA 1V37A 3BB3A 4LRXA 2FK7A 5I51A 2IZ1A 5JLAA 3PPIA 3VJRA 3PFHA 2IIVA 4HJXA 4JXZA 1CV2A 1XZAA 2BMWA 2VUUA 5JS6A 3O4RA 4CU2A 4M88A 3RU2A 1C80A 1L8OA 1KP2A 3NOOA 3ODPA 1UQTA 1N0WA 2CD7A 3PNLA 5L51A 1G8KA 1B3RA 4G26A 1DTWB 1JJFA 3LL4A 3A6DA 4KACA 4LXHA 4E15A 4HNSA 1FDWA 2PD6A 1IATA 1KO1A 2ZRAA 5FULA 1A9XA 4YRRA 4RANA 2A1UA 1SY7A 2GTHA 4FS3A 2BKXA 2BW0A 1EJ0A 1HE1C 1JH8A 2G76A 2PKQP 2O3RA 2Q5IA 3H1PA 3AC0A 4JQOA 4NKRA 2GZ2A 3EXHB 4HX5A 3U19A 1DL5A 1V8FA 5BWBA 4NXMB 2H1HA 3TL6A 4W8GA 2O7RA 2YC2C 2YL2A 1CFJA 1ZUIA 5K3DA 5L9AA 2P1DA 3L7IA 4MQ5A 4IL5A 3Q7QA 2DQSA 3E7FA 1LRKA 3LHIA 3D3WA 5EXEA 4RK0A 1DMSA 2CE2X 1OMOA 1EINA 3AW8A 1RLTA 1MG0A 1ZVMA 3U7HB 1O03A 1ULZA 3H7IA 3X1MA 1PS0A 5CG2A 1KRXA 1E6WA 1PTKA 4LPKA 3X1KA 1C0IA 1CRLA 2IHUA 3HC7A 4R8LA 4IZIA 5JZ9A 1PL0A 2G17A 1OXMA 1UKCA 2R5WA 3N75A 1GO2A 3P9YA 4WLVA 3TRFA 4JENA 4ZKEA 5FUQA 2BKVA 4LIPD 4M1QA 3QPUA 1AG9A 4A36A 3IVXA 3WIEA 2TMDA 1JG4A 3WL4A 5JAIA 1R15A 3JZFA 1KE1A 3VOAA 1I4TD 2C2WA 1E2QA 1T2DA 3JW8A 1XZHA 1Q0QA 3OY7A 3RS2A 3W4IA 4CHGA 2HMYB 1JDBC 2BBWA 3I58A 3U62A 5FWDA 3C41J 2MSWA 2I7TA 3RS5A 3SBOA 1UJCA 4LOAA 1I94B 3BWBA 4WDRA 3WWPA 5LKRA 4ND7A 3E9CA 1PT6A 4LJRA 2O57A 3W8EA 1SRRA 1KKLA 4MV9A 4D3DA 4GMKA 2E4XA 2ZAIA 5JAUA 1ZSVA 4C3UA 2FEOA 1YVDA 2FX3A 2HBZA 4JYCA 3RF7A 5BOSA 4U2BA 2FEXA 4DWWA 5BNFA 4ZOLF 1UIRA 1CEQA 3VR6A 2WU4A 5BUCA 4MKHA 1B8NA 1SVKA 4UM5A 3T7KA 4DIBA 2P2NA 3KLMX 3QE0A 3VU9B 1YXMA 1XJQA 3W78A 1KYZA 4JC4A 5FL7A 5K0JA 3M4JA 3RK0A 3LGXA 4IFBA 3U0VA 2DLCX 1CUYA 5IDWA 1QO9A 1YR6A 2WSMA 3Q6NA 4X8MA 2F3UA 1B2LA 2J6CA 2I9PA 5EVJA 4EUNA 2AKYA 1IY2A 3RQIA 5F7JA 1VL6A 4KQ6A 3EGWA 2HZ7A 3FWZA 1IHUA 3F98A 3F9RA 4NNOA 5DYYA 1Z35A 3COVA 3R74A 2IOQA 2VQ3A 4BMZA 4D98A 5FX2A 1K9VF 2D7DA 4AIRA 1XVTA 2ZRLA 2DCUA 3ZNNA 3UZUA 3CH7A 4WN9B 3HCBA 4BP9A 3DMRA 4UTXA 4V0ME 5ALRA 3R6LA 2OBMA 1H3NA 2XI4A 1OT3A 1Z6GA 1CG6A 4F9EA 2D1QA 3THYB 2XY4A 3HCRA 5HE9A 1Z7YA 3OQJA 4G09A 4KGVA 1FTGA 3K1AB 4YMHA 3F3MA 4MTCA 3VYWA 4I1SA 4WN3A 1WCIA 2MSEB 1R6BX 2A9OA 1K6EA 2V7UA 3CEMA 3L05A 3PITA 1KR2A 1M8PA 2CNLA 3FCOA 1NYLA 3OVMA 4G0NA 3BGOS 3DL0A 5U4XA 2FWRA 5KVAA 3GROA 4X1YB 2A88A 2VSYA 2ZBUA 4FOOA 3FRIA 1GRCA 5LNK1 5IT9A 3KR9A 5BWCA 1BU8A 4Q34A 1R3DA 1E1LA 2JI6A 2UZ4A 1EKXA 1AKRA 1TPYA 3QVKA 5TMPA 5F5XA 5HIAA 1V2GA 4MLZA 1OIXA 2ZBPA 3D4NA 2RCYA 5DW3A 1A71A 3WB2A 1QRSA 2BLNA 4GI7A 3C7KA 3UQYS 1ZJJA 2EBUA 1KMHB 1LTKA 3JASA 1J23A 4ZVPA 5JZMA 4GI5A 4XD2A 5G2FA 1W0KA 2ODTX 2ZR8A 4G0PA 4O33A 4RWZA 3WMRA 4XIFA 3JV7A 4HZIA 1QPGA 2Z4TA 2Q3CA 4JBYA 4OI1A 3QE3A 1SCNE 4TT3D 4RLHA 1W19A 3JAKB 4C0KA 4S2EA 3EOAI 3GZJA 1MVLA 4L28A 4BO7A 2B4QA 2FSPA 1LBIA 2JVKA 1SBIA 3EVNA 3Q3GE 4R3UC 3UHOA 2JGEA 1FTNA 4ESOA 3KCNA 1MQSA 5DBIA 1FYXA 1SHZA 1NQWA 2JARA 4FQ8A 1BU5A 4Q03A 2BCGY 2J48A 3AUKA 1AKNA 1HFJA 5CGQB 3DWFA 2FPKA 2X13A 3QHQA 4YJ2F 2ZRHA 5T3YA 4AULA 3T1YB 5ALJA 4KR0A 4B6FA 1Y5RA 1V47A 4F8JA 1AKUA 1MXFA 1DKLA 1YJQA 4L9WA 4LQCA 4JYAB 3JQ9A 4GOJA 4HXYA 2AFHE 1CR6A 4WI1A 4BU1A 4DMLA 5AM0A 1ML3A 1NJ8A 2G0AA 2BTOA 4PO1A 5J1SB 3ZJYA 1NZFA 1WUYA 2I3AA 5CA0A 5ES4B 4XR4A 1ZD4A 1B76A 2PIAA 3HUFA 3G2OA 3R77A 4TXMA 3C7TA 5EPUA 5AFSA 1YAJA 1ICIA 3TOCA 3VAAA 2CVPA 4RKRA 3FNGA 2FXIA 4RSHA 4ZXFA 1CUBA 2W8BB 1V7CA 5FEUA 5GPBA 3CX6A 5LQMA 3SKYA 4U9IS 1V8ZA 1GD1O 1X2BA 3TTVA 5FV7A 1VPTA 3BTOA 4NPAA 3NWBA 5CBKA 1HFWA 3R44A 4OGKA 4R83A 2IU4A 4GBGA 3FOCA 2INGX 2C20A 2ZI9A 4HH4A 5F1PA 3ZDAA 4Q9HA 3OCYA 2R44A 4FEAA 2ZWVA 1KBQA 1O6BA 2JFNA 3OMLA 3WRXC 3O7MA 4G4SP 1C9EA 1WP9A 3CLTD 2VDJA 3I42A 3P9CA 3PFCA 4CQLB 5CA1B 4MVJI 1FNBA 2LMEA 2GVNA 2QU7A 3KOMA 1LTQA 2VCYA 5JCJA 3EDCA 3SR0A 2W11A 1RQGA 1GRVA 2B94A 3ESBA 4G1MB 1BMFA 4XVRA 1T8WA 2V03A 1RI5A 3DAYA 5HCUA 2OPHA 4UE3S 4NEGA 4YPVA 2Q21A 2YHBA 1SWWA 1TIKA 4AYWA 4QECA 3ZX4A 4PVDA 2K87A 2Q7DA 5FBHA 3CFIA 3V00A 4FTWA 4V0QA 1QP4A 2WHXA 1XA4A 3OU7A 4OHMA 2XUIA 3AF3A 3H0EA 3KUCA 1S2LA 4TTJA 1CUWA 1QIHA 4PCVA 2OP1A 3JX9A 3WOVA 5ARBA 2GCEA 2X5JO 2VSFA 1N2EA 4U6QA 3PE6A 2A5YB 2F17A 3ZQ6A 2P2CA 5DXJA 2M9MA 3KOYA 2D5BA 3T5DA 3GQBB 3H2ZA 2GTIA 5HUQA 2VA9A 1DJPA 3GJZA 5SICE 1PKXA 1SBTA 1XXLA 2FKNA 4TTAA 3RBZA 1JLSA 3RTGA 4E4TA 4K2HA 3HL4A 4PS1A 2IUUA 1GNTA 1EM8A 1A8HA 4WNAB 4FKMA 3G17A 4TKMA 3UOWA 4QU9A 2WIGA 3WWDA 2CBGA 5SY6A 3S8YA 1Y8RB 3QENA 1V5EA 2ZRBA 3H5NA 1S1CA 4K87A 4PRLA 3OFSA 2OKCA 1OLSA 2XBLA 4CL8A 4P0PB 1UBJS 2E1PA 4RPJA 3KB6A 1YS1X 4H08A 3UMGA 1EXVA 5ALHA 1K06A 2R60A 2YWBA 2V5UA 3DFIA 2AHRA 1E9BA 1LW6E 3EPRA 1CRPA 2A59A 2AKAB 5JT1A 1TVKB 2AVDA 1B0PA 2EJWA 5B1SA 4F4IA 3DJYA 1VL0A 5JATA 4JU8A 2C84A 3BILA 3LK6A 4FI3F 2GBIA 3DWIA 5KQPA 1SXJB 5FRDA 3VVBA 3LXUX 3F97A 5H70A 2XCTB 1WPRA 4YUZA 4JJKA 2X41A 2YW2A 3JQAB 2MHCA 4GI1A 3SICE 2HJ9A 4QO7A 4EG7A 3FNBA 1U3DA 4KPUB 4X20B 4R1TA 2RJ3A 3JQFA 2ZRGA 3E03A 4KW7A 4BWVA 2AEJA 3QIVA 4JR0A 1XNRB 4F3KA 2EJUA 5K99A 4WXHA 4IRUB 3O47A 4IEEA 4CQMA 4O3MA 5LUAA 4BLUA 4NBNA 3E70C 3SHOA 4PNPA 5KWJA 1K5GA 2RB4A 1QZXA 1F4LA 2B2NA 3F2VA 4RV4A 1ENZA 1PUJA 3AEZA 4P58A 1EFKA 1FFXB 5AVWA 5AOAA 1M2FA 1QM5A 4IFIA 1WULS 3NEAA 4MVXA 4F2DA 2XUDA 4EFKA 1QFJA 4KFTA 4R2JA 1XQ9A 1C4WA 1XELA 3ORRA 1RXYA 3N76A 4DG9A 4QIHA 3THXA 1KZ6A 4ITUA 2VHVA 4CM8B 1QWSA 1L4UA 1R8YA 4M86A 4NICA 1O0BA 3C0KA 1DWQA 4QYSA 3BBLA 4LYHA 4IDCA 3M6FA 2DR2A 4RTPA 1VSUA 2CZQA 5JXGA 1UXOA 2XRYA 2IOHA 3TNFA 4CHTA 2PZMA 4DLXA 1BA2A 2PT6A 2ADMA 3UXYA 3VR5D 1QG2A 2BGTA 5E9WA 1P31A 1NI4A 2O2IA 2QMQA 3QMWA 2QSJA 1TQDA 2ZJ3A 1KI6B 2E48A 1HOTA 2P0EA 3MCAA 2G63A 2VWQA 3RFCA 1L3IA 4CL0A 4A8JB 1JHAA 4QPDA 4Z86A 3TLGA 2WF7A 2A53A 2H1CA 3B1VA 1TYCA 3DCYA 3E61A 5K6AC 1VZ3A 5B30A 3A4IA 3LPLA 4RGYA 3UAXA 5CDFE 2VHQA 4EVQA 1F2TB 3MCWA 1BD3A 3G9XA 4J6FA 2P0YA 1TE2A 2FZCA 3L04A 4WPGA 1RVV1 4XYGA 4DQUA 5CAEA 1TM2A 4P5DA 3VR3D 4DLSA 3PGXA 3GEBA 3I4LA 2W0SA 4HS4A 4L76A 5HQ3A 3W2EA 3IP8A 3NBQA 3RKRA 4B74A 2F9FA 1XDZA 1YCHA 4BLSA 5LZ5A 1ONOA 5BQ3A 1TM5E 3RM3A 2WHPA 3DZ8A 1PJAA 5BN4A 3K15A 2V7TA 4NPHA 3FDIA 1L7RA 4RS4A 5DMHA 3P9RA 1NVDA 3B1WA 3HUEA 1HFEL 1QCCA 3N3BC 1QX3A 3IQWA 2FHSA 4RH1A 4WTOA 2XF2A 1R8JA 1Z5WA 3VYUB 3KOOA 1UBOS 2G71A 3SJUA 2PTHA 2WSLA 3CO5A 3LX5A 3PNSA 4C0LA 1XWWA 4LC1A 4B8YA 1JHDA 4M8SA 4B3MB 1R4ZA 2PD4A 3B5IA 4ACAA 1EX7A 2FSUA 1HPLA 2QF7A 1FUEA 3L6UA 2VH1A 5TRTA 1GGJA 1KA9H 2C5SA 3O8OA 4UKDA 2IKQA 1CLUA 2OGSA 2QTLA 5E9JA 3RRFA 4W8HA 4F06A 3A9RA 2TS1A 3LCRA 4A8HA 4EHBA 1I1OA 4R1PA 2AJTA 1UBNA 4GMGA 1ZXBA 4JBIA 1GPMA 5FTJA 3INRA 1KS9A 3DPUA 4IDOA 5FLYA 2J0SA 4FZ5A 2PMBA 3PYMA 5JRDS 3AVVA 3C1UA 1M0TA 2XIQA 1DIRA 4HZGA 4AAYA 1J0BA 4AF7A 3ND7A 1UK8A 3FIUA 4JLVA 2W6PA 2Q3EA 3F3YA 1PR9A 4N0QA 4DAOA 5CA0F 3BWCA 4K0KB 1T5LA 4UJ3A 3I92A 1QONA 2IYLD 4XLZA 4UEKA 1GFZA 3L6RA 3ACDA 1E9DA 4FGKA 1PGNA 4PX3A 1CR1A 4TQ9A 1QXSA 3ASYA 3CWQA 1A9RA 2AR0A 5ESWA 3ZXIA 3IUBA 1RKQA 2P7HA 3DL2A 4BKOA 2LXNA 2H5EA 2QZSA 1KQFA 2CEAA 3LBYA 2AFRA 3OZIA 4D0LB 2WDZA 4PPFA 2VDNB 2GYVA 1XVLA 1U80A 1ZJ4A 2A2ZA 4KYTA 1JS1X 2OA0A 1P2VA 4B4KA 3GH3A 3D1VA 3GJRA 1CUAA 2OD2A 2DUNA 3FWNA 3KKEA 3M5WA 4ZQHA 1KI2A 3QBJA 3MHTA 1F4PA 1FW8A 4QPZA 3PS9A 3EGVA 3A2NA 4C4AA 4Z9AA 3GPCA 4TV9B 2RETA 1YIOA 5EMJA 4D99A 4GXQA 3KB8A 2WF5A 5T41A 1FXWA 9ABPA 2FZLA 4RHXA 4F5YA 3GOHA 4PYRA 2DPYA 1ILWA 2GWRA 4YP0A 1Q7EA 1NRIA 1USKA 1U9CA 1Q2XA 3ZOKA 4FKBA 1ZMRA 1AKQA 3EIWA 4R8KA 2OPBA 2ISQA 3QVJA 3WGMA 4AJLA 3CE9A 1MC4A 1LGYA 2J3HA 4A1FA 4O4JA 1H6DA 3BD9A 1VPWA 4BNZA 1DWOA 1PZGA 3GN1A 1JJVA 2HBRA 4YREA 1GHTA 1TM4E 3IBCA 5DBEX 4KWTA 5CCEA 4HC4A 1Y7HA 1KAMA 2A9FA 4HAIA 1XA3A 5C4GB 4DBVO 4DEXA 4CVNA 3RUCA 5KOIA 5J4LA 5EJ9A 3FHLA 2PBRA 1Y6JA 2YFKA 4RZ2A 2XNSA 3HXQA 2GFHA 3A1CA 2HDHA 1AQJA 3EWIA 4I5DA 1T9ZA 4MWDA 2R0QC 2PBFA 5ABPA 13PKA 2CYCA 2Y6UA 5ECWA 5FWXA 3TIVA 3LQKA 4GXTA 5IN5A 5ERGB 3VISA 1PV2A 4DBLE 3QWHA 4N3CA 1AUOA 4EG4A 2WTMA 3RABA 1E89A 2GPTA 3UJ6A 3LDFA 3OEYA 1SKMA 1WUKS 2UXDB 1VSQA 2ZSJA 3D6FA 1LS1A 1KSFX 1GDDA 3RS0A 4MRMA 2XAUA 3ZE9A 1SULA 3TZLA 3SQMA 4BGUA 3OAAD 5FHRA 4MDFA 1A2QA 4OI0A 1AS3A 2WVGA 2C83A 1OWLA 2FN9A 1DBWA 5BW6B 1ARZA 1GPLA 4Y2HA 1E4EA 3LHSA 3AF2A 3K0CA 1Q6ZA 2VP0A 5DNUA 4DLVA 4Y1RA 1C1XB 4QDKA 3TW4A 1Q0ZA 3IBFA 4YP6A 3RS3A 2QNRA 1ORIA 2XUJA 4FFBA 3VXKA 4YXFA 1RBMA 3RIGA 2GEJA 4R3WA 4G0YA 3DPIA 4O1IA 4P3KA 5UKDA 1U1DA 3WTBA 3TG2A 3BB4A 1M72A 2WD7A 1NX6A 1VPDA 2R9VA 2YWHA 4PLCA 1JYSA 3FSJX 2JFWA 4L8VA 5E7JA 3ZV6A 2O6LA 1NVAA 3OQ1A 2B5VA 3L4KA 1OGYA 2GW4A 5TS3A 3AQ4A 3IPAA 4CTMA 4NYIR 3WRYA 3IHTA 3TQSA 4J6EA 1OTXA 2YQZA 1EBBA 2C2BA 2FX2A 1XDDA 2GETA 1KI7A 2ZIXA 4UU0A 5AHOA 5EWJA 4ZALA 1R9GA 3K20A 4OO3A 4WXEA 2WJ3A 3K0KA 4ZV9A 4CM3A 3HBFA 4B6SA 4N8DA 5IUJC 2WJYA 1C7RA 1KFCB 1M74A 4MYSA 4MI6A 5G1OA 4P08A 3R9XB 2C9CA 2VQFB 2NXJA 3RVBA 2NXWA 2PFSA 3CMCO 3DZGA 2W4MA 5AP9A 3CPHA 1HGXA 1SOUA 5B1YA 2H85A 3NIFB 4PGMA 4AZ3B 1P9RA 4C0JA 3BE6A 1PZFA 3HN6A 3FNHA 2C61A 3LGSA 2A14A 4U7WA 4EKNB 3UHPA 2KQUA 1NFQA 1UKAA 3QFRA 1D6SA 1H2BA 1Q1AA 4M98A 4EL5A 1N3YA 5JCPA 1GKIA 4AZSA 1ACJA 1ZCAA 1LPSA 2J6BA 3ETNA 4NCJA 2ZJ4A 4XI9A 1WVIA 4QM7A 3CEPB 4N3NA 3GJ8A 3U3XA 2BFCB 3EQ6A 4DV0B 2YN2A 1G7SA 2ZCUA 4CKWB 1KDZA 2F1OA 2X0EA 1Z6PA 1JFFB 1OI7A 2DH6A 1QFXA 3ABSB 4YH1A 1XWFA 1T8PA 4YUXA 3W5JA 2Q3LA 3I6QA 1NY6A 1OIWA 3WHLA 2ADOA 1XLVA 3MD0A 5J63A 4BYGA 4LQDA 2PQ2A 3KDPA 1GLNA 2YWFA 3UW3A 2G1KA 1FQOA 3DOUA 1D6JA 3NYRA 5DTEA 1TVCA 3AL0C 4MQ4A 5AO9A 4EA8A 3LZDA 4RWEA 2OBXA 1E61A 5I7OA 2AZMA 3BFPA 2FQYA 2MINB 1L5QA 2NO7A 3FPJA 1L4YA 1V11A 2RGGA 3BMXA 5FA5A 1JHPA 5B55A 3WHPA 5HJEA 1ZP6A 4HWRA 1IZ8A 1JR6A 3EJ6A 4EK9A 2Q45A 1JSZA 1I3LA 4N65A 2JFZA 3W6ZA 3TLZA 1G5HA 2QTRA 4YCCA 2PGNA 3HEAA 3PHCA 1XFAA 1Z4OA 4D57A 4X5OA 5IEBA 1Y8AA 4M9XA 2VDPB 1DG9A 3EZ7A 4UBKA 5BWNA 2WFAA 4DA4A 5HTOA 1XZNA 5BYAA 3N0WA 1S8NA 3E4CA 1ID1A 1HNXB 1J2EA 3DBVO 4Q66C 3U40A 2VR1A 5I9MA 3NDBB 3MB5A 4P36A 1R16A 1H9AA 4R1OA 2ID7A 4JUFA 4ZJPA 1DINA 4ZZ3A 2V7QA 1X7ZB 4IUBS 1HL7A 1UQRA 2BM9A 2Y4NA 3LSYA 5F1YA 1COWD 5CH5A 4DQ0A 3PFKA 4DGQA 4MW2A 4S24A 3RAPR 4W9RA 1T4BA 1GR1A 4JP8A 5B64A 4BLRA 4D9GA 4TS4A 4YASA 5EZ6B 5KTTA 1Y6GA 1IN7A 2XXJA 3OWHA 1V9CA 3MFYA 4KG7A 4MKRA 3WJ1A 4CM4A 2HADA 2J41A 2FQ1A 5C5DA 5K7SA 3PIDA 4E5NA 4AG5A 1S02A 1N9GA 4MW4A 3PPWA 1YF3A 4ZDKA 4AJEA 4TMXA 4HDCA 1RWPA 3TB6A 4ND2A 2LPMA 3K9CA 1QMPA 3Q9LA 2EW8A 2IDJA 3E7WA 1IYZA 1ZA1A 3LWBA 5EWMA 3VPCA 5IJ9A 3L46A 1YE5A 1E9SA 2AR9A 2J5RA 2L82A 3TI9A 5K0SA 1RBQA 3MUFA 1UADA 1V43A 3U17A 5M29A 3AVTA 4C4SA 3MUEA 1Z0UA 2CE7A 1TMYA 5K1ZA 4FVTA 1OVGA 4IGKA 4KXLA 5LSAA 4QBIA 1LPAB 4RK6A 3WGGA 1B43A 5TF4A 4JGIA 3C14C 1YDFA 1CR4A 3SQXA 1JDTA 4MA5A 2J7PA 3F0TA 3FNIA 3M7IA 1DIGA 4GPZA 1WY5A 4IIVA 4O5AA 2XMQA 4BAGA 4OLBA 1CUGA 3AJAA 3W5VA 1Y6RA 3GZTB 4TLLB 4ZT3A 3SYLA 4B31A 3CONA 2MYUA 1OZ0A 5EI5A 2EWMA 1GARA 5CVVA 3DM5A 1KFBB 2Y1DA 5H3CA 1FYVA 1RLJA 2J6IA 3TW8A 3GT7A 3NKVA 1C7ZA 3L6EA 2MSLA 2WD9A 4LXQA 4WXRA 4Q02A 4FOLA 5CFLA 2ZSIA 5I7WA 3T3NA 4A82A 1WMSA 4HRYA 2BGLA 1RWOA 1G8FA 1KVTA 2Y0DA 4BNFA 3DV0A 4J75A 3KBBA 1C9JA 2J09A 2OCGA 4BLTA 1FVFA 2XQJA 3JPWA 5CD1A 4A9AA 5BN3B 3ORQA 4I6JA 2IS2A 1X2EA 1P1KA 3A14A 4NARA 5AJYA 2VLIA 1NP7A 1ZMTA 1XMSA 1W44A 1J0CA 3DVAB 4L02A 2ZVJA 4D9IA 1NNEA 1Y98A 4O4JF 1T6NA 1S3GA 4RTOA 1J90A 2EZ4A 3ZHOA 1P5HA 3I2FA 3GDFA 3U7GA 2O5CA 3LWNA 2FRDC 1VHWA 4IYRA 2W6JD 4O2BF 3BF7A 4L27A 1N2CE 4YRDA 5CT5A 5JTUA 1U3GA 1W47A 4X1IB 4CIDA 3TX6A 1MJ5A 2B6HA 1IXRC 2LDBA 2CUTA 1T13A 3D6NB 1S96A 3UJAA 1UAYA 3Q87B 5JNSA 1TK9A 4BQRA 1KFJB 2ORED 1RQPA 2IEDA 3G23A 4ML3A 4RQAA 3TIFA 2EHJA 4G0QA 5BP7A 3KAKA 4YP1A 1WCYA 2Z1NA 1AE1A 1HDZA 1RFGE 1XXHA 4JBHA 2WY2D 1K8YB 4XJTA 5TQ2A 1E3JA 3VU3A 1Q0SA 3IAM1 3WL6A 1RWQA 2VJQA 2NU6A 3WP0A 3L84A 4EYSA 1ZRNA 4YCBA 3H5IA 4MS4A 2B7LA 4HDAA 3PXUA 4JLBA 4F4HA 1FMTA 2B5OA 4QSMA 1KEEA 4OXQA 1KJNA 2L0XA 4MUAA 1UKVY 4WESA 1A95A 2C92A 3ST7A 4C6HA 3ZXSA 3LT0A 3DR5A 2DPMA 2NO0A 3OPXA 1N5JA 5DYGA 3JPYA 3PUZA 4OJYA 1BMDA 1PO7A 2ALJA 1NSFA 2GN2A 4I46A 4Q7KA 4FONA 1GAWA 1A9ZA 2IYTA 2GYWA 1T5SA 1UR5A 4X41A 3OF2A 2X7XA 1DX9A 4M89A 3LY8A 3EB9A 1ENYA 3T61A 3UMCA 2EFDB 5K01A 1YUNA 1KRWA 1QORA 4OJQA 1V3TA 2PY6A 3G13A 3G5TA 4IXNA 1YBVA 2O8DB 1UBHS 4ZPXA 1T91A 1TU4A 3A6EA 3I5UA 4PAOA 1X1AA 2NW6A 5AHWA 3RE1A 3A3PA 2Z3VA 3FUTA 4PE5B 5CT8A 3BXZA 1WV0A 1XHFA 3UYLA 1YS7A 5C2JB 1VXOA 2PVSA 3E84A 1VMKA 4H7IA 3EMBA 3LJKA 4MAMA 2XRFA 2HQ1A 3P45A 1ZH2A 1UC9A 2XVAA 1QIMA 2YBDA 5F2EA 3WLQA 3W2FA 3WSTA 4D56A 3AP3A 4F12A 4Z4HA 1GPWB 1YK1A 2HZBA 1OFVA 4AWXA 3WXBA 2BBOA 4Q9DA 3P1JA 3ICQB 1DRKA 4MYUA 4E5VA 4YV7A 5KOHA 1Q7CA 2HXSA 4K5QA 4AMVA 1L6RA 2IBMA 3ZTTA 2FPIA 1V41E 1A8IA 1SAYA 3GGSA 5EP3A 4WV3A 1L7XA 4UU8A 3DDSA 5IJWA 4IYJA 4TZTA 5KAMA 3W79A 1O9GA 3IYLW 1U7UA 2QT0A 3PX2A 2A86A 1MB0A 3B6IA 2IYNA 2AMVA 1Y34E 4JBLA 3OJLA 5F21A 3PUXA 1OJLA 4ZYVA 1PR2A 2FEWB 1F0PA 2I4OA 2WNIA 2FJ0A 4PZ9A 1VPLA 4KC0A 4DHWA 3WRXA 3DVSX 4MH0R 4YUWA 3M6AA 5ESXA 3U26A 2I34A 1KYIA 4UHJA 4LY6A 4EX7A 2KWIA 5K20A 4D9NA 3E8XA 1ORVA 4A0RA 1JZQA 4ENRA 3FFBA 3VR4H 3AY6A 2HOQA 1R0ZA 5AVJA 3WGKA 4HYTA 1NVUQ 2PK3A 1YRHA 3DO6A 2B8WA 3PA6A 1M2VB 4BMDA 3MBIA 4G2NA 1WVMA 3E8SA 4JA0A 4OUDA 3FGOA 1ZRSA 1PHRA 4RMIA 2BGRA 3AZOA 3EA0A 3WNDA 1UPXA 1XQXA 3ZU4A 1HF3A 2DLNA 4OAOA 1VLZA 2Q2WA 2J87A 2RAUA 3KM0A 3LBFA 1RS0A 4M49A 3IFSA 1HURA 4R0VA 5ALTA 2GARA 2ZSUA 3NPMA 3HXOA 2LD4A 4E5YA 4XVCA 2GCPA 1YVUA 4RM3A 3BE8A 2OGZA 1TT5B 3K2BA 3W05A 1EEXB 2ZITA 4DQLA 2Q5OA 3RVMA 1KWKA 4YBZA 1CKEA 2BJVA 3JYQA 4KZKA 5JQGA 1OI2A 4D6PA 5BSWA 4DR2B 3WYGA 1WWKA 2DPGA 5K03A 5L3ZA 3HM9A 5KTYA 4CMHA 1P1HA 5LZ4A 1BXZA 3CVWA 2ASEA 3P96A 4MCAA 5CFMA 1RNLA 3QLUC 1JT2A 5B7PA 2QPOA 4ZD6A 3DTTA 5FFFA 2QW1A 1ZN8A 2HA5A 3EZGA 3G49A 3IBSA 5FNVB 3C5EA 6PFKA 1RWBA 3ORYA 1IOVA 1L5KA 4CDNA 3IR7A 2SICE 3PWSA 2ZANA 4B6PA 4MQUA 1EG2A 4CF7A 3FF1A 1C1YA 4Z2AA 1LD3A 3TK1A 3T9AA 3AUXA 2ZEJA 4GFDA 4OYHA 1BDMA 4GZ5A 2W43A 2XUQA 5I8PA 2JASA 9ATCA 1MQ8B 3K31A 3EPKA 4NULA 1TM3E 1ISIA 3ORFA 4G0VA 4PYIA 1JNYA 1PE0A 4YRFA 3FTNA 1BXGA 3TTSA 4AJNA 3MMNA 1T0JB 1NC1A 2V58A 3QK7A 1JEEA 3O83A 2AJDA 3F3KA 4G8DA 3IOCA 3MUNA 4BWYA 4Q3OA 4RKEA 3UWOA 1EVYA 4Z8XA 5JHHB 4DT1B 1OH6A 1USGA 5IJXA 4BO9A 3AB7A 3UJCA 3KXKA 3HRIA 3VR2D 2OP0A 1MA0A 4LE1A 4NAHA 1R0BA 3LVFO 2V54A 4Q39A 1XDGA 2ZRKA 3ASVA 4BE4A 2QGFA 3IQFA 3FHOA 3CVJA 4DLPA 3I62A 1EQAA 1M10A 1X13A 2D1YA 4H6WA 1LQTA 2C5GA 3PHLA 4EHAA 4EJ6A 3OC0A 1DQPA 3DMFA 5FQOA 4ZPJA 4GSLA 1N3IA 3OZTA 3TGLA 1RI3A 1WZIA 3RIHA 5I7VA 3AHHA 5DSXA 2BCEA 2Z2ZA 2KBEA 4HUTA 5L3SA 2J85A 4MPRA 4RPKA 5I8ZA 3RYCB 3F5FA 4RZIA 4NDNE 2O59A 2JLYA 2GKSA 1K8RA 2A0FA 4H0NA 1L4NA 3SOZA 1T9AA 3I8OA 5DT9A 2A5JA 3OO1A 5HQJA 4CMBA 2BH9A 2E87A 1KSHA 1PT9A 2ZWAA 4FFOA 4P0TA 5EIXA 3EMOA 4N6NA 3ELUA 4OSEA 1RM5A 1VIAA 2Z9BA 1IQPA 1R0RE 4FGSA 4P31A 2Q4BA 3KXLA 1VSTA 2AG1A 3K6RA 2ET6A 3LUFA 3CUYA 4M7OA 4MRSA 3URMA 3A7EA 3KEGA 5CEEA 2EDCA 1GVNB 4RKYA 2CNWD 3NJ8A 4BVJA 3FM9A 3TSYA 5KJ1A 4G8CA 5GQSA 1AY0A 3ROGA 1ZK1A 1KAQA 1RP7A 4KYUA 2BSQA 1NN5A 2BFMA 2P11A 1JEYB 5GM2A 4J1NA 4LZPA 1XQYA 2QDKA 1H2HA 2FCRA 3WBJA 3QUQA 2WIDA 1BCSA 2FFQA 2JGFA 2XE6A 4M9RA 5AVOA 3HNRA 1WDWB 4BP8A 3AHFA 5HRAA 2BGNA 2FP4A 3RVOA 2X15A 4H3KB 4L4SA 1SU7A 2PEZA 4J1TC 3SEQA 2XYVA 5KINB 5A3QA 5KYXB 4KITB 5K6AA 4YY3B 2P4HX 1LNQA 5A3RA 4ZTBA 3N58A 3U0BA 3PCRB 3QKSA 3ROPA 4IHJA 2E18A 2O48X 2AI3A 4Q93A 4QNMA 3W5SA 3IUYA 5JHGB 4K03A 4L4XA 1JGTA 2DT5A 4GXNA 4PPNA 1NFFA 4P1ZA 2Q6TA 1VKNA 5F33A 3HUDA 4NZOA 2JFQA 3HFJA 3X2FA 1DC8A 4DHEA 3V97A 2P67A 1YFJA 2P9BA 1EEHA 3H8WA 2VXYA 2ZYDA 3OZVA 5K8JB 1SB8A 2AC7A 4I50B 2V7GA 2QD4A 1L6IA 2BMVA 4HF7A 2J4FA 3DC2A 2GR9A 1T9KA 3K1YA 4KCGA 3UCFA 3VZSA 4D8XA 2DWQA 4B0PA 2Q62A 4NBVA 4JLNA 4ICIA 1MA3A 3ANYB 2N9UA 3DE3X 3HGTA 1NW8A 3R8FA 4D41A 5ICCA 4KMMA 2IGBA 4WK6A 4C89A 3EZYA 3O4GA 4JXKA 2ODQA 1S7GA 2KE5A 3HUUA 2JJYA 4XVQA 4GQBA 4E94A 5KTNA 2QE6A 2V98A 3IPXA 4ZU6X 4MLCA 2B78A 4CQJA 1GQOA 3PHHA 2X0FA 3W5IA 2V0CA 4DMMA 5EEGA 1PEDA 3BHMA 3KAQA 3PSHA 4PBTA 1I51A 2AYZA 3D81A 3UV7A 2CKMA 3DZHA 3JD4A 4PNZA 3T54A 4E4RA 4ZHSA 1UC5B 5C31A 2PAFA 1CQXA 4A03A 1FQWA 3RU9A 5A4MS 1B15A 1EG7A 3REGA 3F7NA 1THZA 1IONA 3LQQA 1TKAA 2VS1A 3U3MA 4GMHA 1CPYA 4JJ6A 1ZBQA 1VHLA 2YZMA 1VE1A 2WYUA 4XDHA 5EQFA 3TEFA 1Q0PA 5IXSA 2NSHA 4QO8A 3EQ8A 1NWCA 1QDEA 1TZJA 1KVSA 1C14A 2OQVA 3KB1A 3OE7A 2H11A 1PTJC 4YRPA 5BR8B 3ADKA 5DU2A 5JI3E 2HK8A 5FL3A 3GPDG 2AJBA 1P5FA 1XQVA 3SZGA 4MR9A 2PR7A 4YA6A 2ON6A 1N6NA 2FEMA 3JVVA 4V3CA 5EIOA 4JKOA 4O5OA 3C3WA 3R76A 3VR4D 1RFLA 3B53X 4CUKA 1IN8A 3TGPA 4MVYA 1B26A 1IXKA 1DB3A 4OXRA 4TLBA 1W59A 4B3HA 4ARIA 4ZI2A 3B9RA 2IXEA 5CXQA 5ECDA 1J1UA 3LLCA 4ER7A 2PXCA 2CLFB 4D9BA 3BH6A 2R62A 2DUUA 1OX4B 1PFKA 2WHQA 4HMPA 4U02A 1YRQA 2GNPA 3GP8A 3HNOA 3EYWA 4YT5A 5KCMA 1XZPA 3ZH2A 3S3TA 3SBXA 3UJ3X 1FMLA 3A04A 3MUOA 3OJXA 1K3TA 4AK9A 3ROQA 4C7KA 4AKEA 1IRXA 2O2SA 3UJNA 2WJWA 4XGQA 1QZUA 1MTOA 3IDQA 4KL8S 3HYTA 4OBWA 4L22A 4MHOA 4O8ZA 2R85A 1M2OB 2Q07A 2M6KA 3RJZA 1JUDA 3BDAA 1DHTA 1YRLA 3L9WA 2HDNB 1TC2A 1XRMA 3MWEA 3ZI4A 5BRJA 1AXRA 1R6AA 2HX1A 3PGJA 2GCOB 3FPFA 1K4KA 4L4ZA 4Y2UA 5BWOA 1PGJA 3K5PA 3RBVA 2QTGA 4MMZB 2WWRA 4XVUA 2C9MA 2DECA 4AKTA 2NO1A 4B8ZA 4HFRA 3W3AH 1N6IA 1ZM3A 3D8RA 1RLMA 4UPDA 2C0QA 2VPPA 2XKBA 1QG4A 3I32A 1WQ4A 4ND1A 2NUTA 5EE3A 1DAMA 3IMGA 3D6UA 2ZRDA 3HVJA 4UHDA 2GD6A 3V1MA 4EI9A 1XTSA 5K05A 5KC9A 1F9AA 1ZHFA 2VPQA 1XTJA 2PUJA 2Q3JA 3B2NA 4UBOA 3WGOA 3CLSC 1ZESA 2XTAA 1KE2A 3ETGA 4FT2A 4WLUA 1UBKS 4N3GA 4DCOA 1R0SA 2O19A 1SU6A 5IC6A 1J5PA 3ZXUB 5JG7A 3QXJA 4ZVTA 3RV3A 3UH1A 2VDVE 5DWQA 3BGSA 3ED5A 4M0UA 1K6XA 1IL0A 3OM1A 5FTWA 3VR6D 1I80A 4F4CA 3AFMA 4H7FA 1H1TA 4DDVA 3T7AA 2HHHB 1D5WA 3ETJA 2WUDA 3PQ3A 2IEBA 5EXPA 4WUTA 4BFCA 2AN5A 4CMIA 5JD6A 4KLZA 4JC8A 1RJEA 3TD2A 1KPGA 4WFQA 4XQCA 1L5MA 2XVMA 1YNSA 2H9IA 3FPLA 3O8QB 3Q3IA 4BWGA 1EUYA 1L1RA 3KBOA 4LV6A 3FSGA 3CUKA 3CIOA 2ZYIA 1ZCFA 2ZYUX 3HO8A 4FCTA 4ZCIA 3WIDA 2PGOA 2V59A 3FYTA 4BGDA 1I3OA 4OJNA 3ZWNA 2V65A 1IVYA 2F3QA 4B71A 3Q88A 3TD6A 3M0EA 2PTGA 2W6QA 3DP9A 3OC6A 2E0IA 3NHSA 2JBWA 1ZOOA 1G1AA 1R9MA 1LBSA 2CF6A 3I6MA 2QN8A 3QEMA 1ZC4A 2VDWA 4RO0A 8ADHA 1FS6A 3I8XA 4KUEA 2MDTA 3LBIA 1GSHA 4BBPA 2QVLA 1ICEA 3KYBA 5CLFA 4Y9SA 4QUHA 3UBTA 1T24A 4GUAA 1II0A 2CMGA 2X40A 2YWCA 1T0UA 1YUBA 2HMVA 3SHTA 4NYJQ 1A2OA 3S6JA 3EODA 1U0SY 4WE3A 1L5FA 4KJZA 3N8NA 1ECGA 5JNRA 2QW0X 2O2JA 3QMMA 3KUKA 3P2IA 1J8QA 1YB2A 2CHGA 1DU4A 5EMLA 2CVHA 1XOIA 1EBFA 2G1UA 4KWCA 4XJSA 3CG4A 4IVQA 4MARA 5ALKA 2ZTMA 3QVWA 4FHZA 3S5UA 4BMSA 3L82B 3O6VA 4ZV7A 4IXMA 4ZCSA 5KDLA 1TNDA 2H2WA 3MINA 3UCEA 2VNSA 2ECKA 2V7BA 3DULA 1JAZA 1X9IA 3EGDB 3EUEA 1KY3A 4L0CA 5HDBB 4QBFA 1JDSA 3L0SA 1NJ1A 3OX4A 5T6MA 4TSKA 3LPAA 4RABA 3EXIA 1RR6A 1P29A 3OZBA 1QC5A 5IT4A 1A1VA 1UEIA 1W0KD 4UE2A 4K8RB 5IBCA 5TQVA 2G8LA 2NAFA 4FWIB 5KOJA 4Y2TA 3E9NA 2JLSA 4OMUA 3N70A 1RHUA 3MJFA 4NOKA 1JW9B 3WLEA 5AVRA 1NIPA 1P2DA 1QQ5A 1I1NA 1RI4A 3G0OA 4PZEA 1WLSA 1N3LA 3MBKA 2JIRA 4R9RA 2XB6A 1HG0A 2CLSA 1DSSG 2PZAA 3IAAA 1PYGA 4KBFA 5ICSA 1EE9A 1JPVA 3DAHA 4TKZA 5JXIA 1A9OA 3C4JA 1Y5LA 3SHQA 2NIPA 4AW9A 4F21A 2XE8A 3AX6A 4ZICA 4NCXA 1QBKC 1R4MA 2XR1A 4IKOA 4EAAA 4JLSA 4PIMA 2F8TA 1DQRA 1S2GA 2OV1A 2XBUA 1PYDA 4UULA 3CXUA 1OGIA 4H7DA 2CNOA 1G2IA 4LCBA 1GXSB 1MIOA 1UBEA 2CNKA 3IAS6 4E03A 3WLLA 2QA5A 1UFOA 1QYCA 2O0HA 1W1UA 3H1TA 1M2HA 5DGTA 5G1PA 1NBEA 4C7VA 2HPAA 4IHJF 1UZAA 5JI2E 3ID6C 2FW0A 3NORA 4KAAA 4LZLA 4ZVOA 3LQ4A 5L40A 4Z0NA 5LXTA 2WVJA 4D4HA 3U81A 2M98A 4N5DA 1FFHA 3ZGLA 5DCUA 3KDAA 4EY5A 5HMMA 4DADA 2XNKA 2I62A 1QLHA 1GGVA 1RT9A 3D02A 4AC9A 4LNUB 3QOFA 4U1RA 5DISB 3GJ5A 4RFVA 4DG5A 4KO8A 1TAUA 1YFKA 4R54A 1J2JA 3FE2A 3D6JA 4L6CA 4GYWA 4XIIA 1E2KA 1ZJZA 3ZNPA 2AOTB 1GTL1 3OM9A 4Q7QA 3IVCA 4XWTA 4GEGA 4OL9A 1V96A 1SD1A 2X8LA 4GR5A 3LUDA 2WPDD 3WO0A 2GYUA 1M5UA 4ZK2A 2O5RA 1BMFD 2DT8A 2FYTA 1JHQA 5EYPA 1XCPA 4AJJA 4B79A 4ZI7F 4ARCA 1RPTA 1P33A 4HQNA 1YZUA 2G1PA 1RJFA 1G60A 3EZNA 1JALA 2C4UA 2BELA 2AXPA 1IK4A 4PIPA 1JG3A 5AI0A 5DO9A 1X74A 1NT2A 4EPTA 2JHGA 4DSOA 3BXFA 2F6RA 2YMPA 5IKPA 4TQAA 2BLLA 1T2EA 4Q3LA 4M0CA 3C6XA 2D1TA 3RSHA 3T8YA 3JD3A 4F93B 4F04A 3UGQA 4LJ7A 2C03A 5EPOA 5DI9A 1CS0B 3E5HA 5DVZA 3TTYA 1T0HB 4MUIA 5EIEA 4P3NA 5JS1A 3U4GA 1ESNA 5KNCA 4Q4CA 3EF0A 1ESCA 2ZZNA 1JF8A 1N2JA 3PDIB 3KLNA 4BQQA 3LQ1A 2J8ZA 3T99A 4NP6A 3W5AA 3NU1A 3NRBA 3PX7A 3WYBA 1C2TA 2GVZC 3PB3A 3DUFA 1WM1A 1N8TA 1ECCA 2AL7A 4MQLA 4R98A 4PW0A 2OYRA 4Z54A 2VRWA 5K3SA 4AURA 1WKCA 1Z2OX 1JRLA 2Y27A 1U63A 3HS3A 4FGWA 4JLDA 1PZXA 2DWUA 3HMKA 4LC0A 3BJEA 1HL3A 1SOWA 3H04A 3PL1A 3GFBA 1EXMA 4RAQA 3URKA 3DG9A 5EP4A 2OD7A 1MG5A 4B3FX 2VYNA 4EKDA 1P1IA 1PJSA 3DKPA 4GM4A 2WYIA 3JALB 3L7NA 4FJ1A 3JWGA 3IEKA 3W3AD 4OU5A 2YWJA 2R6JA 4FZJA 2ATVA 4L7QA 5HGXA 1M7HA 3OUTA 4X95A 1GCGA 3O82A 1W35A 4XJXA 1I2DA 4LHXA 3VR1A 2C00A 1MO5A 3GRVA 3IDOA 3LY7A 1YFZA 1U7ZA 4IXWA 3TBHA 2PGJA 1FNNA 4LTMA 2JPDA 1A5BB 1KJZA 3RO7A 5E2AA 1T1RA 2QP3A 2X0NA 4TS9A 3TI7A 4EGJA 1SQGA 1AH2A 4O29A 2FUNB 3MMZA 3VQTA 2O1XA 3QW4B 5NULA 2XYHA 1JLLA 1SG0A 2E6UX 1SRQA 2GGSA 3GFOA 4URFA 3SQLA 1PP4A 3MTEA 7MDHA 2V9CA 3OG9A 3UGJA 2OHVA 4UM8B 5DI3A 1P4AA 3I6ZA 2Z2IA 5ELMA 5SZKB 4CQMD 2F3SA 2XNDD 3R7WB 2J0QA 1DADA 2UYGA 3BSYA 3GIWA 5CXUA 1NF2A 5E6SA 1A9SA 2X9NA 3NHZA 4LHVA 3AP2A 1GTVA 4RA9A 1O57A 2AEEA 1J1IA 1Q0RA 2FQWA 1EVEA 3AF1A 4PYNA 4QT4A 5LDDC 2D6FA 1A8UA 1SR8A 4ISBA 2UYQA 8LDHA 3DP7A 4RD6A 5BY2A 2ZJAA 3Q0TA 1TECE 1E1CB 4BMYA 3WQRA 2P2DA 4DY4A 2YOGA 5HP4A 4CXMA 2XZTA 3MGGA 5K4GA 3OTGA 1BC5A 5DSZA 2VNKA 3I04A 1EJ2A 1JG6A 1Y6QA 2EARA 3WYDA 3O4VA 1NZJA 1NOJA 4L6IA 4N7MA 4OB8A 4ENWA 5HPYB 2VAVA 1NJ2A 3C6YA 1L5SA 3MPOA 2H2HA 3WLHA 2F3TA 2OQ2A 2Z6QA 4CCYB 1SKBA 2C54A 2H4HA 1KVUA 2J9XB 3I52A 2W71A 4IMIB 2PKCA 1LQUA 5K0EA 1NU6A 2PR2A 4BMOB 3OESA 2ZR9A 3F96A 2C9BA 2R8BA 3UAWA 1P7ZA 4HFJA 4TM8A 3DKKA 1HEIA 1XP8A 5HBGA 1ORDA 1P19A 1U0JA 1V7PC 3HA3A 3A6FA 3KTAB 3OKAA 1BKYA 1T4CB 2G9VA 3H4IA 4P86A 4Y18A 1QQBA 3BG5A 1KL7A 1IM2A 1A2KC 1GU1A 4E1BA 2OUKA 4LDPA 2K2QB 3K1JA 3ETDA 4RD3A 1FW6A 3UOAB 1Z6XA 2XKJE 2WJZB 2YIMA 4V02A 1F7VA 1ULAA 3C8UA 2IUFA 1Q3HA 2GJ9A 1COZA 1W75A 3KT0A 4IJUA 2GN1A 2C3PA 1Q7TA 2ZETA 3T6KA 4N41A 2HRQA 1YMUA 3REQA 1NVVQ 5B3LA 1OY1A 2WKPA 1TLTA 4NJMB 4EY4A 2B1QA 2P3OA 4WIAA 2FP3A 3DT9A 2OXTA 3GNSA 4DG8A 2L17A 3N2GA 3V9AA 3WC4A 1K5PA 2IYRA 2P9CA 2ZUWA 3PI6A 4M87A 2O2ZA 4YJ3F 3JYHA 5ILOA 3RADC 2H00A 2IIPA 3B1JA 4BB6A 2H4YA 1MTZA 2WF9A 5LOVA 4C2UA 3RYIB 4D8TA 1SU4A 3SX0A 4IJWA 2JW5A 5AI6A 4NCAA 1GWNA 3AIOA 5EPEA 4FQ7A 1SIUA 5G53C 3FSRA 4XIYA 4P4TA 4XRGA 1NSTA 2MJLA 4UAGA 1ILEA 5EIBD 3Q5GA 2BZSA 2PLFA 4ZMBA 1T4DA 2L2QA 2O1SA 4Z5XA 5DWDA 2CK3A 6NULA 2HDOA 5J59A 3CH4B 1NURA 3R7BA 4XDZA 3BMQB 4NBUA 1NNSA 1BRTA 1O5IA 3CSUA 3HBJA 1AQYA 4CF6A 1M34A 1QAQA 3BK2A 3AFOA 3C45A 4OVKA 1H8HA 3MJHA 1A04A 1BCRB 3G89A 1DIHA 4RF2A 3L4SO 1U8ZA 3B85A 2POCA 4LOIA 4DQKA 1A2BA 3JD1A 2AIRA 2Y6VA 4EKIA 4ZEOA 2GKOA 1GLGA 2C82A 4G4GA 4NJEB 4OD0A 3CG0A 3WLMA 4I4LA 1LB1B 4I6GA 4IMPA 3WLNA 1XZEA 2RH5A 5CVJA 1Y3CE 4L16A 4TWRA 1OLUA 1W49A 2YOFA 3PDUA 3OLZA 1KEWA 1XEWY 3TCKA 4C21A 3EMVA 1DAGA 2JD1A 5IM5A 2ZW9A 4CKBB 2WU3A 3KLOA 2BY4A 3IQDB 3AU9A 4KOEC 5LL6P 2ZIFA 3H5TA 2SKEA 4NK4A 2O8EB 5K8CA 3IPYA 3OEHA 5BWMA 4LJ4A 4RD4A 1JQEA 4QVIA 1TJYA 3ZLVA 1W0JA 3HUTA 4TV8A 2AW5A 4QYIB 5CD9A 2G72A 5LXTF 3TPCA 4G0MA 4CGZA 3CTMA 4EG6A 1RYNA 3UHJA 1GJRA 1GN9A 4ZVMA 3AUTA 1VCHA 2DCMA 5K3CA 1V9LA 1M5RA 4A92A 3TRDA 4PLYA 1ZO8A 3FB1A 5CIQA 4P0QB 2G40A 5FXMA 4QTTB 2XIJA 3M2TA 3TQHA 2C5FA 3WIVA 2IZZA 4V1CI 1UP4A 1EVKA 3QWFA 4BMXA 5L6L