3IMCA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.6 ang resolution in complex with fragment compound 5-methoxyindole, sulfate and glycerol
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
287
Chain Sequence
b'PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 92
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3imcA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3imcA01
3D6VA 3FDXA 3G59A 2A1UA 4WSOA 2CV0A 4MUKA 4KR6A 1TEZA 1KORA 1BS2A 3RJZA 2CFOA 3X1KA 1ZJWA 3RK1A 1IQUA 3FOCA 2WQ6A 1NURA 3FETA 1LI5A 1QJCA 1Q15A 2QJOA 2CV2A 1MC1A 5J5AA 1O97C 4EG6A 1N2EA 3ISJA 4EFKA 2VTBB 2E89A 1GLNA 3TQIA 4DDKA 1WZ2A 2GKSA 2J08A 4HK4A 2A86A 3SP1A 3L93A 4S1OA 3IUEA 4MW2A 1XNGA 2JA2A 2CSXA 3CLRD 1J1ZA 4XFDA 3UC5A 4MVWA 1IHOA 4MW7A 2JAXA 4MWEA 2HMAA 1TYBE 2QUIA 3DPIA 5KHAA 1IQRA 3IH5A 1EE1A 1MRZA 3CLTD 3ND7A 5IHXA 4AQ7A 4UZEA 1U7XA 2PZAA 1N78A 3FH0A 1XNJA 1U3CA 4RUKA 4XFJA 2AZXA 4ZCQA 1M8JA 1DNPA 1ZH6A 4Q93A 3P0IA 1FFYA 2AKEA 2V0CA 3Q4GA 1Q11A 3ZJVA 1JZSA 5J59A 3ZIUA 4K0RA 3D6UA 1PG2A 1N1DA 3NV7A 4ARIA 1JMVA 5HUJA 1VBMA 1O96A 4PY2A 3CVVA 3AKZA 2PZ8A 2E21A 1F4LA 4MW6A 3MUEA 2XRYA 4BWVA 3PNBA 1T6ZA 1NP7A 1OWLA 4NAUA 1O0CA 1M8PA 5TGTA 1M8KA 2D13A 4R0NA 3DO8A 4MUIA 3P0JA 1M8FA 1JHDA 1ZUNA 1V47A 4ZT4A 1K92A 3TQOA 1MBZA 2CUZA 2IP1A 1YUNA 2X1MA 1KP3A 2E18A 3I05A 4MUEA 3VRHA 3PNVA 4DDMA 3BL5A 2RE8A 3M5WA 4AS1A 1VBNA 2B7LA 2A4MA 3AG5A 2IJGX 4ARCA 1WJGA 1RQGA 4A91A 1N2JA 4HJRA 1OWOA 1J09A 1TYDE 1QQTA 3KT0A 3AFHA 4PBRA 3CLSC 3HZRA 1J70A 2QUKA 2PXHA 5DASA 5KCMA 1NI5A 1WXFA 1M8GA 1O95D 2DUMA 3FNRA 4KPUA 4MWBA 4U7JA 3INNA 2X3FA 2D5BA 2WSIA 4NATA 4GRIA 1FYDA 1WXIA 1R6UA 5LLTA 2BTEA 2A1TS 1VL2A 4TS1A 4KKVA 1QRSA 1JZQA 3SYTA 1WQ3A 4ZT7A 4JYZA 3CVUA 3KFLA 2O5RA 1T9GR 1U0BB 3GUZA 5DEOA 1COZA 2ZUEA 1S4MA 4GU5A 5FNZA 3CLUC 3HFJA 4YP5A 2D54A 3HV0A 4L2IA 4OUDB 2CYAA 4KR7A 1WXEA 2BYTA 1M83A 2AG6A 4MWDA 5FO1A 2PFSA 4JXXA 4MUNA 2OQ2A 1P7PA 4MULA 3N8HA 3CLUD 1T6YA 4RPIA 2GOYA 1F7VA 1IQ0A 3ZGZA 4EG3A 1R6TA 3COVA 1YI8A 4JZYA 3SEZA 2ZUFA 3P52A 4ND6A 1JGTA 2XRZA 4F4HA 1X8XA 2E0IA 3GLVA 3HMQA 5H7XA 4G5FA 3N9IA 1O97D 4J75A 1KAMA 3IMEA 5AHWA 2G36A 4G5YA 4EG4A 3QTBA 1IVSA 1KH3A 1GTRA 4ZT3A 1I6KA 3FWKA 3ND6A 4CDNA 2R5WA 4MVCA 3A04A 1U3DA 5TS2A 4FZJA 3K9WA 3OTWA 1TYCA 1Y42X 3H99A 2Z09A 2DLCX 5LM3A 2A7XA 1JIIA 5BNZA 1LW7A 1LI7A 1MAWA 2DPLA 1NUSA 3MMXA 1I6LA 1OBCA 1D2RA 3UY4A 1Q19A 3IVCA 3Q10A 2DEUA 3AIIA 2V0GA 1WQ4A 5DB4A 3IOCA 2QJTA 2J07A 2WB2A 3KT3A 2Z08A 4ZCSA 3FI0A 1O96B 3A2KA 1N75A 3ILVA 4R2MA 1N2HA 1PG0A 2PZBA 1GTSA 1K97A 1MJHA 1GAXA 1KQOA 3COYA 2J09A 4MQ6A 4YP6A 1WOYA 4NAHA 1IFXA 4E1AA 1EFPB 3IOBA 4QBTA 2CV1A 1SURA 3VGJA 1X6VA 2PIDA 1ZH0A 5K0TA 1QU2A 4JXZA 3TNJA 4YBRA 2H2AA 3UK2A 5KWVA 2J5BA 3SEQA 1CT9A 5F23A 1G8GA 3ZUGA 1NUQA 2WQ7A 4I6GA 1O94C 3CR8A 1GPMA 4CDMA 2ZP1A 2YWBA 3VU8A 5IJXA 2H29A 1H3FA 4KPUB 1MB9A 4MUFA 1KQPA 1NYLA 3FG9A 1H3NA 3CLSD 1J21A 4Q16A 4ZCRA 2RD2A 3RHSA 2QTRA 5LFAA 2A1TR 1J20A 5JBNA 1V8FA 3OP1A 4MUGA 5EKDA 3FIUA 4ZT5A 3H05A 1QU3A 4MW4A 4UZFA 3TZLA 4F3RA 4X0EA 1H3EA 1KH1A 1HYBA 4YMIA 1PFWA 1NUUA 2I1LA 3MXTA 1WKBA 3RFFA 5J58A 1EFVB 2YWCA 3ZJTA 3RK0A 3UMVA 3KT6A 4DNXA 4EG1A 1PFYA 3X1JA 4L2IB 4NDAA 4MW5A 1N3LA 3H9BA 1G8HA 1GZUA 3IODA 2TS1A 1MB2A 3FHJA 4G6ZA 4MW9A 4MW0A 4ZT6A 1EUYA 1TYAE 2A1UB 1TQ8A 4H3SA 2QTNA 2X1LA 1JEEA 1ULHA 2QUHA 4ZCPA 3QTTA 5HG0A 1T6XA 1JILA 2GM3A 4YP7A 2CT8A 3IOEA 3MLAA 3ZJUA 4MVXA 1VBKA 3IMGA 4QREA 3JXEA 3LCJA 2HZ7A 2YY5A 3K32A 3SDBA 2EJCA 2CYBA 4MW1A 4EG8A 4EGAA 3E27A 4QRDA 1JIJA 4MVYA 1O0BA 2PG3A 2O8VA 4WNYA 4ZCTA 3Q12A 5HUHA 3COWA 2DETA 4JFAA 3IDFA 1K4MA 1IH8A 3PRHA 1N2BA 3A4IA 2A84A 3PNYA 2YXNA 5FO0A 1JEDA 2VTBA 3DV2A 3CLRC 1F7UA 4HJXA 2JANA 1U7DA 3RBAA 2NSYA 1JECA 1KAQA 1K4KA 1O6BA 1G59A 4R2LA 1F9AA 4MAFA 3X1MA 2VXOA 3MLBA 1QRTA 3CLTC 4DE5A 3P0HA 3A05A 1OBHA 1XJQA 2QTMA 3GMIA 1KQNA 4CT0A 3QE4A 1UFVA 1H1TA 3CVYA 1B6TA 4MUHA 1G8FA 3SZ3A 3UOWA 3N05A 1JIKA 4ND7A 3NBAA 1J1UA 4EF6A 3ZXSA 1KP2A 2A88A 2X0KA 3COZA 1EXDA 3AG6A 1NUPA 1O5TA 5DK4A 3G6KA 1QNFA 3C8ZA 3LE8A 3S3TA 2DERA 5TEVA 4MUJA 4DJAA 1YIAA 2CYCA 2HGZA 1QTQA 1OD6A 2J4DA 4NZPA 4U8HA 1YUMA 1M1ZA 3CVWA 1YIDA 4I6EA 4XSVA 1OWPA 5H16A 4P2BA 3ND5A 1I2DA 1MAUA 3IMCA 1EFPA 3ZXIA 1TFUA 1N2OA 1I6MA 4MWCA 4I6JA 4PBTA 3IUBA 1NUTA 3PXUA 2C5SA 3HGMA 2OV4A 1ILEA 1NSYA 1O94D 4CQNA 2QUJA 1N2IA 1O95C 3N2YA 3H9CA 1N2GA 1GN8A 1N77A 1PFUA 4NX2A 2NZ2A 1MOPA 3NBKA 3KT8A 3LOQA 3TZEA 3HL4A 1XNHA 1OWMA 4KR9A 1KR2A 1NZJA 1WY5A 3FY4A 1EUQA 2DR2A 4ZT2A 2QJFA 4J76A 2IELA 4PBSA 3ELBA 4EG7A 3AL0C 4DLPA 5K0SA 1VLHA 1KKUA 1KH2A 1YULA 3CA8A 1T9GS 3CVXA 2Z3VA 1WXHA 3SZGA 1A8HA 3IVXA 4K03A 3TS1A 3IVGA 1R6XA 3U1VA 3G5AA 2DXIA 2EL7A 4OJMX 4HPWA 5TEWA 1Q77A 1EFVA 3DLAA 4EG5A 4OUDA 1EJ2A 1OWNA 1PFVA 3H97A 1QRUA 4MLPA 1WXGA 3L92A 3F3MA 1IRXA 4DDHA 4U63A
chains in the Genus database with same CATH superfamily
2AOUA 2IWHA 1OXXK 2HPZA 3PD0A 2GK6A 3RS0A 3A9UA 1W5BA 4CF3A 3U7RA 3JPWA 3FYHA 4OSEA 5EP2A 4RKQA 1Y3FE 1XA3A 3L0OA 4RK5A 4KITB 1DT3A 1INLA 4G25A 2YVLA 2XX3A 4MV0A 3DFIA 4Q1FA 4Y1FA 3AOGA 3EQ8A 3U6BA 2BFFB 2QM0A 5TJHA 1SR8A 1OFGA 1CUYA 1OA1A 2FI1A 1JJVA 3S29A 5A04A 4B17A 4EFKA 3QM1A 3GBVA 1EZZA 1R0XA 2FWPA 4MO2A 1R0BA 3CNQS 2IUSA 5FPQA 3DVAA 4I4TF 3UJ9A 2WOOA 2A86A 4B76A 1Z4IA 1Z73A 3T4EA 1PNOA 4S1OA 1GKKA 4XW2A 2FAXA 2VNAA 4FFBA 2JA2A 3HZOA 5KJEA 3T38A 4GVPA 3R40A 4JQYA 4Q7JB 3FHCB 1ZD3A 4QYIA 4AMVA 2H4FA 4GE3A 2NUBA 4MVWA 3DFUA 4MW7A 1RJ9A 1TL7C 1XWIA 3OIDA 4CYMA 3F98A 1F0KA 1P3Y1 2HMAA 2RI0A 2RONA 1C9KA 1C9YA 4IIJA 1KVQA 4R1TA 5FBQB 3ZNOA 5KU7A 2GK7A 5ALJA 4AIRA 1PJCA 1MRZA 3MC1A 4BMYA 5IHXA 4MR9B 4OYYA 4QG7A 1FDRA 2C5BA 4QSMA 4Y2PA 3K09A 4DM7A 4DRZA 1R6VA 4J49A 4RUKA 3K92A 4A36A 1OYOA 1PAUA 1BGWA 1MN6A 2QVLA 3K1YA 2OXFA 3MCAA 3MRSA 3O8LA 1ZH6A 3PDCA 3N0XA 3RFXA 3E1GA 4BJ3A 5C5IA 4PQEA 1C4XA 3R44A 2Y0PA 2I22A 3BD7A 3U9LA 4RVUA 2OYSA 1XX6A 3K9NA 2G1KA 3ST7A 1YE5A 1RM5A 2Q2NA 1PG2A 3DUFB 5DXAA 2AFHE 2JZNA 3Q85A 1JMVA 3OPQA 2OKGA 4K9NA 4RPJA 1O96A 3TW0A 721PA 4CUJA 5L53A 3AZOA 1X86B 3HR8A 2ACEA 4OB6A 1AZWA 1GDDA 3MTDA 3OI7A 4B3SB 4C2UA 1WCXA 1F2TB 4C3UA 2GJ4A 3A3YA 4L1KA 5D6OA 5C1PA 4NU0A 5EIHA 1XPJA 4RL6A 3SQOA 3QK7A 4GE0A 4AP9A 3ZHRA 4BECA 4EL0A 2Q3EA 1S8NA 4GX0A 1UEIA 4F9TA 1Q3HA 2H2DA 2JI9A 3NDPA 1V47A 2VNKA 4M4SA 1KTVA 2C58A 2WWRA 4KO3S 1OT5A 3FLAA 4UTOA 2IP1A 3DE3X 3HKDB 2E18A 2J9XB 4LE2A 2QOEA 3IAUA 3IIJA 5EIWA 1YBAA 4F11A 2YYYA 4W1QA 1C29B 4IZHA 3T9AA 3B6JA 3H42B 3KDPA 2Y9MB 2WF6A 4RW0A 4BJHB 3GP5A 3V7YA 1SOMA 1VBNA 2CMGA 5CIYA 1XRSB 4CMEC 4DSNA 2JK0A 3IHWA 3S8EA 4TUYB 1JEYA 5DHTA 4W99A 2G77B 2X58A 2IEDA 4G1VA 4UAGA 1TO1E 1L7EA 3DHYA 5EGSA 4IUDS 2GEJA 2WFLA 5JD6A 1G8YA 1NVEA 4NBTA 3CRQA 2PXHA 4CMIA 1J5PA 5CITA 5KX5F 1NI5A 4PLHA 5H1YA 1NVKA 3UK7A 1M2HA 3Q9SA 4RV4A 3T5BA 2QIOA 3LYHA 2Y1OA 3M6XA 3L02A 4MPDA 4B6RA 1ZM3A 1UJNA 5BR7A 2HFJA 1SJ9A 3OX1A 2X14A 4GRIA 3WDKA 5IKEA 3V8BA 1BOFA 2QVCA 2C4TA 1K7CA 1EGHA 2ACKA 2CE2X 2R11A 3BF7A 3M33A 4Q21A 2X86A 3LQFA 3K4HA 1X2EA 3NX4A 1DBRA 2HYDA 3PV0A 1UJBA 1Z3IX 1Z56C 2FZ5A 1WQ3A 4ZT7A 3CE9A 5AIAA 3AM1A 2IUTA 2YWFA 4REQA 4KQ2A 5DXFA 4DZTA 8LDHA 1I5RA 5I4CA 5K03A 2TSYB 3A6JA 2BFBB 2FA9A 1PHPA 4KV9A 4FX2A 1T8UA 2FUKA 2G4LA 3NG1A 5FNZA 3W6OA 4LQCA 1NFFA 4CCYB 1EUDB 1T4CB 3MMPA 2ON6A 3ELUA 4PTZA 1CQIB 2QE6A 2QMOA 2YWJA 2J46A 5D3MA 3QMWA 4OB7A 5EWJB 1UCFA 3VR4A 4BPBA 2Q5EA 1XEAA 3U39A 2XXBA 4H6XA 4CXMA 2QE7D 4CL8A 1RPAA 2LGJA 3G0IA 4BO8A 3PJRA 1G63A 1B8VA 3HWSA 3G2MA 1S0UA 1XLWA 3FZYA 1DI0A 4UREA 4WA7A 4YB8A 4BFUA 1ZFNA 1UPXA 2AJ8A 3GN2A 2JEOA 4O2AB 3W2EA 1A69A 3BZBA 4HSGA 4JELA 4MPRA 1I2MA 2OD7A 1QGED 2R79A 5MDHA 3KSBC 2QT0A 1M6WA 4D9NA 3RYFA 1S2OA 1RWKA 3HCWA 3VHQA 4BJ5A 3ADBA 1ZL0A 3E70C 4DR3B 4Z4EA 2MSNA 3PFCA 3G1TA 4X71A 3JVVA 4YASA 3I83A 4B6OA 4EG3A 2HQSA 3QYPA 4ZU1X 3WMFA 1U7ZA 1H4SA 3HWWA 2B83A 2P2NA 5KYUA 4BAUA 3L7JA 4PLPA 4XA8A 1KSJA 3F7MA 3LKBA 2MCFA 3V9PA 2R8PA 4ISCA 3ZDEA 3QQPA 5K01A 4WNCA 4GWLA 1I51A 4UASA 3F5SA 3BWMA 4LQDA 1B0PA 3D6AA 4WXRA 3DS8A 2B8EA 4MJ3A 1NU6A 4YUYA 1OXKB 2FW9A 1I9CA 3ETHA 3ZHTA 4EG4A 2HK6A 1U0HC 3CFIA 5DCYA 2I03A 2I9PA 1HE4A 1A5AB 3HBNA 4Q34A 4RD3A 1Z06A 1T1EA 5AW3A 1LCIA 1VRVA 1VMKA 1HORA 1U0NA 3H11A 4QEDA 3ZU5A 1TF2A 2H4ZA 2VT7A 1OI7A 1H1DA 2ID7A 1MIHA 4E07A 3EZLA 3LWDA 5HVNA 4L85A 1P0PA 4FCWA 1L4BA 2ZIXB 1MHPA 2V97A 2EJTA 1LBSA 5MN5A 2XUIA 5DP2A 2H07A 2X4DA 3IUJA 4EELA 2NUTA 2J0SA 4US2R 3PR2B 4IS2A 1KEPA 3BEDA 3DCYA 3CRRA 5BVHA 4F85A 1J42A 2XOEA 4F9FA 2R8OA 3KT3A 1VKRA 2PANA 2RGRA 4F3TA 5C8DA 4Q4HB 5A4DA 3NBXX 1Z17A 3PC7A 5A6SB 2Q27A 3U7GA 4RDCA 2ID4A 4AIIA 3TVYA 4A26A 3P9RA 2Z1NA 1I4OA 2CHGA 1REQB 3G8CA 3EK2A 3UT0A 4BQFA 1E3WB 1DXHA 1HE2A 4KE7A 4E94A 3V33A 2O59A 3OIFA 1BKSB 1NVGA 4KXFB 4D9GA 2Y71A 1W93A 3N0VA 2CMKA 3OMXA 4Q03A 3UHAA 1ZUNB 3HVHA 2OPHA 2LUOA 2A53A 3MT9A 5LUAA 3LF2A 4P4SB 1MB0A 4L5AA 1NVBA 1VJ5A 2HA5A 4M98A 2YZNA 3HN7A 1UBCA 2BDUA 3PJDA 3VPXA 3ZE2B 1UDBA 2IPMA 2UUBB 4DJTA 1RKVA 2ES4A 2EOAA 2EZTA 2G7MC 3AEKA 1SUIA 3LF1A 3W4KA 3GLGE 1NPDA 5K0TA 1PKEA 3FMIA 1N2CE 1X14A 1MO5A 3HA2A 4DNPA 3V4LA 4M0CA 1RMTA 1A2KC 3W5CA 3N6RA 1LPPA 1W8IA 2WHPA 3QLUA 3SKVA 5F23A 1BCSA 1E3EA 3LY8A 1NUQA 4MS3A 5ES3A 1WOMA 1Q1ZA 1Z5VA 4OKNA 2AI3A 1JYEA 1TJYA 1XJWA 3HO1A 1FLAA 1RWBA 1LPSA 2NM0A 3IDOA 3R6GA 5FWYB 4H27A 1PT8A 5GJVC 1Q83A 4YI3A 2LXNA 3AU8A 3RFCA 4R0VA 1IY9A 1HEIA 2A5LA 3GQVA 3NM4A 3ITNA 4QHYA 4TVSA 3WX0A 1Z63A 2WKQA 3HO8A 2PX2A 1NBAA 1MX3A 4DUGD 3FTDA 3X2EA 2RHJA 5EZYF 4NCKA 2P6PA 3AETA 1NMYA 4LXXA 4TXNA 1QSGA 2J5XA 4Y7CA 2ZRNA 5DV9A 1JSCA 1BJRE 3OKAA 3IAS1 2AMVA 2QLTA 1IY8A 1C50A 1Z33A 3BFPA 1KQ3A 1F38A 3QWBA 3RU2A 1JG6A 4W5RA 4HUJA 4ENSA 1BQ4A 3JVDA 4PGFA 1GGEA 3K0EA 1O94A 3HR7A 1N7IA 2IWRA 2R25B 3RFFA 4QM6A 4ZA2A 1G38A 4JT2A 1DAOA 2DWPA 3ABOB 3MAJA 4ABYA 1HPLA 2VA9A 4RJJA 3KXKA 5AQEA 2XGGA 1WL8A 1H2XA 2I6UA 4MW5A 4Q1BA 5BQOA 3DTYA 2IX3A 4EHFA 3ZDCA 2TS1A 4MI6A 1UK7A 3VFDA 1XMJA 2I6XA 3A70A 1JEQB 2OXEA 1K3UB 2JAPA 3E9CA 3AMVA 3LX5A 2FG6C 2RH9B 4IBOA 3B60A 4MLZA 4BUZA 5C4MA 1Z7YA 2VJYA 1VG8A 2WLSA 4IQ8A 3LQKA 3ZJUA 4M1KA 3NT5A 1F20A 5K51A 2ZBGA 3RRFA 1VBKA 5BORA 1UC4B 2QPTA 1SBTA 2C2WA 3RVLA 1YZKA 3SZLA 5C4GB 3MJEA 3SDBA 2DUJA 2EJCA 4HH1A 5KJCA 4AY4A 2ZWIA 4IIJF 4QFCA 5CNKA 1DS6A 1QIFA 3FFXA 1YDFA 1JIQA 3N6VA 4I1OA 5KNCH 1Y6ZA 1P7VA 2E4YA 2QL9A 3GGOA 4L4SA 1BRMA 1AMOA 3MB5A 3DBHB 1YK1A 1Z5PA 2C2HA 2A84A 1F3OA 1YQWA 2AWOA 2GKGA 4J0KA 4K6OA 4BE4A 1QHXA 1QP7A 4HWTA 5J5CA 3GJ8A 2Y1CA 1EJ6A 2FP4B 2NSYA 3GP3A 3M4XA 4KBYA 4OOEA 5EIOA 2IUUA 2P2ZA 2YHBA 4MZDA 1ZICA 3QW4B 1BYIA 2VZ0A 3DMNA 4YDSA 3W9SA 1NNLA 4KUGA 3VJLA 2IXTA 2WTAA 3CSDA 3PGMA 2ANBA 2YVKA 2HK9A 5IT0A 4RFLA 1KJIA 1N3YA 1Z4JA 4DE5A 3CJTA 2GBFA 2GBCA 1AQYA 1SC3A 5AOCA 4D9EA 5ITVA 1N7JA 3SBDA 2HIHA 1PWHA 1I4WA 4YRLA 1YZYA 3QE4A 1UFVA 4TQAA 3U3ZA 3HYTA 4IIYA 1K6XA 1JX6A 4ND7A 5EP4A 1GPYA 4YUXA 3CX8A 2PWYA 5IBRA 1ZD8A 2EERA 1E62A 5FTMA 2DLDA 3G7UA 1M1NB 5KQGA 5EL0A 4B6FA 4CKYA 3CF2A 1FFGA 3IP5A 5I4BA 2XXAB 1TMGE 1WZEA 4MRRA 1FS5A 1ZKDA 5YASA 1ZJJA 2MINB 4ZAWA 4J16A 4Q48A 2ZE6A 3GN1A 3GXBA 5DCUA 1EGQA 4CNBA 3QELA 2A0XA 5E0KB 2P4QA 2Y4NA 4ZYLA 2J33A 1XHEA 1QNFA 2NPIA 3ZVKA 4JMLA 3OZFA 2GBLC 3S55A 5K0FA 3ZVRA 1JG4A 2VEDA 1A77A 2CYCA 4MV6A 2Y8EA 5D3KA 1ISRA 1EA7A 3KUDA 2NO4A 1EGVB 3M3PA 4BO0A 5DGIA 3PL1A 1R74A 3LVFO 2Z83A 4OPMA 4PC1A 1R3UA 4CIXA 2IIQA 1A7KA 2P2GA 4LC9A 5K3DA 1O8BA 2PUEA 4ZXPA 2JHPA 3I6BA 3INGA 4NRDA 5T64A 5IJ9A 3F6CA 1JPNA 1BVHA 3P9QA 4CM9D 3IQGX 4I36A 4AYXA 4QGAA 5IVPA 1UP7A 1E5LA 3OCCA 3V48A 1TFUA 1WQ1R 3E53A 4JOBA 2MT9A 4ZO7A 4AF6A 4GLOA 3EARA 1EUCB 1VI5A 2C5EA 4GHWA 4XRRA 3I23A 1N2IA 4WXHA 1HDZA 1TT7A 3UJPA 4BNWA 1SXQA 3SMVA 5JSZA 3GGGA 2UXDB 1DKMA 3UW3A 2QAJA 4LJ9A 2JLAA 3MD0A 2ZUBA 1A9RA 3JAKB 4PYMA 1M72A 1QVWA 3QUAA 4QHSA 5D86A 5KYTA 1MA0A 4R1PA 3CHYA 4MI1A 4AUNA 3EPJA 2F4VB 2GS9A 4DA6A 1J2YA 2XKJE 5JWOA 1OJLA 4CDRA 4ABTA 2R8EA 3IJPA 1Z8FA 5DW0A 3H5LA 4YAOA 1TKAA 4ZT2A 1Q2UA 1ECCA 1TNDA 2C8LA 3AW8A 1V6CA 1ZG3A 2DUNA 3M89A 2PVCA 4Q4DA 4G0YA 1IPFA 4LMPA 4RYLA 4UUNA 2VDOB 1G0OA 4Y6PA 3KQHA 3OO1A 1UP4A 4KMOA 5B12A 1G0NA 2QWXA 1RI5A 3AYXB 1QUEA 2CVQA 2ZQ5A 4TKUA 3HJFA 3H6HA 3DXFA 3ICPA 1U3UA 2CCJA 1S2LA 4XPIA 1JTVA 3CA8A 3MILA 4H6PA 2V54A 3EZGA 1KI8A 1ZMTA 2VYVD 2W6MA 2Z3VA 3DAPA 4NYIQ 1IM8A 3O9VA 1E5TA 3N2EA 3QLTA 4UCQA 2JAWA 1WP9A 1D3AA 3JWGA 2P9TA 3OCVA 1J49A 4JA0A 1A7UA 2PO7A 1DEXA 3KQPA 3LXUX 4DMLA 3PE3A 1ZIDA 4HPWA 1ML4A 1WUKS 1UAAA 1RD4A 5DJ5A 3ZEIA 3GVXA 2FF5A 1G60A 5IARA 1PBTA 1EJ2A 1T3HA 1RJGA 2O6LA 1HRKA 4ZYXA 1U2PA 4PYOA 3S68A 1OF1A 2OXTA 2ZZNA 1IIBA 2P8SA 4AMZA 1SU4A 2KBEA 3ZV5A 4LF6B 1P7ZA 3MHTA 2ATXA 1KDTA 4IMIB 2I3AA 1HFEL 4CMBA 1Z82A 1MXFA 4EY8A 1BS2A 2RGGA 3CG0A 2R6DA 3N59A 3PUYA 3UTDA 2G70A 3U44A 4BKQA 3SZOA 1IQUA 3RFUA 5JTTA 1ORRA 1V9CA 1Z4OA 2HV9A 2PU7A 1NXTA 3QX9A 4FSXA 4QJBA 4YVFA 4XWWA 5AW9A 2JC3A 1QCYA 3KCQA 1LPBB 3ONDA 3DDWA 1ORTA 1CZNA 3OJCA 4CEJA 5INTA 3S2UA 3WB0A 1NVMB 4OMDA 1O9GA 1SXIA 2QE7A 2VSNA 3FPAA 3GLKA 3LUAA 2QQEA 3LDUA 3GEMA 5CA0A 1YRWA 4UTRA 2ABWA 3O3OB 3DP9A 3LBHA 4EGSA 1IZ9A 3KQKA 3ANLA 1U0EA 5FBWB 3CLRD 3EMBA 1L4YA 5FHRA 3HA5A 4LF9B 3WLLA 1J1ZA 2BHSA 4XFDA 3VDRA 2PLAA 1M5UA 4DG5A 4YUWA 2HNAA 5HP4A 5A2QA 2HZBA 2D74A 1IBLB 3EQ2A 3A28A 1GG9A 1PJ3A 1SUPA 3MCTA 4DCPA 4FPXA 4IX1A 4EA8A 4YAGA 1Q0RA 2EW1A 1SHJA 2YXBA 2C98A 4AQ7A 4RVCA 2X2OA 2QVZX 2ZPAA 1RXUA 4OI0A 1E2FA 3PCXA 2ACVA 5JI3E 2DHQA 2VHXA 2G1PA 4F4FA 1DIHA 4O1MA 2QL6A 4M0DA 4CKEB 4NU5A 5KTSA 3QEOA 3E7DA 1EFAA 1J8DA 3OLVA 4DLLA 4AS2A 3ZJVA 2GHTA 2A5JA 4EMSA 2JLWA 1KY5A 4GMKA 4YV1A 2VOEA 3JQBA 4RPKA 3W3ZB 1N8SA 2A57A 3DYIA 1K7EB 4ZPXA 1EFUA 5PGMA 1SY7A 2X22A 3IV7A 4Z7JA 2HA0A 3OIUA 5DI9A 4DRYA 4W63A 6ABPA 2P6OA 4P0PB 5FWDA 2EP8A 4RYDA 3WYBA 4BWVA 3W6PA 3S5JA 4DDWA 1IWPB 3NHLA 1A2QA 3ICOA 1ODJA 1OWLA 5CVEA 1K88A 4YFYA 1M8PA 2VZEA 3VU9B 1K98A 2Y66A 3BCSA 4X97A 4LXYA 1M1YE 4RVHA 5REQA 4BZXA 2CLDX 5TX7A 1IY0A 2OBNA 4U2EA 3PPXA 2ZAYA 3W2GA 1YF3A 3C3KA 1PSWA 2PLNA 3QPCA 4DB2A 1TAHA 4P4NA 1QTNA 4D0RA 5TGZA 1Q0HA 3D5QA 5EJFA 1G3QA 5HGJA 1KBZA 3PNVA 1P1HA 2HEGA 1P17A 3AESB 1C30A 4K6CA 4O29A 2QAIA 4XFKA 4CIYA 5LYJA 4AS1A 1XFAA 4EUEA 1UAYA 4DLKA 121PA 3WLIA 3I5MA 1XKLA 2X9VA 1CY1A 1AS0A 4DLNA 1RI4A 1CUXA 1N8TA 4DXDA 3CEJA 3TXYA 1QQTA 2TYSB 3E8MA 3DEAA 3T3HA 4OXYA 3L1UA 4PBRA 3U56A 2HDHA 4S2EA 3MTGA 2B25A 1V5FA 2QUKA 1QYXA 1IMOA 2REQB 3LKDA 2Q6OA 3P9IA 1EGAA 2G88A 3BMCA 3MRTA 4EKEA 5KHLB 1G5TA 1O95D 1WUYA 3KHUA 4S0ZA 4Z1MD 2PYIA 3TFQA 2X3FA 1XZCA 2AZMA 3U4IA 5EP3A 1CR0A 2K2QB 2DULA 4UOEA 1OYYA 1R6UA 1HOXA 3GRCA 4J1SA 3SSOA 1LBTA 4A6XA 3QPBA 4MXDA 5IZCA 4C04A 2JJ2D 5ICGA 2YRXA 5HE9A 4Z4GA 1E64A 1CUBA 3S28A 3BX1A 2W98A 4WDRA 3H2SA 2PRJA 1W76A 2OAQ1 4XUGB 4I9NA 4ZO8A 1ORIA 3LUGA 3TJZA 2NP7A 4QG3A 4J7XA 4F7WA 2RGCA 4V03A 4Z9AA 3AGPA 2OQIA 3CMCO 3TQRA 3H5AA 1S4MA 1Y1LA 2FXVA 3C98A 4FONA 1W96A 1GYQA 4Q4JA 3VO8A 3CRZA 3VYTB 4DUGA 3D8NA 4ERXA 4RQBA 3UCXA 1P62B 3IV6A 1FNBA 4HF7A 1SD2A 4L8YA 1N7GA 1IK4A 1UKCA 4G07A 4M46A 1NKVA 3K6RA 1TGVA 1P2UA 3DJFA 4L50A 4KRFA 1MABA 1L9XA 1Q7GA 3BRWD 3PC8C 3CPJB 3HDHA 2OCBA 2UYYA 3O21A 4JLOA 3G0CA 2WWIA 4N47A 5JTUA 3LLCA 2H1OA 4MULA 4IFBA 3WO0A 2IYXA 1I33A 1XL0A 4AURA 3FDIA 1P9NA 1I2AA 2OCGA 4DCNA 1Q1GA 1U2SA 1F7VA 1QWSA 1IQ0A 1W5EA 1Y7PA 1A7AA 3A9WA 3R0ZA 2JFZA 1UMDB 3EG5A 1DMSA 3VDMA 4N3BA 4BGVA 2XZDA 3E23A 4OQNA 1NHGA 1OZ0A 3F8SA 4FR2A 4U7PB 3LC2O 2DHDA 1JALA 5KKAA 1P4SA 3FCSB 2XRZA 4G0PA 2R9VA 3V8EA 3DBLB 1PEKE 4KVFA 2AVDA 4ZZIA 2GYVA 3BERA 2H8GA 4YAKA 4DKJA 3THXA 3AWIA 2OQRA 2NYAA 3EQ6A 2ZTMA 2JGMA 1IHDA 1NBHA 4UTZA 2ZRDA 5AYVA 3RIGA 5AJYA 5ADUS 4CEIA 2NSDA 1XVLA 3E9DA 2MSKA 1GL7A 2O2CA 1HO3A 2W6ZA 4Y2VA 5EZQA 3IKMB 1ZMBA 2ID8A 1Q21A 1RAIA 1PBNA 1RYZA 2R8BA 3A04A 1U3DA 3OIVA 4MVCA 1QNLA 3D8HA 4KYUA 4LHSA 5JT1A 5K0CA 1BCRA 1Y42X 3FVTA 4MROA 3TAXA 1VDZA 1WP4A 1P72A 3K70B 4JUAA 2Y1FA 3WRVA 2WWWA 4X6YA 1QF6A 2P7HA 2PMCA 1LWOA 1I6LA 3AUJB 5F12A 1FMCA 1P77A 1RHUA 1K4YA 2Y67A 3A1TA 1KFEB 1HMYA 4BFSA 3FBGA 4NKRA 5ALWA 3AIIA 3B82A 1P75A 1QKIA 1M6HA 1RJDA 2HRBA 2RGBA 4V02A 5A9SA 1HI9A 1F12A 4RC9A 4GXRA 3D6NB 4CIVA 4R1OA 4C7OB 4EHHA 4FYPA 1RJEA 5G0TA 4HFNA 5KI6A 2YY6A 3GBPA 3H0CA 3ZWWA 4Q37A 1GTSA 2PZMA 3G2PA 3VQTA 9MHTA 1EWVA 4FK8A 2DZDA 3SX4A 1V8PA 1WCV1 3UC9A 4UU7A 3SFVA 1J9EA 3CM0A 1CB7A 4F45A 2DKNA 5E9WA 1FQKA 1DDOA 1UPCA 1QHNA 1WR8A 4YJ3A 1NXXA 3L84A 3OZAA 5IDXA 3K6SA 1XCBA 2GARA 3U6KA 1GU7A 1U6KA 4MB6A 1LDNA 2YCLA 4JI4B 4LRUA 1OC4A 3LXMA 5LB4A 1CERA 1YKGA 5FFMA 4AZ0A 2HAEA 1ZH0A 4MS1A 1QU2A 2C95A 3OJFA 2UAGA 2C4MA 3K0CA 4B3CA 5F7OA 4I55A 4GRAA 3LA6A 4MA0A 4KXNA 5LR6A 3SR0A 2KE5A 2GWRA 4XD2A 5B7PA 3T3EA 3O75A 4MCJA 4UVIA 3DEIA 5KNCD 4I1PA 5LMNB 2Q9BA 2VG8A 4I6GA 3GLGA 6AT1A 4U7FA 3QEAZ 2R751 3ON5A 3LQ2A 5IJAA 3GO4A 4P0TA 4OQEA 1AF4A 1NASA 2QG4A 2D3TA 2R6JA 1V8DA 4Y0VA 1VL0A 4MUFA 1TCVA 5DYYA 1Y1QA 4V24A 3W5JA 2XGOA 2PUCA 3DT9A 3E2PA 1LTHR 3ESXA 3FYDA 1WF3A 3DPUA 5EE1A 2YV1A 2GPJA 2O3JA 1X13A 1A95A 2P9HA 2QIPA 1Q6YA 3IEIA 1NATA 4LJ5A 2EV9A 4BVLA 2FYTA 1F7UA 3DT8A 2OHVA 1Y9ZA 4MUGA 2CSUA 1ICEA 1RFGE 3FIUA 3S2EA 4CM9A 2ETXA 1M33A 3AF1A 1AXGA 3ER6A 3EFHA 3HN6A 5E7JA 3VOSA 1BXRA 1XA0A 3BM5A 2AXEA 4Q6WA 4DWJA 1QHHA 2H4JA 3CX7A 1WNFA 3R3ZA 2AK3A 1DRJA 2WD8A 5CK5A 5KAMA 3I32A 4ZI5A 4F12A 4G0WA 3QUQA 4HLDA 1QUFA 4IRMA 3GA0A 3DBVO 5I7EA 3EGXA 2YFYA 2VRCD 4P3KA 3RSHA 3LZDA 3DFKA 4KLRA 1V16B 2B69A 2PZFA 4F8JA 4XB1A 1EK2A 4S12A 5H59A 1XD9A 3GB9A 3ZYCA 2M9MA 2ERCA 2UUOA 2VP0A 3H4IA 4MW0A 2VHVA 1TYAE 1W2GA 2XWBF 1TQ8A 3T5CA 2UU9B 1ZC3A 3I0ZA 3MJHA 2PL3A 1DEKA 5JQGB 5L3QB 2EIHA 1B76A 2V9ZA 2IYSA 1RYMA 2AR7A 5CA0F 2OAGA 2VH2A 2PMWB 1JILA 2C1XA 3GLUA 3A1DA 1O0SA 3BGSA 4N01A 4CQMD 4KAAA 3L2OB 1NQXA 1MFPA 3L7OA 1E6KA 3TI7A 3ZHCA 4W5QA 1CZLA 1NU8A 3LVQE 4Y2SA 4AKEA 1XU9A 2MR6A 3IXMA 4OBEA 2WKPA 4JYMA 2OV6A 1IG0A 1UANA 4B80A 2B94A 1AKYA 1JMYA 1F1BA 2VYVA 4HN2A 4MVJH 2EGHA 1N5OX 3ASYA 1CR2A 1CQJB 1G3UA 1FTQA 3KTAB 2GN2A 3IE1A 1SA0A 3DM5A 5TRTA 1K3TA 2GDZA 3OVMA 5JFGA 5EE5B 3NEJA 3SF0A 2O8VA 3H8WA 2NU9A 4UQOA 4URFA 1JSRA 4GM4A 4OP2A 5CP8A 1I30A 1WBBA 3FJ1A 3S1AB 4JR2A 3IAM6 1N0HA 1QYVA 1ICIA 5ESRA 2VJQA 5HE8A 3SHOA 1XZHA 5J4KA 3H7AA 3HL6A 1B1CA 1YE3A 3HI4A 3UHPA 2M6KA 4WD3A 4QUHA 2AOTB 3V9AA 2GM9A 5DM4A 5A7HA 4DR6B 1VSUA 2P6NA 3K8OE 3N7UA 4PM4A 1X1SA 4D3DA 4EPWA 1QQ6A 3QG5A 1W35A 3EC2A 3CKLA 4NV0A 2VJDA 4U0JA 2XZLA 1QANA 1T9ZA 2UZ0A 3TCXB 4QQRA 3AF0A 1U2DA 3WGQA 1XEWX 2GA9A 5FOXA 1CR1A 2JFNA 4LHVA 2D7CA 4MRVA 5FXMA 4LKOA 3FKJA 3WLSA 1MC5A 1P6QA 4R68A 5DEIA 1ETHA 2ERXA 2WK1A 4MZXA 3L8GA 1H1TA 4ZANA 3A1WA 4EI9A 1NTOA 1X7DA 2X9QA 3KAPA 3E4CA 2FR8A 4QX6A 4L78A 5I7AA 3RNOA 2DQZA 2NZXA 2W4MA 3KQYA 4RTQA 4W5JA 2ZWVA 3IURA 3NZEA 4R9NA 3PC4A 1SB8A 5JXGA 1WCIA 2I3BA 4HDRA 3UT5A 2X0KA 1G3RA 3B8HA 5LYJF 4FW8A 3DV0A 4A73A 1ISMA 3HFGA 1AHPA 1KDOA 4DZZA 1P9OA 2I1QA 3OTGA 3IP9A 1Z0KA 2PGOA 3C41J 5BOVA 4YAUA 1UBMS 1OOEA 5F9MA 3L8CA 4MYCA 5C5CA 2GW4A 5CEJA 3ULKA 3QKSA 3HNRA 1FFXB 1QG2A 2Y1KA 1NMQA 3N0WA 4LDNA 4LJ8A 1EE9A 5I3CA 3HP4A 4Y8VA 4IHQA 4RKYA 3SVLA 2MJLA 3INRA 1QTQA 3VPCA 2CMDA 3O47A 4CF6A 1UC8A 5TJ9A 3O0TA 4Z49A 4LXIA 5KTKA 3RGWS 4BFLA 1CVRA 4IRXA 4QD3A 5B1SA 2V6GA 5ICSA 1MNAA 1XI2A 3AVYA 1GNVA 1LKZA 3EASA 1K6IA 3HACA 3K5IA 1TUGA 2D4AA 2NSJA 3V4PB 2QQ5A 4B3DA 4K9DA 1CNMA 4GPBA 3O1IC 3JZAA 5C18A 1MAUA 2XYQA 1RZRD 3HBLA 3UJAA 5CVUA 2Q4TA 3OLYA 1PZEA 3WLFA 3ZXIA 3F78A 2Z5LA 2JW5A 2AF4C 1JS1X 1MAAA 1VFPA 2IHTA 2JLBA 2XWPA 3DEKA 3LUHA 4J0QA 4YP1A 3HGMA 5IHPA 3MTIA 2FFHA 4FHZA 3EGOA 3R0XA 1G5FA 2F43B 3H9CA 3BMNA 5F1PA 4LV6A 3BQMB 3ZE7A 1KI3A 2NZ2A 2GRAA 2YVQA 5C34B 2LZ0A 4HY3A 4Y67A 1ISHA 1PGJA 4Y0AA 3ZV3A 1ESMA 5TY0A 4KRXA 4EA9A 1IEVA 1A9OA 2G82A 4ZOCA 1PJSA 2BGIA 2Y76A 2N1BA 2WA1A 1Z28A 3DBIA 2IZ6A 5EHGA 4CM3A 2JAHA 1AHIA 1T9HA 1ZVQA 2PJUA 1WY5A 3NNSA 1M73E 4UBMA 1P2FA 5JMPA 2II6A 3GMSA 5AJUA 3AFOA 1O03A 4Q4AA 1V5IA 3H5RA 2IY9A 5HZHA 3DL7A 4FU0A 1GY8A 4OH1A 5F52A 1W19A 3TD6A 1T1JA 4IKOA 4YR9A 2XMCA 4YO8A 1MIOB 3GJSA 1FYEA 4PYQA 3VR5H 4AWXA 4LSZA 1O95A 1OLXB 4KWCA 3RVQA 3NAGA 4Z1MA 1E9EA 4HWRA 3OM9A 5EYPA 4BMPB 1A8HA 4YAWA 4FGWA 4DIKA 3U1VA 2NMVA 1U2QA 2Q45A 1PO7A 3AJRA 3MGAA 4QDXA 3LAWA 3FUXA 5FUMA 4B6SA 1YACA 2P6MA 4XWOA 2Q2OA 4TYQA 2JHFA 2BTQB 2WG1A 2JJ2A 4EG5A 4YRIA 3QWIA 4FUTA 1GUFA 4LW8A 5GJCA 3SAJA 2ORIA 1WXGA 5DN6D 1FA9A 4ZU3A 3G85A 4BVAA 4HDSB 5TIIA 3Q8LA 4PFSA 3G59A 1T3ZA 4FWIB 1ZXBA 2A1UA 4IMJB 1LVGA 4TZKA 1QYWA 2G83A 2X8JB 4MINA 5EIEA 1GUDA 5KYNA 4FR0A 2Q1XA 1OLUA 3ABRB 4JP5A 4D8XA 4RDHA 3A36A 1T8TA 4PRYA 3NU1A 3OWXA 3O5AA 4BDTA 2G3DA 2QU8A 3FOCA 2ZYTX 1M2OB 1IM2A 2RHLA 3VR3D 3EFOA 2V3WA 3K1ZA 1LNZA 3K70C 2O8DA 4ZQGA 4KDCA 3ISJA 5A2GA 3BRWA 4KLCA 3QVOA 1NA5A 1TAGA 2VPWA 3NWOA 1UC9A 4C7XA 4Z3KA 4GIBA 3DF7A 3I01A 4LAFA 4NCXA 4FLFA 4CJXA 1RP7A 3O90A 1X94A 3ITDA 5EQFA 3IUEA 2XKKA 3BN3A 3NHRA 5ERXA 2I52A 2AA3A 3T0FA 4BU0A 2L18A 1X7XB 2P35A 1NQOA 3NMUF 2ODNA 3Q7EA 4PEVA 4ZFNA 1W48A 4RTNA 4DVJA 1N0UA 4TROA 1LH0A 4Y2HA 3AERB 4CE6A 4P54A 3W77A 2E5LB 5EG5A 2WU8A 1JE1A 1JQDA 1SG6A 1T36A 2CJWA 4PLZA 2O2HA 4JR0A 1YZFA 2APJA 3ZWXA 2HLPA 4YJ3F 1G4UR 1E7QA 1UWLA 2BRUC 1FX0A 3OPYA 1ZM9A 2OFWA 3O8QA 5A05A 3TLGA 3W8RA 4GLFA 1G21B 4HDNA 1MO6A 1AV6A 2ASVA 4KQ9A 1SUEA 4NARA 1RZVA 2GSWA 3UXEA 2H9YA 4C03A 4G0MA 3SU8A 1U0FA 2FZ4A 5LIPA 1W0CA 2AXQA 4IZOA 4MP6A 4ZOQI 3FUTA 1E61A 1PTJA 2XNHA 3BL6A 4I55F 4MRNA 4W5HA 4LRQA 4Y1GA 1QO0A 4ZV7A 4AK9A 5H82A 3A26A 3IGFA 4C0QC 3HK2A 5C8VA 3WS7A 4A0FA 2C54A 2P4EA 1EBBA 2WT8A 3ONFA 3EPLA 2XHZA 3PWSA 2CFSA 2XRYA 2DTDA 4M99A 3RTGA 5BXQC 1RQ7A 2Z4RA 4MLCA 1FNSA 5EPOA 1P2VA 5DGHA 2NO5A 4YRZA 3TQCA 3AVOA 2OTCA 2XVMA 3WTCA 3S4YA 5BSFA 5L40A 3JAWA 1NBEA 2CXQA 3TTYA 1T8PA 5JAIA 1NPTO 3QE3A 1BMTA 1J8VA 1E8NA 4DXHA 1JTFA 1BXKA 3RV3A 4G1UC 3VRHA 4M6WA 2W2NA 3U2QA 4NJMA 1HETA 1UT5A 4DDTA 2IRWA 3PA8A 1D4FA 2OLEA 2COKA 3FNEA 1HEYA 5I5EA 3K30A 5KYXB 2EP5A 2Y6VA 4OL9A 3DZCA 3F4BA 4IQFA 4WW0A 3ZK7A 2B4AA 4PPGA 5BVGA 2F1HA 3HYRA 4RK6A 3SSMA 5LDHA 1N2JA 4KH1A 2WAAA 2AEEA 5B4TA 1DIGA 1FK8A 1XAJA 2FW0A 2GD0A 2P77A 3IDSA 3AFHA 4H1TA 3BILA 4AICA 2BF7A 3Q3EA 1NVAA 3CUUA 2RIRA 1PR4A 2Q6KA 3UQYS 1WXFA 3DWGA 4X5OA 1CCWA 1ZWKA 4OD0A 4EB3A 5A3VA 2ZS8A 2CJYA 3S44A 1R37A 1W1IA 4LZLA 1PV1A 2ODTX 2HJGA 2AQKA 3INNA 3E8XA 2Q9UA 3ECAA 3H5NA 3L7YA 3QVSA 3C7TA 2A5DA 2A92A 4TMXA 1LFDB 1Z7BA 4GYKA 1Z2EA 2A1TS 3AUSA 5DM0A 3IE0A 3MS7A 4FGJA 3CY6A 5KNCA 4U8GA 5BN1A 3DWFA 4OI4A 4UU8A 5HTOA 1A1VA 2O6HA 2Z6UA 1RTTA 2EJUA 4P3PA 3EGCA 3SYTA 4UE3S 4BZZA 2FRDC 4IL5A 2AX3A 4JIMA 3DDOA 2NSLA 3G23A 5HKBA 1GIAA 1YRAA 1C5KA 2W2KB 4JQCA 3EOZA 1NNUA 3D9QX 1XB2A 2NUPB 2HT6A 1RM3A 2LP4Y 4G1BA 4GU5A 3ZC3A 2ZS9A 4GQBA 2A7QA 3DV9A 3PTAA 2FPRA 1ZN2A 2DUWA 2C96A 3NTXA 4YMVA 3IBCA 4DA9A 1KFBB 4BPRA 1U6IA 1AV7A 1R4ZA 2Z1DA 4UZSA 9LDTA 4MHSA 5MGNA 3QV2A 3UJBA 2D2XA 1F4PA 3OFSA 1EDOA 2CXOA 2F8LA 2GXQA 2QXYA 4QDOA 5A71A 1W4AA 4DMHA 3U5TA 2CDCA 5BRNA 3VSDA 1UADA 1C1XA 5ALHA 2P27A 2C88A 4TWAA 3LY5A 1US8B 4ER0A 2BONA 5THXA 1KDVA 2R65A 7MDHA 1X70A 2VRCA 4J1NA 3TLEA 5BYKA 1ZKMA 2EHJA 2VDKB 1XZJA 4CKZA 3ABSB 2ZT8A 1KZ7B 3JRXA 4H16A 4CL0A 1VE7A 2F00A 1FUEA 1NR7A 1UKYA 4XYEA 2VNJA 1OUMA 1DHTA 1AGNA 1G1AA 2ZITA 2CLEB 5F5XA 2QGNA 4B6QA 1BD3A 4CM4B 2RHGB 2C2ZA 6ADHA 3GJZA 2H1SA 4TTSA 4E3WA 3T3MB 1SVLA 2GPSA 3BE5A 5LOVA 1Y3AA 4CQMA 2JFWA 3WL7A 2RI6A 4P83A 4DL9A 4D9FA 4AYTA 3CRNA 3Q7RA 2HWWA 4IZ6A 4PGHA 3CVJA 4V0LA 4H7JA 2NVWA 1QV6A 3RHTA 1NF2A 4F72A 4OX9Y 2WEKA 1ADBA 3WQBA 2WMDA 3C6KA 4W7HA 4ZRMA 3RUPA 7AT1A 1KQGA 2EYUA 1NQAO 4KV7A 3TLCA 2XUPA 1DCKA 1R9NA 3SYKA 2IDZA 2HO4A 1QCDA 3NJRA 2WHRA 5E4JA 4YLYA 1OY1A 1NI4B 1XL1A 3PXEA 4C6SA 1DHRA 1W73A 2JD2A 1QGAA 3JASA 3O84A 1WSAA 2B1QA 2BJVA 4ALNA 3C5EA 2JG3A 4FQ8A 4OY3A 1WD7A 2KMLA 4CMKA 3CIOA 3DLHA 4MR8B 1M6NA 3F49S 3GU3A 5FRDA 4C4PA 5L4NA 3C5CA 2V0GA 3MWEB 4QNRA 4AN4A 4FYXA 4O4JA 2GASA 4JV5B 1YAHA 3QLVC 5I6DA 1ST2A 1Y48E 4H3VA 1CVLA 4JR1A 4BQNA 4AO7A 5FOUA 4BZPA 3MUOA 2DUUA 5IWCA 4C6HA 1KF0A 5BN3B 3IJEB 2OEPA 3NYQA 1FXUA 4JJ8A 4GLBA 4YRJA 3UB3A 2PUAA 1PJZA 1UDXA 1V5WA 1E7MA 4AVYA 5I45A 5GV7A 4ZYVA 1QH8B 2B92A 2SECE 4GR4A 4OXQA 4KW7A 1B4DA 1EX1A 1T5OA 4QOFA 3T3IA 4O3MA 2JIDA 2WJJA 2IIVA 1U0JA 2A67A 3A9TA 1EFPB 1LD3A 3VC3A 4Q3DA 2JGIA 5BQXA 1OAOC 3IBGA 2B6HA 1R88A 4N0PA 1X6VA 3GJRA 3H6GA 5DBHX 4MVJD 1U63A 2PTGA 4JN6B 1YK0A 5E8RA 3G8AA 5E4YA 3EAGA 3KK0A 4F91B 5BNTA 4ZOLB 2FXIA 2H2AA 5EMJA 4M49A 3DPSA 1VRWA 3EXIA 3ROEA 3PEUA 1S3SA 1Z3CA 2QX9A 4RK1A 3HKDA 2DFVA 1YASA 4P86A 5DGDA 4Q3CA 2YWBA 4I7EA 4YA6A 2IZ7A 4OHPA 4R8VA 4AMUA 3KB8A 1FIUA 3C3YA 4K1LA 3KAKA 2IX9A 4LN1A 1JG7A 3BFVA 1X7ZB 4Z5XA 4Q12A 2YBDA 3BCHA 2ZT7A 1SKUA 3D4PA 2B3TA 5LZ9A 1XPRA 3UF0A 1J20A 1KYQA 3I5YA 3A2MA 1FF9A 4FI3F 4DCJA 2H7VA 3RWBA 1GVNB 3RRBA 3EDOA 3BJRA 1RZRA 4LVOA 4RX1A 1KVTA 4K3VA 1W94A 1DQSA 2EJVA 1UJ2A 4M9SA 1G8MA 4RHXA 4BWFB 3ER9A 1XZEA 1YSCA 1Y5MA 5EE9A 3ELYA 4BFVA 1GTJ1 4TLEA 1BN6A 2BLLA 2QMYA 3N8NA 4S3MA 1Y3DE 1AKVA 3ZJTA 1YA4A 4WQMA 4JB3A 4JX8A 1YBFA 1YZ3A 3EFBA 2I7DA 3EIEA 3FW1A 1VI2A 1YFKA 1YZLA 3G5UA 1QTRA 3D7MA 3WK9A 4EZEA 3OO0A 2OECA 2CGEA 3ORQA 4HT3B 5J40A 3GUCA 1MB2A 1HG0A 3GAAA 5CEEA 2O52A 5E7QA 4BBPA 1FNCA 3TSCA 1L9KA 4JT8A 1XEFA 5A0FA 4TL6A 2DU8A 4UXHA 1NDHA 4PWYA 1NW5A 1SCDA 1SCBA 1UBTS 3MIIA 4OXRA 4ZCPA 4OHUA 3UEOA 4YUZA 2C42A 5JS1A 4EHBA 1RKBA 1EK6A 1TZKA 1T3GA 4POOA 2CT8A 1X19A 3P97A 1JHRA 4ZQIA 3PYXA 4J0CA 3JRWA 2NT4A 1CUJA 1MTZA 2OLJA 1VHTA 4LISA 4W8HA 4H4EA 4UBKA 5FFNA 2QA5A 4NWIA 3QKIA 3AILA 4DYHA 5AI8A 1E2LA 2W6JD 3B5JA 2IS6A 4FQ5A 2IYUA 3KOZA 1V0JA 1OIWA 4ND8A 5IMBA 1PUJA 3CNNA 5ES4B 3P9PA 1L5GB 3J7AC 2Y1LA 1ZPDA 1UIMA 2GF2A 4O2AA 5TMPA 5EIBC 1G19A 2XT9A 4TKVA 4RETA 5DOVA 3WP0A 1Y33E 2L69A 2ZXFA 3FXAA 2AXPA 3HCOA 5DN6A 3VR2D 4LE0A 1PLJA 2ZIWB 4DHWA 4IOJA 5IP5A 3DO6A 1J22A 1M75A 3GGCA 4OKSA 3CXUA 4Z0HO 5HF5A 2IA5A 2LNDA 2D1FA 2BM9A 3UK0A 3UMYA 3H16A 5HCNA 4EYSA 1E2HA 3QEMA 1N1EA 1A9QA 4NFSA 3RI3A 3PQ4A 4JDUA 2EFJA 3TW8A 1QFYA 3I5AA 3JQPA 3A37A 2ISCA 2GGSA 4RK4A 3ZOKA 2GVDC 3VR3A 4HAZA 4OYHA 1B2LA 1OBOA 1D04A 1R8JA 4OQLA 3A6ZA 4NOKA 3SIPA 3JQFA 1AQNA 1HH4A 4DSTA 3KKNA 3THYA 3HI6A 3IVRA 2PAFA 1BYUA 4GICA 3U60B 1LI4A 1A9TA 2A0UA 2HH9A 5TPWA 1PHRA 4GPTA 4UPDA 4DA8A 5ELXA 4DSOA 3IUNA 3OP4A 3PLNA 4R1NA 4RFVA 3UB4A 5FA8A 3VM6A 4RFSA 3TUZC 3WLEA 1JR4A 5NLLA 3ISTA 3VR5D 2DJ5A 2F1JA 2D1TA 4L9WA 3T7EA 1KOFA 2FSFA 3L6EA 3TIXB 4HRYA 1VCMA 2Z43A 5EWLB 5HKKD 5K4AA 5KC9A 1LVHA 2B5WA 1NUPA 2ODEA 2PKXA 3COSA 2BFNA 2HJSA 1PJAA 4EPXA 2FDRA 4TYMA 1SPXA 1R8XA 3B1WA 3UGJA 3P2MA 2ZXUA 1PL0A 4Q9LA 1KSGA 3ZBQA 2P78A 1J7KA 3UMBA 4Z9FA 5DI3A 1D2CA 3NUGA 5CEFA 5A6SA 4PZEA 2QX7A 4KXQA 2IC5A 1DIRA 2QLFA 2PRIA 2DFTA 4OJNA 4AN1A 5KYWA 4U8HA 2BMEA 1UJ5A 2C5HA 1PJTA 1L5RA 3FE2A 4MAMA 2HA7A 1RLMA 1RRVA 4DFDA 2YJZA 2RI1A 1YVUA 3CB2A 4WZAB 5CLQA 3LC1O 2H1HA 2A54A 4OQZA 4ZVRA 4U7HA 1NJ5A 1DJLA 5ITSA 1SIOA 2R7KA 3DHWC 2O20A 4RGBA 4HNAB 4P4TA 1X3LA 1XU7A 4TPKA 5F35A 3LHSA 3OQNA 4KJXA 3NP7A 2JFHA 1KDPA 4NV3A 4ZJPA 1ACJA 4I6JA 1GO2A 2FFJA 1HC7A 3C6MA 2CLSA 2QSUA 1JQLB 3TFOA 3RGGA 1VE1A 2FSVA 4PGAA 4HRXA 1MOQA 3N2YA 4PVDA 5JDIC 4MVJG 2IYZA 3O2SB 2YIVX 5JYCA 1HE8B 1FJHA 4P82A 2MTBA 3CZAA 1DIOB 3AP2A 2DBQA 3NBKA 4G5OA 3SC2A 4QU5A 5CW1A 4KTTE 1K8YB 2AKAB 2B1IA 4WN3A 4W1SA 3S2YA 3EQZA 4O2BB 4E14A 1D6SA 2IZ0A 1MRSA 2QRMA 3FFBA 4ZDWA 3E9MA 3USCS 4F2PA 3KPUA 4MDFA 1UAGA 5KJ6A 5E4TA 3ZTWA 1UPTA 1F48A 1P39A 4HX2A 4WKPA 3ENNA 4PZUA 5IKOA 3NRJA 4CG2A 3MMZA 3LV8A 4IHAA 4JFRA 1SCUB 1NDQA 4EARA 1L5OA 4V3BA 5EJEA 3QX8A 1R4MA 3MNFA 2AFHB 1JHYA 3FVVA 2GF0A 3KSUA 4NOJA 2PQMA 4KLAA 4UEOA 1SZCA 3N2GA 5AVOA 3AVXA 1CG6A 5EJ2A 1BWSA 1RRKA 2BHRA 2V6JA 4UE2A 1AXRA 1THTA 3N74A 3D8SA 3ZLUA 3N2KB 4BX9A 4E2YA 1FJGB 3JWHA 1TZMA 2PKEA 3DT6A 1HT2E 2DQSA 1J25A 1X1DA 2JIPA 3DZ8A 4QQFA 3RIXA 1P5RA 4K1XA 4KUHA 4YRNA 5KVQA 2C00A 4YK7A 4L75A 2BEVA 2QRGA 3Q8WA 4V0RA 3K2IA 3U3KA 4H7DA 1E6WA 1AKRA 2AR9A 1TZBA 5LOVF 2XUKA 2BN4A 3WYEA 3H97A 2G2SA 1P60A 4RY2A 4LGCA 4YYEA 3OKCA 4A2QA 4C29A 1KAEA 2CLCX 1YTUA 4PGGA 3RC3A 1U8UA 3V7FA 5DYIA 1Z6GA 3H9UA 2Q2QA 4C3OB 3H1TA 2QDKA 4EVSA 1WG8A 2PD6A 3PNMA 1APBA 1WHSA 3LCUA 4YWJA 3L0SA 4LZPA 5BMOA 4QICA 1Z2OX 4HQOA 3HU3A 5J2TB 4WKCA 3Q7IA 9ABPA 2F62A 5TV2A 3I73A 3ZG6A 3DOOA 1IN4A 4WA8A 1MP0A 3PX7A 3M0EA 1O97C 3GOQA 4YCLA 3DO5A 3LTEA 3A6EA 3ZE1B 1V37A 3C3WA 3OETA 4GP7A 4F4DA 1FL9A 5JAUA 4ZVOA 4AKIA 1DELA 1FNMA 3AUAA 3B70A 4L8FA 1GXSA 4WLNA 5BQ5A 2H48A 3L93A 2L82A 4IILA 4O4JF 4QVGA 4HH0A 4D8YA 3AJAA 4JGGA 4Q9IA 3FNBA 2CLOB 1OGJA 4EDFA 3SM3A 1TF5A 1DJMA 5ICMA 4AECA 1P3DA 3FVQA 3O4RA 2JAXA 2ZLBA 1ECFA 5ITWA 5JXJA 1PFGA 3R5TA 1JLHA 1OX4A 3EVGA 3HBJA 1IQRA 3EMDA 4HDKB 4LFBB 3EAQA 2YFKA 3CLTD 1KK0A 4RZIA 4K8OA 3CGGA 1A98A 2XSZD 3LSTA 2WPNA 4M87A 3GXOA 4W9RA 7ABPA 1ADCA 4GOLD 2YN4A 1IB6A 3WK7A 1Y8CA 4FTWA 2XMSA 2YICA 3WGTA 4EI2A 1DPFA 4OHFA 3O8NA 3WLAA 5ERGB 2ZU6A 4LHZA 3RKUA 1WB6A 1CHNA 4F60A 3WA7A 1BJTA 2C59A 1KRWA 4A5OA 2JGNA 4ARIA 2PQ6A 2RHHA 3PIDA 5BMVB 1CR6A 3I0MA 1JAHA 1H85A 3HKCB 4IJVA 4KXYA 3WIBA 4C4TA 4AZVA 2RDMA 3UJDA 3KOOA 5EHNA 3MUEA 4C6RA 3LPLA 4WFQA 3GYBA 3O94A 2GRJA 1M1NA 5IBCA 1CHDA 2VP5A 1PJ4A 2VWPA 2WSSD 3MJTA 3LGAA 2X0IA 5T4HA 4CBVA 2CN1A 3LCMA 1P4GA 2QBYA 4E22A 2IEAA 3GZ4A 1QG4A 3JQCA 3DO8A 3AW9A 3AIMA 4IDCA 4QELA 3QHPA 5JSFA 4QGSA 2OV8A 3LM8A 1L4FA 3L82B 4FBMA 5TVGA 1CUZA 4MUEA 3MBIA 2CXRA 3I1FA 2AYXA 1J8QA 3PNKA 4LJAA 4UCXA 3B8EA 4EABA 3M3HA 4Q00A 3OCYA 3ZQUA 3RARA 4UUQA 1RKQA 2OP1A 1NQVA 1XDUA 2LBPA 3JQQA 3TBFA 4MKGA 4A91A 4AF7A 1TUIA 2C3OA 2ZFUA 4JYAB 2OGWA 4PIPA 1TYDE 1J09A 1UOOA 1PDOA 3NIFB 3EPKA 1TA0A 3H2BA 1XZBA 2G25A 2VXYA 5KNLA 2AQIA 3SXUA 1SNYA 4PVCA 1DT5A 4KDFA 3HVKA 4QFMA 4IDAA 2WINI 4X1IA 1MH9A 3CBQA 3HXLA 1WF6A 2Z0MA 4A16A 4I0WB 4Y6LA 1XVVA 2ZYHA 1PT7A 3ASVA 4M88A 4EJSA 1BWPA 4EUFA 1V45E 1XD2A 1ZQ9A 2VPYA 2WSIA 3OOSA 1EXWA 1P91A 1MGPA 4MVJA 4N7RA 3TLZA 3ED5A 2DWQA 2G8NA 4AJPA 3WA6A 3EWNA 4IIUA 1Z5GA 3K31A 4MITA 4OGLA 2RGUA 3OWOA 3R8CA 3ZDYB 3P71T 4TX1A 1NYRA 1YR6A 2VK4A 3M6WA 2HBZA 2BMVA 3WNZA 4A8JB 1AVTA 2YZ2A 2O5RA 1TIKA 1VPVA 1DBIA 2PYDA 2PVSA 4BX8A 2YXEA 4EPRA 2EW2A 4P0QB 1YFZA 4AROA 2ZUEA 3MCVA 3OCXA 2P0EA 4EW3A 4PQYA 2QPAA 3G5TA 2Q21A 2BMFA 2F48A 3E81A 2IE0A 4KQ6A 3PYMA 2IP2A 2VP3A 2ZB4A 4DNQA 4YRBA 2FVXA 3NIGB 2I1VB 4IFEA 1MGOA 1NLMA 4F6RA 1M7GA 3BBLA 4KR7A 4RCYA 1RXCA 1KFKB 2GEUA 1JBKA 1E1LA 2QN8A 4TLAA 5FOVA 2BYTA 4AZSA 1SIBE 1UXHA 4EITA 4LGYA 5FR1A 1F5NA 1JSXA 4EYOA 1V5GA 2XMDA 5FADA 2ZTVA 1X7WB 3LQYA 3NJ8A 4WX2B 3WR5A 1BSVA 1TW3A 3IAAA 5AKYA 5HPYB 4XWYA 2Q6VA 1O6ZA 3KKKA 4L57A 5IUKC 1XP5A 3CUEF 1NVVQ 1QGYA 3NO4A 5KS2A 5A3JA 3HXQA 3HJAA 4N0EA 1DBWA 1YFLA 2HLHA 3PQDA 1WTAA 1RMYA 2FFAA 4KWHA 4ATNA 3ZWOA 2JFUA 3BA1A 3IPYA 2O14A 4GEGA 2PGLA 3MB8A 1XR3A 1TT5A 1XHFA 1KJ8A 3KJNA 1AE1A 1KI6B 3QE0A 4OU5A 1T2DA 3O8BA 4RGYA 5AHWA 1AKQA 4J2OA 1GSIA 2BFWA 2YQ5A 3H8VA 4MGIR 3M6MD 3MIZA 1ADFA 1BIFA 1QS0B 3WWYA 2W6JA 3WC4A 2C20A 2I4RA 4U7DA 5LYYA 2A4KA 2VLIA 4KVGA 1DQZA 1KMIY 1I94B 2GPWA 2DQKA 2Z2YA 3A7DA 1UM9A 5KTMA 2Q6LA 2Z1MA 2ZQZA 3LUDA 4NECA 1ZA1A 5GGYA 4YUVA 1JG2A 1DJOA 3HB5X 5B3JC 1N5KA 3WV4A 4JC8A 1D2RA 3UY4A 4JKYA 4QBFA 3VR2A 5JYEA 2XNKA 4JT4A 2QD5A 3A4LA 3EG9A 3UPUA 1H6AA 2HCBA 2ZI5A 5H9VA 3E9NA 2G1UA 2B30A 5IVIA 4DA0A 3RS9A 1SK8A 2GN8A 2ZRAA 4MDYA 2H9AA 2XMGA 4MWOA 4ZVKA 5IAEA 1RWMA 1GSHA 5TC4A 4BFWA 5HRAA 1KEUA 3PSHA 4C1NA 5JAMA 3SQDA 3KTFA 3MHPA 3PHCA 1KHHA 5K8IA 5AM1A 3TB6A 4B9EA 2AJBA 3C1OA 3HDJA 4DV4B 1DUVG 3NRCA 4FJ1A 1C8LA 1YFJA 1KQOA 1M6YA 3F47A 3SBOA 4TXMA 4KSBA 4GO1A 4DCMA 4HOYA 5CLFA 1JL3A 1Q0PA 1GU0A 4G5SA 1MRNA 2ZKLA 3I37X 2C9ZA 2NO6A 5F21A 3RS2A 1WOYA 1TMKA 3SGLA 4KIWA 4RTKA 5EXPA 3BGVA 5T4FA 3RSLA 1MOZA 1VCNA 5WRFA 6NULA 1XDZA 1UK6A 5EHQA 3K1AB 1D6JA 3V1LA 1L5MA 4EJ2A 4DV3B 1X1QA 3VR5A 2YYSA 5G0WA 3OLWA 3IPCA 3KWJA 2E49A 3PA6A 4UATA 5HKKA 4G5RA 4E7PA 4RF5A 3TNJA 3IT1A 3KLOA 1TU3A 4X90A 3QYFA 1G7TA 4OGFA 5CLGA 4CM5A 1P2TA 3BXOA 3IQIX 1V3TA 4RVFA 3E5NA 4JEMA 4QYTA 3GWZA 4BNMA 2DVMA 3QNMA 1EWTA 4PYLA 1KSFX 3U4QA 2FWIA 1BD4A 3IIKA 2GTPA 4TT3D 1EVJA 3W8FA 5IAOA 1OZFA 2AC4A 1NFRA 4RTLA 1DCTA 1BFUA 2JGDA 2QR3A 2NTJA 3U4DA 2BMWA 3VYUB 3FG9A 2IYNA 3CLSD 4QPCA 1QONA 4ZHQA 1FQOA 2H4YA 4JXJA 4R51A 3TRHA 4BTEA 5LFAA 3TDNA 3EIWA 2YUIA 3EYAA 4NZZA 3REQB 3UWDA 1FDOA 5BN4B 1SZPA 1YOVA 1FE8A 3DVLA 1VQ1A 1H6CA 2R6AA 3NEAA 4W9NA 5KHOC 4Y1EA 4UDNA 3U81A 1VCHA 4ZTBA 1H0HA 1YQGA 3FVWA 4KMSA 1YGPA 2AN4A 4BCBA 1U8EA 5FP0A 4C3ZA 2ZSEA 4C76A 4J2HA 2ADOA 2PE5A 5F7XA 3LRPA 4ZODA 4ZJUA 1P5HA 4BX0A 2BGLA 3MXTA 2GTHA 5J58A 3F96A 4NP6A 2BFMA 3BE8A 3E3MA 3WRXA 4NYMR 4A5SA 4PLYA 1VG1A 3IIIA 4AN0A 4X8MA 2CLLB 5H3CA 1L5KA 1XEXA 3ZDRA 1GZUA 3ZD6A 3FZEA 3JQ8A 1YWGO 3C4QA 1Q74A 2WZQA 3IALA 4RD2A 2BC9A 2H1VA 3PUXA 2QTNA 5ALUA 3TE6A 1JEEA 4IR7A 3WBJA 2FUG1 1N6PA 1ZR4A 4L4UA 2OCDA 4JBGA 2F9LA 2FEKA 4U39A 4XLZA 3IT3A 1KK3A 1Y1SA 2CL7X 2X7XA 4RA6B 1UBJS 2O7NA 2E6UX 3NKVA 4O4IA 5DNCA 5DFAA 2FETA 3SR4A 3IL2A 1K2VN 5ENDA 3G7NA 5EXDA 2G4VA 3V1MA 1ACLA 3UA4A 3C1UA 9ATCA 1MX1A 5C80A 2VR1A 4LOHA 1VE5A 3FTFA 1MW9X 2CYBA 2R1UA 3DMFA 3OQBA 1FUYB 4JH0A 5IAAA 3IA7A 2HLNA 1JIJA 2CVFA 4C4RA 2ZRFA 4RIFA 2OHXA 2X0NA 4ETIA 2F8TA 3COWA 2YYZA 4AZ3B 4IUYA 4ZCIA 2M6RA 3K53A 4C20A 3JD3A 2PZEA 4PX3A 4YO7A 1KWGA 4ND4A 1LLUA 5BV1A 1L5HA 4OJKA 1DTEA 3DV2A 3DA8A 4QPPA 4LDQA 4X95A 1NRWA 1E1DA 1IE3A 2IHBA 1MO3A 5A1TA 1R2QA 2RH5A 1K4KA 1SELA 4O6VA 3UV3A 2Q5LA 4GR9A 4UFNA 2PSSA 3QFFA 1P1IA 5AHXA 5IVHA 4MAFA 4NTZA 3AC0A 4N65A 2VPPA 4ZOBA 3B6EA 4Y0NA 1K8QA 4IGIA 4MJ7A 1ZDMA 4LDRA 1NVFA 2Z5GA 4RZHA 5JS2A 1M10A 2HEIA 1UK8A 3CRVA 3SBEA 2HWXA 4B3IA 3BIXA 1G8FA 1F14A 4MUHA 4I4TB 3WICA 1CUUA 1CNFA 1M6VB 1NUHA 3NB0A 4DQLA 4E4TA 5CFOA 2BEUB 5BT9A 3UVEA 1GTZA 4K46A 3KZMA 3BJIC 3FNQA 4O5OA 3ES9A 1TXGA 1JR2A 1Y63A 2GN0A 2UYQA 1C1DB 2X5XA 3KTDA 3IJRA 1DAMA 2ODWA 3NHZA 1UWVA 4GAEA 5H68A 5I7UA 2IDKA 3C3JA 2GF9A 2OV1A 1HQYE 4DIOA 4RXUA 4ALMA 5L51A 5TNXA 4DWVA 4ZZ1A 1T91A 4HFMA 1BEZA 5JVDF 4JI2B 3P9NA 4R8LA 4X44A 4PC7A 1GQRA 1JI3A 3EZ6A 3Q7TA 3WAKA 1T0PA 3L6DA 4ZOAA 1ZSVA 1I14A 2B9VA 2FPLA 3LT1A 3LVRE 2FQ1A 3G6KA 4PHGA 4ADSG 4DSUA 5JWRA 1XPUA 2CDRA 4MCIA 2XSZA 2H4WA 2PZGA 3LT0A 4HADA 4CMGA 1C7IA 1U0OC 2X5KO 3K0KA 4MR7B 1TJ4A 2FPGB 4OJYA 1TQ4A 1YB2A 4ALKA 1CIVA 1BDMA 1HQKA 4DEVA 4CODB 2F8SA 2J4DA 1FDTA 3OQIB 2VUIB 4PYRA 2HMTA 3JYOA 1ZL2A 5D3QA 5AK3A 4IJ6A 3ZY4A 2JBHA 5K20A 3O8DA 4MVJF 1GCGA 4O2RA 1G20A 5E38A 1ENZA 5HX7A 3AHHA 1N2ZA 1XCJA 3N39C 2PN1A 4J8PA 4PZCA 1KAOA 5AJZA 4HAIA 4OEHA 3SQMA 4BIMA 3STVA 1TZCA 2VBFA 3V1UA 2GZMA 1P1KA 1OIXA 1VXRA 1YQQA 2WYVA 3HKBA 3SIRA 4TRMA 4GL2A 3DHVA 2JFVA 1NJ2A 4LGVA 1KU6A 2WSSA 4D6YA 3RPEA 4U02A 1ZO8A 1AQ6A 1IYZA 3M4JA 4EY4A 3DMDA 3PT9A 1JHZA 1VL8A 4A8JC 4PZAA 1WBJB 2IIPA 2X0JA 2IYOA 1JYSA 1PS0A 1DC7A 2BBTA 3DOJA 1WRBA 5DSXA 3ENKA 5HDQA 5K8VA 2IBTA 2IU6A 2XCRB 4BAGA 4PHTA 2H1IA 4H08A 4KO2S 3ANSA 1LS1A 1R0WA 4ZAZA 1L3CA 1BXZA 3AH8A 4EHJA 4I3HA 2I91A 3AY0A 5FNVF 1BE6A 3AXSA 2ADMA 3UAWA 4J2TA 4GMHA 4QU0A 1IEWA 3PXGA 4XEHA 1G7RA 4YQZA 4PBSA 2VJMB 1KEVA 2V6BA 1CR4A 4G1CA 2G6TA 3RHZA 4AC9A 4KU4A 2JAOA 2Z6VA 2GZSA 2YN0A 2WABA 1AKUA 1YZUA 3FLEA 3GA5A 5TE9A 4NMWA 1HZJA 2R00C 2NU8B 5KX5B 4LYFA 1HM5A 3D3WA 4UVDA 1RXVA 4QBIA 2GR9A 1ZZGA 2H7YA 3HQ4O 4I9HA 4HR7A 3SS9X 5L3VA 4BQIA 1T5LA 2C83A 1TTHA 2HQ1A 1M1UA 1LRLA 4R7ZA 1CRZA 1ORDA 3SG0A 2DBYA 3RIEA 3N53A 4UNPA 1DKNA 1YKFA 3FWZA 4AP5A 5DX1A 1ECBA 5DBEX 4M8SA 4LWZA 2DF8A 2GH1A 2WVJA 4LOJA 5I7RA 3CVOA 3GDFA 4LSGA 2G16A 1V16A 4JA2A 3ZD8A 3NHKA 3GBSA 5LNK1 2UZ4A 1C80A 4W8OA 7YASA 2BVNA 3UUEA 3H5OA 4F1WA 1CDZA 2KQUA 1XCGB 3C70A 3EQ9A 3M8KA 4EQZA 1ESZA 4HGQA 3U09A 4G26A 1XAIA 1DTWA 5L3QA 3PDJA 3E9RA 3QV1A 5DLDA 4D4LA 1UKEA 1VLZA 2PSHA 5IN5A 5F78A 4LF4B 5HR5A 3IC5A 3MD9A 1THZA 1FLVA 4D9MA 4DF3A 4JLMA 3KAQA 4LZJA 4FOLA 4DLSA 4QO8A 3AX6A 5J5AA 5I9NA 3KWMA 3PCRB 2HU5A 3GGJA 2E89A 3K0AA 1GLNA 1N5JA 5B2ZA 2GFHA 1XUOA 1UFKA 1VIYA 3CIFA 1OBFO 2GHQA 2QVYX 4TYNA 1Z07A 5K3SA 1XZMA 2B21A 4F5ZA 2VH5R 3M9XA 3HLYA 3UPDA 1T1SA 1CUHA 4JU9A 3PPYA 1XG5A 2BBSA 3I4LA 3FRJA 4ENWA 4TKZA 5EUBA 5IK2D 3ZCQA 4X1YB 4X9XA 3ZS8A 1CF9A 2C2XA 1MX9A 2HHAA 3B3FA 1TADA 3BIFA 3W8DA 2C8VA 2C7GA 4CVNA 2P0YA 3K8YA 2V7UA 1HL7A 3G5MA 5D7NA 5KHAA 3JWIA 2HRCA 1NLZA 3I04M 4Y2UA 2R1ZA 1CX9B 3EYWA 3UUWA 4TGLA 3PQ7A 1HXHA 2PZAA 3A4VA 3OOHA 5BWOA 1EDZA 2WE8A 1NBIA 4ZCQA 1ZEMA 2XQGA 4ZPJA 4Q93A 4XAQA 4L07A 1YNSA 3H2GA 1U4OA 2XQKA 4B3GA 1XTUA 3CN7A 3FFTA 2PKCA 3ORFA 4NBKA 5IDYA 2GN6A 5K3AA 5T6MA 1G2PA 2I34A 3FAKA 4CFZA 2FPUA 5EJ6A 1Q0ZA 2OOKA 3CZ4A 3I8OA 4LFCB 1IXKA 4YN3A 5A5FA 5K8TA 4EAQA 4FT4A 1F4LA 2BEWA 5SYMA 3GLHA 2DB3A 1JQ3A 5IZ4A 2OUIA 3IA2A 5ISMA 1RRPA 2GJ8A 4MYHA 4IGFA 2XVAA 4NAUA 2IYQA 4RM3A 4DV5B 5CPBA 1O0CA 4ZHQF 1J5XA 2J4CA 5CHYA 2ODQA 5H4GA 1MBZA 4ARZB 1OLOA 3WQSB 5I7HA 3I05A 3QBDA 4RTRA 3BCUA 2HU7A 3WZMA 3Q8KA 1W87A 6GPBA 1FFDA 2X6RA 2DPHA 2HUNA 3F6SA 4Q24A 2XADA 3D0QA 3HCBA 3AKYA 4YEDA 3Q98A 4DNFA 2ZZMA 1SQ5A 2W8BA 3N7TA 4MVJP 4ROTA 4ACBA 5JJKA 3KB2A 5TSDA 4BXOA 4I1VA 5CHEA 2D0DA 1RQGA 2H4HA 2IPNA 2PKQP 3RC1A 5IU6A 1PR3A 4U0KA 2EQAA 4KGDA 2ZK7A 1XRNA 2I29A 3P0RA 4NENB 1YC2A 4DABA 3F2IA 2XB6A 3JQ6A 3MTQA 4MDEA 4M38A 1ISFA 3HZRA 2V65A 2XPCA 3IT0A 4BASA 4YT4A 4X00A 3JWJA 5JE8A 2RJOA 3EH2A 5DHRA 4BP9A 4MHTA 4A7PA 2GKOA 3LRXA 4RJKA 2FEWB 1QQBA 3U3MA 3WBFA 4L0DA 5K1ZA 4BQQA 3SBXA 4L3OA 5FUQA 2WF8A 2Q5OA 5B1IA 4GOJA 2NZWA 4Z4IA 2FZEA 2V7QD 3L41A 1T29A 4YAJA 3TSAA 5CBPB 5KMGB 2F43A 3NS7A 3O8OB 5JECA 4GX5A 1QH1A 4NOLA 1BKDR 2I8CA 4Q1EA 3J80A 2UXCB 2DPYA 1BHJA 1BVRA 4O4IF 1I0LA 1EVQA 1JRLA 1QIIA 3KBBA 5HM6A 3GUVA 3K3PA 3KFLA 2C99A 4RGVA 4TT3A 2VZ9A 3AB8A 1AB6A 3QU5A 4UFPA 5KSOA 1NBMD 3GUZA 3BXHA 2F1RA 2VNIA 4R9UC 3W2IA 3JATA 13PKA 3R7LA 5C53B 5T6BA 4FFSA 4KIGA 4BLQA 4D02A 3AVUA 1FPMA 3EEFA 1R6BX 3L8MA 2I2DA 1E6EA 4G4SO 2C2OA 4KGZA 4L2IA 4OUDB 3UW1A 2WC1A 3DKPA 5KVCA 1NW7A 1WXEA 2HGSA 4X7RA 4R7GA 2OA0A 4FYYA 4G4SP 4JP8A 3L5KA 2AOUB 4Z3DA 5JD5A 3DM9B 1QB8A 3ISVA 3LOUA 2KS6A 3LUKA 4O1IA 4PWZA 4QEZA 4CZ2A 2X3YA 3FYUA 4QU8A 2BZSA 4EVRA 5M34A 3PNPA 4WBSA 1MB4A 1MEOA 2REXB 4RWEA 5C9ZA 5KYGA 1RS0A 3C7KA 1SG0A 3T9DA 1EX7A 3U3XA 1DUIA 1GQQA 4W9MC 4YQYA 2ZI4A 1FUIA 4WI1A 1Y1RA 5ELMA 3TFWA 3MINA 4L6IA 4Y2XA 1GTG1 2CFRA 4CHTA 3E6AA 1E32A 2ERYA 4YLEA 2VAMA 3AEQA 2QQFA 3ZY6A 4GWGA 4ZCMA 1NJ8A 3DVAB 3CF4G 3UIEA 1JE0A 4BGEA 1GV1A 4MP8A 4CV1A 2J4FA 3EZYA 4NHEA 4G5FA 3C15C 4M1EA 5B5SA 4FFBB 4K6FA 1QZ3A 1KNQA 2FUCA 5G53C 4H1UA 2VJKA 1YRLA 3D43A 4G5YA 4JJAA 2MHCA 4TWIA 3USZA 1VLQA 2Q99A 4M0LA 1T5DX 2FY8A 4QYIB 3SJCA 1FUKA 2DHEA 1D0IA 1MO4A 5ER6A 1RJ9B 5IN4A 2KSQA 1R50A 3TZKA 1I7DA 1U2GC 2J0QA 2J6CA 4UOZA 1UPBA 5GVSA 4IIJB 4CL3A 5LU8A 5TS2A 4H0FA 4KACA 4NLLA 4AJJA 4DIBA 1YS6A 1MD9A 5LU9A 1K7FB 2C4KA 4INPA 2DLCX 2UXBB 3QP9A 4MO9A 4MQ5A 4IPTA 4YRCA 1W52X 3IT2A 3V2HA 4HVTA 1Z0FA 1UT6A 2FMFA 3A6PC 2XUDA 2AMLA 4JL6A 4R1UA 2ZXEA 3MW8A 2AIRA 4TZTA 2O57A 2AYZA 1LGYA 1JJFA 3OKPA 3BWDD 2EBWA 1J99A 4UVEA 2QQGA 2H57A 4BLSA 1TQDA 4GVLA 3NAZA 1HBJA 1O96B 3JQDA 1DINA 4GYYA 1J9ZA 3P2OA 3K0FB 4KOAA 4PSUA 4R81A 5IM5A 2CZQA 3GCDA 5L3ZA 4MQFA 2PZBA 3D1LA 1K97A 2V45A 2PUWA 1JQJC 5EZ5A 1N8KA 4B0OA 3CUVA 4I1RA 4LOKA 3L7AA 2H1WA 1GNRA 1WHTA 3D0RA 2XYPA 3PJFA 4B7AA 4HUTA 2AD1A 2FWRA 1SVUA 3WSVA 3CTPA 1GJRA 3WHIA 4BNFA 3LCCA 1QZXA 1F2DA 1ISIA 3TLKA 1OC2A 3WGYA 2E1RA 1GAQA 4V0NA 4WERA 5JOQA 4X93A 2ZSJA 3KZKA 2DBVO 3M6UA 5JG7A 2W6OA 2Q0XA 1KOLA 2QRPA 5IDWA 4CLHA 1RYFA 4ZEVA 3LHKA 4ARAA 3FOEC 1NRIA 1MZVA 1PI3A 2VCHA 4J1TA 1AZTA 4IIEA 3MF4A 4P7JA 4W7SA 4W8GA 2YJTD 1CU1A 5A4IS 3WNQA 2VK1A 1IWBB 1KIMA 1DXYA 2VJNA 3MGKA 1JEYB 4R69A 2DFNA 1QB7A 3NYIA 4IFTA 1J9GA 2VCYA 3HCNA 4I19A 2JH8A 2WFLB 3AB7A 1VA5A 2P75A 1WY7A 2JKYA 2P8JA 4CMIB 3RG8A 5HQ3A 1LLDA 5DM70 1SVWA 1NM5A 1Z34A 2ODBA 3DE7X 3FLBA 2QN7A 1KI2A 1QLHA 3DFFA 3PJEA 3X2SA 3OE5A 1W0KD 1EU1A 4UPVA 1LK5A 5LWQA 2FFQA 4Q16A 3RHFA 3DZIA 2WILA 1ZM2A 1MEJA 1Z62A 1ZAKA 2CDAA 2NT3A 2WYWA 3O93A 1NVDA 4BJ6A 1B0UA 5BXYA 5JBNA 4YJGA 5C4IA 1AK9A 4RVSA 1U7TA 3OPYI 5HF9A 2AFRA 3TIVA 2OE2A 1NN5A 1P4RA 3G9XA 3OQPA 4ZT5A 3R6WA 4C06A 1ENPA 1Y4AE 3FPSA 2HDNB 3OPVA 2GAIA 1JWAB 4P4GA 4REQB 4K3UA 1G6HA 2XW6A 1A8PA 1N1MA 1CJTC 4DLVA 5DBGA 4YCCA 4XDZA 1I1NA 1WDWB 1AURA 4F5DA 2D2IA 3OFVA 5KSZA 2V55B 1EFVB 4OI2A 4UM9D 1KZGB 3TKYA 5DH9A 2HPAA 1W85B 1TJ3A 4X7MA 4UW9A 1WVMA 5DM2A 2IDMA 1JAYA 2QP3A 5D3MB 5IAGA 1STOA 2GK3A 4PZDA 1PIWA 2WT9A 4ZT6A 2ZYVX 2ZS7A 4QSHA 4D25A 5EMHA 2W2KA 2VF7A 5E6RB 2FZCA 1E0AA 1SKYE 2HIAA 2H7CA 1Z6TA 3VYSB 5I4KA 2BH9A 4EO4A 5B53A 2JLUA 2JIRA 3RYFB 3WK8A 4D96A 2IU3A 4JQSA 5MFPA 2RG7A 1WB9A 2G06A 3PC6A 4PG7A 1SWVA 4GC9A 1LRJA 3C5WP 5JASA 1JJIA 2EG5A 1R5NA 1CUVA 3LO8A 4L7QA 2VAWA 2WB4A 5KYUB 1AO0A 4D45A 3C7CB 2NIPA 2BGRA 2C1ZA 4BLPA 1OXMA 2HA4A 4KVZA 2HF7A