2A84A

Crystal structure of a pantothenate synthetase complexed with atp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
277
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantoate--beta-alanine ligase
publication title Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 88
structure length 277
sequence length 287
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a84A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a84A01
4K03A 3ZXIA 4ND6A 1F4LA 4MVXA 4P2BA 4EG5A 1GTSA 2YY5A 2A7XA 5DB4A 1JIKA 4MAFA 3RHSA 3DO8A 3SEQA 1Q19A 1N2HA 3COVA 4FZJA 2C5SA 4DDHA 1G8FA 4HJRA 2V0CA 2A1TR 3N2YA 5IHXA 1O97D 1EXDA 1NYLA 5DASA 4MW7A 4A91A 1WJGA 1I6MA 3LE8A 1O96A 4MWDA 1QTQA 4KR9A 1WQ3A 5H16A 2G36A 3FETA 4CDNA 2WB2A 2X3FA 1PG2A 4MQ6A 4XFDA 3CLRD 1NI5A 4ARIA 5F23A 2ZP1A 3CLUD 4I6GA 4MW2A 1YULA 2H2AA 4ZT6A 1WXHA 3NV7A 2XRYA 2JANA 5TEVA 1JILA 4JXZA 3AFHA 3Q10A 3SEZA 1IQ0A 5J59A 1RQGA 1M8FA 2PZAA 3AL0C 2VTBB 2HGZA 2E89A 2DXIA 3TZEA 3TZLA 3HFJA 4YP7A 3ND5A 1F7VA 4QRDA 4ZT5A 2WSIA 3COWA 3QE4A 2EL7A 3HL4A 4OUDA 4MUJA 4MW1A 3VRHA 1IRXA 4MW6A 4ZCPA 3SYTA 2BYTA 3ZGZA 1KH1A 1XNGA 5DK4A 1O94D 3FY4A 3P0JA 4Q93A 3AG5A 2B7LA 2TS1A 3Q12A 3LCJA 4MUFA 4RPIA 1WOYA 2QUJA 3PNVA 4UZEA 3ZIUA 4EF6A 1U7DA 1COZA 1J70A 1WY5A 1R6XA 1O95D 3CLTD 1T9GR 4KR7A 1N78A 4GRIA 2CV1A 4DNXA 5KHAA 4E1AA 3RK0A 1T6YA 1P7PA 1ILEA 1M83A 4JXXA 3ND6A 1J1ZA 4U63A 4MVCA 4AQ7A 3MLBA 3IMEA 4KR6A 3LOQA 3IOEA 3IOCA 5LLTA 2WQ7A 2YXNA 2DEUA 1QRSA 4PY2A 3HMQA 4NDAA 3CVYA 3UOWA 2H29A 1D2RA 2A1UA 3S3TA 3SZ3A 1EFPA 3L93A 1FYDA 4JZYA 3X1MA 2X0KA 1QNFA 1O96B 4YMIA 5EKDA 4ARCA 1QU3A 1N2JA 3IVGA 2DUMA 4MUKA 2AG6A 1I6LA 3A2KA 3BL5A 1M8KA 2IP1A 1LW7A 3IVCA 4EG4A 2DLCX 4DDKA 1T9GS 4X0EA 2QJTA 2PFSA 1H1TA 3CR8A 3IODA 1LI5A 4MUNA 4MW9A 3PNYA 4JFAA 1VBNA 1VBMA 5H7XA 1KKUA 1KQPA 4K0RA 1JECA 1TYCA 4NX2A 3C8ZA 4R2LA 3HV0A 2GKSA 2NSYA 1OWPA 3UY4A 4ND7A 1NURA 1TFUA 1JGTA 1IH8A 2CV0A 4S1OA 4MWBA 4ZCQA 3NBKA 3AKZA 1VLHA 1O97C 4MUHA 3FNRA 3L92A 3IOBA 2PZBA 4ZCSA 5J5AA 4NAUA 1BS2A 2QJOA 4OUDB 1ZJWA 4QREA 2V0GA 4CT0A 1YI8A 5KWVA 3TQOA 1GPMA 1KR2A 1N75A 2D5BA 3QTTA 4NAHA 1YUMA 1NUSA 3PRHA 1LI7A 2X1MA 4EG7A 4NZPA 3ISJA 1QU2A 3CLSD 3AG6A 1JZQA 1MAUA 1YIAA 2O8VA 3CLRC 4EG1A 3SZGA 2X1LA 3CLUC 1F7UA 3A05A 1JIIA 1G8HA 1MAWA 2E21A 1H3EA 2J4DA 4OJMX 4Q16A 5FNZA 2IJGX 2D54A 1UFVA 4EGAA 2J09A 4MW0A 3CVUA 1K4KA 4MW4A 1N2GA 5BNZA 4U7JA 3DLAA 1IHOA 3G59A 4MUEA 1EUQA 4G5YA 1YIDA 3FIUA 1OWMA 1XNJA 1WQ4A 2A1UB 1NZJA 3SDBA 3CVWA 1EFPB 1O94C 3P0HA 4BWVA 3IMCA 1DNPA 4ZT4A 1U7XA 5HUJA 1N2EA 3FDXA 2Z3VA 4ZCRA 5TS2A 4I6EA 2GM3A 3IDFA 3CLTC 2IELA 1O95C 1QRTA 1MBZA 1N2BA 3KT8A 1A8HA 3H05A 4I6JA 2YWBA 4EFKA 1JZSA 2ZUFA 1KQOA 1MB2A 3OTWA 2RE8A 1N1DA 3X1KA 1IQUA 1FFYA 1M8PA 4QBTA 4PBTA 1R6TA 1S4MA 4R2MA 4PBRA 1CT9A 2XRZA 4ZCTA 1IFXA 4MVYA 1OD6A 3GMIA 3E27A 1SURA 1O6BA 1YUNA 3TNJA 1N77A 4H3SA 3JXEA 2A86A 1JEEA 1OWNA 1HYBA 1O0BA 1Q15A 2CYBA 2J5BA 1GZUA 3MLAA 3CVXA 5AHWA 2DR2A 1PFYA 3FWKA 3DV2A 4J75A 3HGMA 2EJCA 4YBRA 4JYZA 2A88A 5KCMA 2Z09A 2QJFA 1K4MA 1B6TA 1X6VA 4L2IA 2OQ2A 4MWEA 3K32A 5K0TA 4NATA 1NSYA 3FH0A 2QTNA 4ZT7A 3FI0A 1GN8A 1R6UA 3ZUGA 3UK2A 2CYAA 4YP5A 1Y42X 1WZ2A 4RUKA 4MWCA 3ND7A 1KH3A 1EJ2A 2YWCA 3GUZA 3FOCA 5HG0A 3G5AA 2QUKA 5FO0A 1N2OA 3TS1A 3OP1A 5IJXA 1EFVA 3P52A 2BTEA 2CSXA 3DPIA 2QUIA 3N8HA 1F9AA 1PFVA 1VL2A 4J76A 4KPUA 1TQ8A 1U3DA 1PFUA 4WNYA 2QTMA 4TS1A 1VBKA 2HMAA 2E18A 3F3MA 1WXEA 3IVXA 3N05A 4ZT2A 1ULHA 1WXFA 2E0IA 3CLSC 3RFFA 3VU8A 2I1LA 2A4MA 3MUEA 4WSOA 1GTRA 2J08A 1J09A 3A04A 3CVVA 1JIJA 1KORA 1T6ZA 3ELBA 4UZFA 1MB9A 2PG3A 4DE5A 1PG0A 2RD2A 1M8JA 1V47A 3U1VA 1ZH0A 1NUPA 1K92A 1XNHA 1K97A 1MRZA 5TGTA 1QRUA 1J21A 1H3FA 2DETA 2NZ2A 2CYCA 5DEOA 2OV4A 3Q4GA 3COZA 1KQNA 3KT6A 2D13A 3ZJVA 1NUUA 4YP6A 1OBCA 2QTRA 3TQIA 1KAMA 3RBAA 3SP1A 1U3CA 3IUBA 3MMXA 4L2IB 1IVSA 4HJXA 1EUYA 1QJCA 2Z08A 1JEDA 4MVWA 1MC1A 1NP7A 3KT0A 4MULA 3N9IA 3ZXSA 3GLVA 4DLPA 1J1UA 1NUTA 5LM3A 4KKVA 3ZJUA 2HZ7A 3RJZA 5JBNA 1G59A 4AS1A 3QTBA 2O5RA 2PIDA 1WKBA 2A1TS 3IH5A 3H99A 3PNBA 4F3RA 3COYA 1O5TA 1EFVB 1TYBE 4ZT3A 1O0CA 1KP3A 3P0IA 1KP2A 2CFOA 2JA2A 4KPUB 1ZUNA 1GAXA 2DPLA 1J20A 2QUHA 4G6ZA 1TEZA 4DJAA 3UMVA 4DDMA 3H9BA 4F4HA 1I2DA 3VGJA 4MLPA 1V8FA 1MOPA 1TYDE 3D6VA 4XSVA 2ZUEA 3H9CA 4U8HA 2A84A 3D6UA 4EG6A 3RK1A 1WXIA 3KT3A 3PXUA 3A4IA 1N2IA 1T6XA 1ZH6A 1I6KA 3UC5A 3ILVA 1Q11A 4CQNA 1OWOA 2CUZA 1U0BB 3H97A 2GOYA 2DERA 5K0SA 1KH2A 4G5FA 1OWLA 3CA8A 2AZXA 3MXTA 3K9WA 1TYAE 1M8GA 2CT8A 2PZ8A 2CV2A 1G8GA 3X1JA 2WQ6A 1X8XA 3NBAA 1JHDA 3I05A 1KAQA 3AIIA 5TEWA 2VTBA 2VXOA 1JMVA 3IMGA 1M1ZA 4EG3A 1WXGA 2AKEA 1IQRA 1QQTA 5J58A 1PFWA 5LFAA 4MUGA 3ZJTA 2PXHA 4HK4A 1NUQA 1EE1A 2R5WA 2JAXA 4GU5A 4PBSA 4R0NA 1N3LA 1OBHA 5HUHA 5FO1A 3FHJA 4XFJA 1GLNA 2J07A 3M5WA 4HPWA 3INNA 4EG8A 3IUEA 3KFLA 1Q77A 4MUIA 3FG9A 1MJHA 4CDMA 4MW5A 3HZRA 1H3NA 3G6KA 1XJQA
chains in the Genus database with same CATH superfamily
4N5IX 1KZYC 1UBJS 3BJRA 2YRFA 3BXHA 4QAQA 4C22A 2JRCA 1NE2A 4L15A 3TOCA 1O89A 2FXIA 3M89A 4F2HA 4AQDA 4HDAA 4DARA 2VJMB 2ZS8A 4BU0A 5FLXA 3U62A 4NH4A 2VUIB 4B6GA 2X4LA 1UKZA 1CZHA 1JIKA 1CR0A 5JHHB 4KPYA 1PS9A 4R8SA 3JQCA 5B2EA 2OAGA 5FWYB 4CL2A 4WZAA 4BVFA 1NHGA 4FS3A 3BH7A 4FFOA 1ODCA 4XD2A 4XCXA 5ALDA 5B30A 3HBAA 4N0PA 4U3JA 3W5UA 3P2JA 2I6GA 1U7WA 2O0LA 3T0FA 3IQZA 4JJFA 1Q0RA 4C0XA 3IURA 1XVTA 3VO1A 5A0VA 1NL3A 2IXFA 3KIPA 1E6EA 2B82A 2HK9A 2X40A 4JHXA 4ZANA 5WRFA 3SLRA 3ZWAA 3RUAA 3OT4A 1L5WA 1N5MA 2HADA 5G1NA 1UT5A 3WIEA 4D3FA 3CW9A 4H7EA 3AEQB 5A5GA 2GEJA 4MP3A 2HBYA 2ZATA 3OAAA 1Z7EA 3HJAA 1JEOA 4MQ6A 5T64A 4A8HA 5EJ5A 4F6LA 3BDAA 3CF4A 5CDGA 1ISSA 3CLRD 1PSDA 2B6NA 1TB4A 1Z0JA 4B4WA 1E8NA 4ME6A 2DFNA 4R1MA 4BQOA 8OHMA 5KSOA 4PS0A 4NZMA 4KXUA 3H8WA 3OJOA 4UEWA 1RXIA 1KWKA 3K0AA 3MTEA 4PCUA 2YC2C 4LUCA 1CB0A 3TZHA 3S8YA 2ONZA 3AFHA 5TQ2A 1RXWA 3GNSA 1M8FA 3KE9A 1UC4B 3ID6C 3F0TA 2DLNA 1MA3A 3EF1A 4YJGA 3HFJA 2WKQA 3VXKA 3ND5A 3E22A 1MXHA 2JAUA 4QYIA 4AULA 2A14A 1H0SA 1JAYA 3CYFA 3HL4A 4K6MA 1LSJA 4JAVC 4M49A 4CVNA 1IRXA 2VF8A 3D8BA 3V2IA 1NQTA 1M0TA 1RM3A 3IUMA 2O20A 2WUDA 3R0ZA 4EYKA 2O5EA 2FP4A 4JOQA 1II8A 3EUAA 5TC4A 1M75A 3LCJA 1TM2A 2O6HA 2Y6VA 1N0UA 5IMBA 4RW0A 3LBYA 3AI7A 4CMBA 1XQVA 3A9CA 1TJPB 1K6IA 3AX6A 2QXUA 1FNNA 3LUJA 4DIDA 4I4CA 1JE0A 2B4TO 1SXIA 1JG3A 4FD2A 2AG5A 3VVLA 5L6MB 3IJRA 3JQ8B 3SPXA 3UHJA 3UFBA 5FA5A 1AQLA 1DBQA 1ULUA 3I4LA 5LYJF 7MDHA 4C89A 1NC3A 2IODA 4JXXA 4F5WA 4NIMA 1I4EB 2XH8A 3J7TA 3PI7A 3PHLA 3SU8A 2E4XA 2J9RA 2QAIA 1D04A 3IMEA 1IOZA 3A6JA 2O8EB 1VLMA 5CFPA 1XTKA 3S99A 2CLFB 2VHZA 2YXNA 5JH7A 4FMBB 4ZALA 1IN6A 4ZYWA 2O07A 1A96A 3CZAA 3F7TA 3REFA 3EXEB 3UOWA 1XEXB 5JQGF 1SVMA 3A1EA 4S3MA 3IVAA 3DZHA 2EC5A 1Q84A 3PG5A 4IJMA 4JR2A 2BW0A 3GGGA 2PZKA 4G9BA 4YUXA 3QX8A 2NSHA 2WABA 2PO5A 6AT1A 3M2TA 4D80A 2H6EA 2QD3A 4F6RB 2O8DB 2W93A 2YXLA 1X0XA 4WK0B 4M88A 3W5CA 4V38A 2P9JA 2ZSFA 4ZYLA 3KSAC 1GRQA 2ZTLA 3WK9A 4MUAA 2OYCA 3SS7X 1GGVA 3GP5A 1LK7A 3LYLA 4CMEA 3WO1A 2FDXA 3BN3A 1H2YA 5SV2A 3GN2A 6ABPA 2Z4TA 1TECE 3E4CA 4MUNA 1HTWA 1ORTA 2W22A 4MPTA 5H02A 4FINA 3JRNA 2QZ4A 2BFOA 3WB0A 4ZDIA 1KKUA 3HL0A 4CEHB 5DBOA 4MYTA 4EAQA 4MGIR 4YCAA 2IPXA 4PYLA 1QIGA 3CIOA 4OTZA 4R5HA 1PJRA 1QFMA 1TFUA 2AWNA 1H6AA 3D4BA 1PCXA 1Q21A 3O82A 4ZXFA 1EINA 4ABYA 4IBOA 4HY3A 2BSAA 2GERA 1A8QA 3EZNA 1N5IA 1UBTS 3OOEA 4QGHA 4Z7NB 5IG2A 1TM3E 4ARZA 2I4RA 1O1YA 4HXFB 2XTAA 4K7JA 3THWA 5EHNA 3AF2A 3DOFA 2Y8EA 3OZTA 3BRQA 4XVRA 3RM3A 3IV9A 1FZQA 2E4WA 5ALHA 5ALTA 4ZJPA 2WB4A 4M8SA 4HNAB 2BTQB 5AVUA 4ZI7F 2RGXA 3R7FA 2QEQA 3TQOA 5ECYA 3ZG6A 1AQNA 2GUGA 5DHFA 5B2ZA 2L18A 3RWMB 1EQUA 4EHJA 2ZULA 1XTVA 1WSBA 3MERA 2YFYA 3ZD9A 3GLFE 4U2GA 1S1CA 1XC7A 1N6LA 1HM5A 2JHGA 4HQOA 5ELMA 2HMSA 1JZQA 4RCYA 1Y82A 4ZU3A 5BSGA 1FP2A 4I08A 1J8YF 4CEIB 1C7QA 2LWIA 3OJLA 1T3GA 3HKDA 4CKWA 1JJVA 4BNKA 2CNDA 3MCZA 4ND1A 3VSAA 4AMBA 2H85A 4G2TA 4MZDA 4QDZA 1H3EA 4M7WA 4I1YA 1WMBA 4L8LA 2D54A 3DBHB 1OI7A 4R54A 2Q1TA 1MR3F 2E4UA 3F5QA 1VL5A 1KWGA 1LBSA 1K8YB 3HPRA 1C7RA 3BMCA 3KVNA 1BQ4A 3QWBA 4OAOA 3TTUA 3SG0A 4Q3KA 5AUOB 2MOKA 3WV5A 5MGBA 6Q21A 1QVZA 2JIZD 2UYOA 3AOEA 1ECGA 3LF2A 2B4YA 3V7NA 3TF5A 2DPHA 4UJ3A 1QO7A 1KA9H 2VA9A 3RT7A 1VQ1A 4KBFA 4QOHA 2VPIA 1PTKA 2P9TA 3PEVA 3AVXA 2ZU6A 4CMKA 4JMLA 3BKWA 4WW0A 1V5WA 4A2PA 4GP7A 4HRXA 3HRHA 1RQLA 2Y1DA 3OIFA 4ENPA 2FE1A 3TZQA 4NS1A 1IJKA 2FX5A 1XLWA 4IVNA 1EWKA 1T34A 3ZIAA 4I6EA 5A03A 3EGXA 1G63A 1U9JA 2PBLA 1PJ3A 3PRJA 1I7SB 4ZMRA 3JWPA 4RWZA 3RKRA 4O4HF 3B6ZA 5JAPA 4IUCS 3CE9A 5EE0A 5ALSA 3AR9A 3PDIA 2W2NA 1H6DA 2C4MA 3QM1A 5REQA 2H2DA 3GIWA 5LA6B 3GLIB 2J0QA 4C5CA 2OUKA 2IOYA 1XXHE 3IDSA 3R9XB 5DBHX 5E3HA 3JQ7A 3FKSA 4CTNA 2AEEA 4DIMA 1D9XA 3R4VA 1R6TA 1ML4A 2EF0A 3CNEA 4QGFA 4KPEC 5FB3A 5BW0B 5DI3B 4XR9A 4WCFA 1MX9A 1DAKA 5E6UB 2A78A 3QU5A 1NNEA 3NHPA 3TW6A 4C5BA 4HS9A 1D1PA 1CR2A 1MC8A 1VGQA 3EJ6A 4HTAA 2FPGB 3CNOA 2SKDA 4BQFA 2P1RA 4MVJI 1MO2A 3C48A 4IGFA 1Z83A 3VPBA 3R23A 2GRUA 4PINA 1CV2A 4YXFA 1O0BA 2PKEA 3WLPA 2BF7A 4M21A 1MB4A 1ZBDA 4GH5A 2XZTA 1WDTA 4KWCA 2IQIA 4C0SA 2AOUA 5CW1A 4MCIA 3VPSA 3BRSA 1KMQA 2G9RA 3TKLA 2R8OA 5DKFA 3L05A 4R8LA 3CWZA 4UPVA 2QJFA 3LW7A 4HUQB 4B6FA 5SYNA 3RFXA 1IAVA 1M33A 2HXYA 3THXA 1BX1A 2JJMA 4L2IA 4LDNA 1OBFO 3L43A 4J0EA 1WAMA 2PT7A 5CTAA 4HWKA 2NU7A 3SJAA 1VGVA 2WJ3A 2ZKIA 3TOVA 2POQX 1LS1A 1ZVMA 2AEMA 3C4VA 3DZKA 4BO6A 4BKPA 5L4NA 2AQ8A 2ORYA 5AKJA 1ZD2P 3CUEF 2I4IA 4MWCA 2GK6A 2OENG 3RSLA 3VZBA 3TZKA 2W2KB 1XN1A 2LRHA 1N6OA 1WD7A 3JPWA 4TVSA 1C4OA 3UWDA 2DWOA 5F4ZA 3C5VA 1JA9A 4N40A 1K6MA 2MYUA 1U2TA 2WINI 3F6CA 1ZYUA 2QUBA 4W1RA 5LCXA 1TK2A 2Q8QA 1B41A 1VL2A 3AY0A 3RRMA 3WGIA 4RD3A 2BV3A 3DGEC 5ALLA 1T0UA 2XNDD 3DCYA 3A1VA 3F3MA 3LKVA 3UF0A 4JASB 1XMIA 1V5IA 4LC0A 3RAPR 1B6RA 3LQKA 3O83A 4HWSA 5HCNA 1QFYA 1QGDA 3CZ4A 2JS7A 3QNMA 1XEAA 3FXAA 3L7KA 3QX9A 4L9SA 1CUZA 2R8YA 1T2EA 1G66A 3D4OA 3I2YX 4AB1A 2RH4A 4L3VA 1C3OB 2VDMB 1AIPA 3X3HA 4C14A 2AV6A 3HB7A 2O3SA 2HU5A 5IC6A 2QGNA 2Y4OA 5ANRB 3Q9UA 5IASA 1XVIA 1I1HA 3RF6A 3KKOA 3PHBE 4YRKA 3Q8XB 2NVOA 2ZW9A 3I3SR 4RFSB 5EJ9A 4PLPA 1X1EA 2CLSA 1TU0A 2FA9A 3R0VA 5KYVA 4AO7A 1QG2A 2ZSBA 1Z13A 2QM0A 2KI5A 3BHNA 3RT1A 3AVYA 1YFZA 4ND4A 3C4JA 2ZAOA 4E2ZA 2MDTA 4NDNE 3V9AA 2NYUA 2DPYA 1LRJA 3G0OA 4XJTA 4B2LA 3V4SA 2WIDA 3VU9A 4OX9Y 2HC9A 4K1XA 4E22A 2ECPA 2G4CA 3PF9A 2FDRA 2FLVA 1GR1A 4L07A 2VJCA 3AI1A 1K7FB 3OPMA 4S0XA 4WLEA 5T3YA 3T4UA 4E5KA 4FQ5A 5JROA 4LXHA 1MIHA 2EFJA 4BV3A 2QJWA 4YVFA 3NALA 5J63A 1XZCA 3WLIA 4DLYA 4ZYTA 4CHGA 1E9SA 1GL3A 3OE4A 4OMUA 4BTVA 4KR0A 4ABTA 3JQ9C 4JLNA 2QXYA 1ZW6A 4O1IA 1Y1LA 1XRQA 1YS9A 3QYAA 2Y0CA 5CK5A 1YOVA 5C5DA 1G5TA 1YR1A 1P73A 3G8DA 3N1UA 4C4AA 1DIBA 1E3LA 1OZHA 3AEZA 1KMMA 1V8OA 4LZOA 3TJMA 5T67A 3K73O 5MN4A 3A9WA 3GFQA 1ST2A 4AJ4A 2QAGC 4DLPA 1RPNA 3UW1A 3F6YA 4FWIB 4QGBA 5DU2A 2NTVA 3PENA 1J8VA 3CN7A 5DSTA 2OB2A 2XUPA 4BX8A 2FPUA 3K4HA 3IALA 2B8WA 4LZLA 3COYA 1O5TA 1R5BA 2F59A 3A31A 3EEIA 3KLPX 1KI4A 4O8ZA 3WRXC 1TYBE 1AQYA 1OX6A 3CRMA 4NK4A 4DW8A 1G17A 2YFQA 2YYYA 1NW4A 5BQXA 5HPYB 3H2GA 3M3PA 2WQZA 2XCTB 1GAXA 3AHFA 5L95A 3BIFA 3PDCA 4HG2A 1E1CA 1EX7A 4KE9A 3B6KA 4FK8A 4LK2A 4S1NA 2QMHA 4EFLA 4ER0A 3EXIB 3P9RA 4GXTA 2HOQA 1VL1A 2PH3A 1TYDE 5B64A 2ZIFA 2VSQA 1V8ZA 4L73A 1PW5A 1TMGE 3PFIA 4AP5A 5JI2E 1KYWA 3FBGA 1N2IA 3GG2A 4OHOA 2VP5A 3HKBB 3BKXA 3I2KA 1T9BA 1JW9B 2FW9A 3L1HA 3TDMA 3UO8B 4EJSA 2JFGA 3KYDB 3VNAA 4LI3X 3E5RA 3O5AA 1EBBA 2AXEA 2W2OA 2WIJA 2J9GA 2Q2NA 2W70A 2FR1A 3CSUA 4PW0A 1UP7A 1IZ8A 5D3ZA 5A9RA 5LQNA 2O54A 1ITZA 1CUHA 2J7PD 3LSYA 3O7MA 5LQRA 2PZ8A 1N36B 4NONA 4WZAB 1A1SA 1AGRA 3X1JA 4DUPA 2WQ6A 3F78A 2N42A 1QF9A 2OV2A 2CB9A 2DOKA 1DAEA 2X7JA 3PPWA 2GPAA 4KQ9A 4ASUA 2HPHA 1VG8A 2DC1A 2TECE 4EMTA 1Z8HA 4CIYA 1OR8A 5EXTA 3EUWA 3DMTA 1G6HA 2OQVA 3MMPA 3OESA 1PFWA 2KYRA 1JFVA 2RONA 3K5IA 1R3DA 4EL5A 4FYMA 4HQNA 5JRZA 3H9QA 1SIBE 1G60A 4JLPA 1RHQA 2JAXA 2PGLA 3KFVA 2JG3A 1YIOA 5DN6A 1EPUA 1PL7A 1Y98A 3KSRA 1GG5A 4F56A 1YUBA 1RM0A 5TF4A 4QFBA 2C5EA 3EGCA 4LJ7A 1F5SA 4NBUA 4RCZA 5FL7D 5K3AA 3LLUA 1QKIA 1M6YA 3WZLA 1KJ8A 2BR4A 2VJAA 3LCMA 4Q9JA 1XDGA 1RCUA 3O75A 1EJ0A 1R10A 3FDJA 5JY1A 2GBIA 3I9LA 3SOZA 4BCDA 1YQ9A 3PICA 4GBJA 1ZOOA 1FSSA 2AXQA 1RWBA 3OHPA 4JGGA 5ARCA 1J22A 3K96A 1EHIA 1T15A 3SYRA 3DHVA 4O4JB 3ZV5A 3F6EX 1G3QA 3DFKA 2XBMA 1UDBA 5IK2D 1UFKA 2ZCUA 3I1JA 1PDVA 1QO9A 3F7NA 1WA5A 4DLTA 3K0CA 5DB4A 1DBWA 4WERA 5C31A 1MAVA 3KKLA 3KQWA 5LPNA 1AGYA 2VZ0A 3SEQA 3KB8A 3HNPA 4H1VA 1IVYA 4UBKA 5AK3A 1I7NA 1GPUA 3SF0A 1GV1A 1N1GA 2P9QA 1C0KA 1M1XB 2Y2UA 3GJXC 1VKNA 2WAYA 3H2JA 1Y5IA 1OU0A 3QUQA 1RPTA 2EEZA 4FBLA 4ZO9A 1QYXA 3QU9A 5HKBA 4ZIRB 4XQEA 2IE8A 4MW7A 1RLOA 1II8B 1PDOA 4N6NA 1H1LB 4QRIA 2AF4C 3G9UA 3S2FA 1ZD4A 3TIVA 4YRBA 4P0QB 3WHKA 5IJ9A 3MS2A 4CPDA 4I66A 3MWFA 1K5HA 1WKCA 2QTBA 3RIGA 2EATA 2MYNA 5JFTA 1RJ9B 2FMUA 3TVDA 1IUPA 1V7ZA 4J3NA 1PZFA 4KQMA 4JD5A 1PSWA 4URUR 2G9ZA 2FJPA 1YAHA 4ZDWA 4HDSA 4FYKA 1PQYA 2F1KA 4B3MB 1TA0A 2PHZA 4TKMA 2FTKE 4V2IA 5B3KA 2B37A 1KSFX 1GL7A 3EIFA 4PG7A 1NI5A 2ZIWB 5F1OA 1V25A 2PQMA 2ZP1A 3LUDA 4G4SO 4ZEXA 2PAAA 1UBGA 5KNDD 1XPOA 1YZYA 3OPYB 2ZG6A 2H2AA 2MJLA 4BO1A 3JAWA 2PR7A 3WZ2A 4W8HA 2R86A 1WOMA 3LDGA 3D3EA 4F84A 4PGHA 4F45A 3V8EA 1NONA 3VVBA 3H5VA 4JOBA 4G5XA 3LXXA 4YP7A 3G0DA 1PKEA 1NLZA 5CIYA 4C2UA 4ETWA 2ZEJA 3NETA 5F2KA 2NZUG 1GV0A 4JWTA 1X86B 4U7PB 4EY5A 3SVLA 3LMKA 1OGIA 1OMOA 2XOEA 4HB2A 2GRJA 4OHMA 3HO6A 4WMLA 5DK4A 1ZUIA 1WETA 1NPDA 5JNSA 3DTYA 2JIMA 2RCYA 4NOKA 2FN3A 1FDIA 2QRVA 3B6EA 4CQLA 3FTDA 3GPIA 4M9UA 4EHDA 1UAYA 1HDRA 4CUZA 5K45A 3OZEA 1O95D 2PD3A 3A2LA 5DYGA 3OZAA 5LR6A 4K3UA 4URZR 3OSZA 1XR3A 2FEPA 2X19A 4M0UA 4Z2YA 4FILA 2CV1A 2LKCA 2G0AA 3I73A 1V2HE 2NXEA 3OETA 3TTYA 2PGOA 1BMDA 2BUBA 3NHKA 1G21E 4F0JA 2B1RA 5JJKA 2HRZA 1RE0A 2V6IA 3ND6A 5AKHA 4GZ3A 3VYSB 1U8EA 5HA5A 3MLBA 1GA4A 2AT1A 4PC6A 5A3RA 3HEMA 3SNHA 2IZ1A 1ZMTA 1Z7YA 2XT0A 1C3EA 2RHGB 3D5QA 4IFIA 1E66A 4PAOA 1G4HA 1Z6PA 2R79A 5DX8A 3GVCA 4M60A 1QRSA 3V1UA 2QSUA 4N49A 4ZQIA 2JEYA 2VF7A 4WJKB 2BBWA 1W5TA 3CVYA 3ZW7A 4OAQA 4PNEA 4QOJA 1UBRS 2C7QA 3ZD8A 1QH1A 1WMDA 3R8FA 1UK9A 5TXGA 4P4LA 2HF9A 4MWGA 2MSLA 5TR9A 2BFBB 1WLSA 1BXRA 4Q1DA 3TMAA 4Q03A 3UMCA 3NI2A 1PG5A 2A9OA 2OXCA 2Y1KA 2ZLBA 1FYVA 4G4JA 2JPDA 2JJ8A 3BL5A 4Y0NA 1HGXA 3DLCA 3T54A 3SSNA 4NNJA 5LXTB 2IP1A 4AY5A 2IH2A 3HKDB 4YV0A 3DWFA 2ACEA 3C3AA 4YBZA 3FDFA 1AQJA 4BNDA 2X8BA 2ONKA 4NE9A 4ZZ1A 4NEQA 3PUZA 3C39A 2TYSB 5EKXA 1N0IA 4S05A 3EC1A 1IVNA 1VBMA 4G4SP 1G20B 4HAXA 4KRGA 4LQDA 2DFVA 1TVKB 2OHHA 4K0RA 5C53B 1GTZA 4JNKA 1ZDMA 1EBUA 1YRQA 4X93A 2Z04A 3AW8A 5A3JA 4MDHA 4Z4CA 1OWPA 4WEQA 2VDUE 3QPUA 5BUCA 5GMOA 5KJCA 4RF3A 3QH4A 3FFBA 1HLFA 3M5CA 4ZEMA 1YRLA 3M4NA 2HW8A 4E51A 3NBKA 1ZRMA 3Q0EA 2GZSA 1SMKA 4WKCA 4DV6B 4CODB 2WHYA 3RSOA 2R6CA 2P2SA 3WGHA 4MUHA 4ZZ3A 4RL4A 1WB9A 3GT3A 3QY9A 4DLXA 2PT5A 2PZBA 4ZQFA 3NC1C 1NN0A 4ON9A 5KS2A 3MOIA 3AIKA 4HKTA 1MRNA 4FDVA 3OH8A 3PX3A 1W30A 2VDLB 3QWIA 2DCMA 1HR0B 1Z6GA 2WAMA 2KSQA 3OZRA 4GLFA 3RGGA 3ICCA 2QS9A 2YJTD 3VX3A 2RHLA 3MJ4A 1XO1A 2EOAA 3PRHA 1CZNA 4WCVA 2C8VA 2GPYA 3B8HA 3I42A 4LI0A 2CL6X 2PS1A 3OSUA 4EG7A 3LX6A 1WXQA 1X1TA 3M4ZA 2YIJA 3QG5A 1ZM2A 2PYZA 2QR3A 4OG2A 4K8RB 1WEHA 3U4GA 1F7UA 1ZUD1 1XA4A 3R75A 1Q0UA 2QA5A 2XE4A 1YB6A 2P9YA 1S8NA 4POOA 4F8JA 2IE0A 1TYZA 3PR1A 3R7BA 3EFHA 2AW5A 5AVJA 1E0SA 2D1QA 2NYAA 5CFRA 1TTHA 4XYMA 5I8PA 2I29A 2PSDA 4UTOA 4RE6A 1MH1A 1H8HA 2FCAA 1RD4A 3WMXA 4RXMA 2VHUA 2IYTA 2XCOA 2ZWPA 3B70A 3GDOA 1BROA 4J94A 4NOMA 2BI7A 4U6NA 4F4JA 4NMWA 1A97A 4M1WA 3Q7PA 2IEZA 3I34X 4Q1BA 4B4UA 1K88A 1H6BA 2IHTA 4G07A 4G5YA 3RVQA 1UC9A 3ZHRA 1SCUA 4K81B 4UUBA 5DNUA 2OLJA 2XJ4A 5ICMA 5TMEA 3PE6A 1MO3A 1VXOA 5LIRA 4NFHA 4QU8A 1WQ4A 1Z74A 2VAWA 4PRKA 5H1YA 4CCWA 5KQPA 1EFPB 2Z2ZA 4C21A 1YA6A 1A2QA 4JB3A 4BE9A 4QUHA 3U5ZB 1DNPA 3FRIA 3NM4A 1NXWA 2JC3A 3FDXA 2CJXA 5DOZA 4PYRA 3IP6A 2GVZC 3L5KA 4U2EA 5FOUA 4JBGA 4EYGA 3K8QA 1B42A 1SCKA 2ST1A 3Q7IA 4BIMA 2P6RA 1G7TA 3KALA 1MBZA 2Z1DA 2Q4RA 2QM8A 2WWHA 3IIIA 1WNFA 3ETHA 1V3QE 1EUDB 1FNBA 3ZDXB 3ZE0B 3STTA 1DC3A 3ASYA 2B8NA 1VM6A 3EZYA 4DKXA 2HA7A 3U56A 3K1JA 3JVUA 3VFDA 4EVQA 3ZE2B 4DSOA 3LDAA 1BJTA 1FUKA 2V3WA 3HPQA 2CWDA 4R3WA 4F2PA 1KJZA 3LLVA 3ZU6A 4P4TA 1HEUA 2A0YA 3A2MA 4D0RA 3LC7O 2E5WA 2B1JA 1QZUA 2D4HA 5E9JA 2VT6A 2D5IA 3C70A 3OJWA 1TJYA 2C9MA 4GR5A 4KXVA 4AG6A 4ER5A 1SPBS 3DWEX 3I6MA 5CT9A 4ZCTA 3DHEA 2H1FA 3KR9A 1WDWB 2EFGA 3O3CA 4BATA 5ALVA 5IBPA 2PL3A 2XVAA 1GQ2A 3KOOA 2YZGA 1MQAA 3LUFA 4ITUA 1V6SA 4BUCA 1IB6A 2ZT7A 2BMEA 2FUNB 3FJYA 2FVYA 2P35A 1DXHA 2R96A 5JCJD 1MH9A 3MPOA 1XJCA 3L6EA 3S2IA 3RIEA 3BWYA 4DDWA 3HKEA 1NNSA 1OQAA 3VDMA 1JPJA 4B7XA 1ODLA 5IDXA 1VMKA 1D9ZA 2CNNA 3BICA 1M1YA 3PNMA 3LCUA 1JEQB 1DCKA 1SOVA 5AJVB 3ZTTA 4KIUA 2ECQA 1DX6A 3TTXA 1QG4A 4JUFA 2VDWA 5HCUA 4RNDB 3R20A 4HPJB 4YDHB 2QZZA 4KQHA 3OA2A 5U1PA 1LV8A 2HT1A 3NAMA 1F2DA 3SQMA 1QC5A 3BSFA 4B31A 4YRLA 3W8NA 4JBIA 1SXJB 1Z4NA 2WSYB 1HFEL 2VYNA 1QVVA 3KHKA 5AHXA 1N1MA 4EB3A 1E4VA 5DE3A 5HKOA 4P33A 1W4RA 1H2RS 4ZT7A 2BZSA 3K6JA 3NORA 3V1NA 2GD0A 2EX4A 1NMXA 5E1OA 4AROA 1WZ2A 3AB8A 4PWZA 1NI4A 1HX7A 3SZRA 1A3CA 3HLTA 1KH3A 5EWMA 4HFMA 3TD6A 3D4IA 2I3GA 1NP3A 2GK7A 2P2NA 2W6NA 3G5AA 3PQ7A 2ONJA 5JNRA 2Z6VA 4M99A 4LV8B 2YZNA 1EFVA 3TQCA 4OLHA 2QMYA 3B8EA 3OTQA 1QYVA 3U31A 4UQOA 1A7JA 3L2OB 4O5AA 3N8HA 2AWOA 3IR7A 1B43A 3F67A 3UJPA 4RHCA 5ADWA 5K3EA 4I1UA 2PV7A 3KB6A 2I8LA 4JEHA 5IAAA 5JSYA 1YDFA 1RAAA 3KXDA 1H8ED 4L27A 1GKKA 3HZOA 2IYFA 1PLJA 4RPLA 2F8TA 3OMXA 4Z0TA 3NTVA 2P3LA 3WYBA 1QR2A 1CEXA 2QN2A 2PXCA 4MLZA 4TWJA 5JO0A 2HA4A 5CJJA 2DHDA 2ZIXB 1N2ZA 1NR5A 2QVYX 1PLLA 3E2IA 3BQ9A 1K08A 4GWGA 3ONVA 2A4MA 5K01A 2IP4A 3PGVA 4WN3A 5LNK1 2IYNA 3GPDG 3O38A 4F96A 2TMKA 1W85B 2SBTA 4IHJB 5JH7F 5C8YB 2HF7A 1KORA 5I7VA 2EIHA 1YU9A 1R8XA 1ZRHA 2FEAA 3G8CA 3NEYA 3PFKA 4I1RA 1F8UA 2QY6A 3KTAA 4B75A 4F85A 5D01A 4WOBA 1HG0A 1PJ8A 2EQ5A 4UZFA 3R7LA 5B7NA 1V5EA 5FQNA 4OGLA 4JX8A 1E2LA 1Q3KA 4MTCA 4UEJA 3V80A 1V96A 4PYNA 1KXJA 1B1AA 3I0ZA 4OQQA 1T9KA 4N5MA 3U1VA 1DO8A 4I4TF 4DCTA 1I3CA 1HT0A 4ID3A 1R27A 1Y4AE 5BT9A 4ALMA 5A3SA 5KNBA 1ECLA 1MRZA 5GOTA 1DKLA 1KO7A 3UC9A 1U7UA 2VHCA 4LA4A 4XASA 3LT0A 2R7MA 2B21A 1L7QA 4IDBA 3LCCA 2COEA 3DFUA 1L1QA 3GT4A 2IPNA 4NYMR 4CYMA 4YPOA 5HJEA 4H6PA 3TXXA 4CF5A 3B52X 3EAQA 3Q4GA 1EP3B 2C7VA 1JI0A 2NG1A 4RK5A 3NS7A 5BNFA 3W9UA 1FXUA 3G68A 4NRDA 2ZI4A 3OHSX 3BPSA 3O84A 5LLSA 3OQNA 5JJBA 1WVGA 4EJSB 3AI3A 3OJ0A 4HLDA 2ODAA 3TCKA 1FLVA 4B44A 1FX0B 1DAGA 1P80A 4QHYA 4RLSA 1GDTA 3GLHA 3M4XA 4LHSA 1MIOA 4F3YA 3ZHCA 2HO4A 3GRUA 3SEFA 5AESA 4FGJA 1KOFA 2HWKA 1MG0A 1QV9A 1Z2OX 2QKYA 1N92A 1TO2E 3DKIA 4JITA 1KEEA 2JBWA 1MC1A 3BZUA 3N7AA 1JDZA 4TKVB 4C4TA 3M3HA 3ROPA 4ZAXA 5HRUA 2XYRA 1WKVA 4JCOA 4BN0A 4R8VA 4YRIA 5IXJA 1XZFA 1L8OA 1NJ6A 5AUPB 3WYAA 5AKGA 1HF3A 1ULBA 1XU4A 1LLQA 3DDZX 4RKYA 5C8ZA 3GYGA 4KP7A 3VYRB 3SJCA 5HQ3B 3UCXA 2Q5EA 2ZXEA 3MLEA 4YS6A 3TNFA 3LQFA 2K7ZA 3DBRA 3NVKI 4A82A 2CFOA 4NKRA 5L9AA 1Z34A 2C4HA 2X58A 4E21A 4AYTA 4BNVA 2BWJA 3OZ7A 5LMUB 4N41A 1Y8CA 1BRMA 3HMKA 4GGOA 1QOPB 3F3KA 4DDMA 4XB6B 1TT7A 2FFQA 2NV6A 3BM5A 1J07A 1R18A 1BCRB 3KKMA 3L0ZA 4XSVA 5DWVA 4Z9YA 4BGIA 2I6FA 1XZGA 2NQ2C 4AW9A 1ZOSA 1I0LA 3VV3A 3TZBA 4LC9A 3W5DA 1JHQA 2OAQ1 3ZGXA 5C3MA 4Q4HA 3G9ZA 2O7SA 4X7MA 1Z6ZA 4LYHA 4P4NA 4TWBA 3U9LA 2ZR9A 4REMA 2C9CA 2MMGA 2GOYA 1APBA 2O52A 1N4AA 2R65A 5TARA 1A77A 3CMMA 1UBFA 2P3SA 4LRTB 1MO6A 4BN5A 5TJHA 2FJUA 3OLXA 4DWOA 4H6XA 1M6VA 4IJUA 1LSUA 1P81A 4QE3A 3E05A 3ZWMA 4E2WA 4DN6A 2C7GA 3SC2B 1WW3A 2ILVA 5LMZA 2V58A 1JWAB 1ENOA 2BSXA 2HQ1A 5HZGA 4MJ7A 3L7CA 5J58A 1J24A 4HB4A 2F3TA 1UF9A 4XQ9A 3WWOA 4Z4IA 4E12A 1XVLA 1W8IA 4M1YA 4KO8A 3R41A 4LBZA 4LF9B 3LBFA 2G7ZA 1K75A 5ISMA 2O2ZA 3KAPA 3KYCA 1YR2A 4KH1A 4M89A 2GFHA 2LNDA 4KB5A 1KDOA 1XZLA 3FHJA 5HDQA 5KWJA 4DR5B 5DGCA 4PX3A 2XVMA 2FK8A 1G18A 1R9JA 2WD9A 1YI1A 2CLDX 2PWYA 4IIGA 4Y1FA 2HWUA 3PYLA 3O8LA 4XAQA 4XE5A 4YX9A 3TEFA 3NHMA 2FRVA 1NQAO 4XUDA 3W2HA 2GCNA 2A5LA 3ILSA 1ZHFA 3MFQA 2ZWIA 3FFAA 4KREA 4QTUB 2YFKA 3ZXIA 1U1IA 5JV5A 5DGTA 1H66A 2R48A 2EZUA 4KQFA 1F4LA 1FFCA 1QIIA 4GMGA 2Z8ZA 3K1AB 4G84A 4RY9A 4RFLA 3TMYA 2C5AA 4ZOAA 2D3WA 2MR6A 1XQ9A 5IUKC 1R37A 3DCNA 4EY6A 1M6WA 2H2WA 4GPIB 1X7ZA 1Q19A 2DGDA 1WG8A 4RM3A 1ESMA 2PJRA 1AT1A 2C5SA 3AJRA 3PQ3A 3QPWA 4DDHA 3QX7A 4C6SA 4IFTA 3KYBA 1XHLA 1YBFA 1F6WA 3B1XA 4Y6QA 1G1MA 1JEYB 1TAQA 3QVKA 1UJ5A 3CWQA 5FUBA 1ZUNB 3LWBA 1WJGA 3FSGA 3TBKA 1H2EA 1NJGA 2OB1A 4IDPA 3QVUA 2ZXUA 1YQQA 2DBZA 3LOUA 4GUDA 2GGSA 2BCGY 2R8ZA 4FFPA 2VF4X 2W0MA 1LDNA 1R0XA 1TLLA 1YDWA 4B74A 4AKIA 4YMSA 4IDCA 1UJCA 1Q1ZA 2XGGA 1F2UB 3MFYA 5D6NA 1I7QB 2F4NA 3AFIA 1RS0A 5IX8A 2YOGA 3NHSA 2QM3A 3QLVA 1QE5A 1T3SA 3SJUA 3LHSA 5AM5A 1CR1A 4ZQEA 2CD9A 4I1PA 3OWXA 3NWOA 4LDPA 1DBSA 3LT2A 3OKCA 2ETVA 5CVVA 1E63A 4RMHA 4H1UA 4UNNA 3BA6A 4FLMA 5HF6A 5IKPA 4JUCA 1WV1A 3U4AA 1LF5A 4AKGA 3C6KA 1FUYB 4YHHB 1GPYA 1Z6TA 1TVCA 4TXJA 3WYGA 3OZBA 3PK0A 3SI7A 3ONDA 4NPAA 2YDXA 3F6SA 5F1PA 2I67A 3QF4A 1XWIA 1FK8A 3TMKA 4A15A 1N9GA 1QH1B 1W5AA 3SM9A 4MICA 4Z9AA 3COWA 4MHOA 5LQAA 3LY8A 1TK9A 3OG9A 2ZETA 4X1IB 2PXAA 3L7AA 1BXRB 1Q7RA 4FLEA 4C78A 4TLDA 1US8B 1XNGA 1A9ZA 1VJ1A 2VF5X 3D7MA 2PUBA 2EX1A 1XEWY 3OTIA 4JELA 5EGNA 5CITA 5BR7A 4RTOA 1E7YA 2Q7OE 4EF6A 4E6EA 1WUIS 1YC2A 2RC5A 5FOVA 4K86A 4YHBA 3IUJA 1UMBB 2I2CA 4DC0A 2W2LD 3VJLA 1BWSA 4LSMA 1SQSA 4B3HA 1KQFA 1N78A 4B2YA 1L8QA 5HNKA 3GZNB 2JJ1D 2AXNA 1RCTE 4HDNA 4IIUA 4IG9A 4J7XA 3W2GA 2BR3A 3UYKA 4CDGA 3DGFC 1ONPA 1U90A 3IEUA 3L0CA 3NJRA 2MSWA 3R6LA 2KHZA 4AP6A 4D5EA 4PX9A 1NOJA 3ZDEA 3PTZA 4AMZA 2YXEA 1Y3FE 2Q1UA 4AQ7A 2HA2A 4FMDB 4MEBA 5D3KA 4JS0A 4LHVA 2KWIA 4LVCA 2YNMA 2OHXA 2JCXA 2WRZA 3RFTA 2BFCB 7REQA 2GRAA 1ENPA 5ICEA 3D4LA 1ZKMA 1LGYA 1DKRA 1FDSA 3CCFA 3PV0A 3MYYA 4N9WA 2Z30A 3MK31 1WUYA 2HTEA 4QEZA 2M6LA 5M34A 1W87A 3KJFA 3HBMA 2JD1A 3EPLA 2XVXA 5HGJA 1Z36A 1U04A 2JF0A 4JLOA 1OH7A 2W9XA 3BZWA 1FFDA 2ZB7A 3KQYA 3UV7A 1SOMA 2IDMA 4YI3A 3A10A 2Q2OA 1N2JA 1JKXA 1UBEA 2ZRAA 4JR1A 4BO3A 2IU4A 1I6LA 3OHMA 5L53A 3NGXA 1OXKB 4RTSA 2YN4A 3ZWWA 3CRRA 1JRLA 3PE4A 4LRXA 4RVFA 2HIMA 3KLOA 3TTWA 1JVSA 3A7DA 2OGZA 1WB6A 1YL7A 1EDDA 4MGKR 5EHXA 2RBGA 3AUTA 4ZGGA 1Y7IA 4IHQA 3ANTA 4YXWD 4BZQA 1LB1B 2J48A 4EBFA 1ZGAA 4NABA 1H6CA 2IBMA 4ERNA 1LDGA 2HA3A 4DQUA 4AC9A 3NBFA 4J1TA 1XIVA 2B2CA 4IJ6A 5EIWA 3G23A 4WTOA 3EXFB 4YJKA 5FP0A 4QGSA 3Q3CA 3ORQA 3CZCA 2XI4A 3F6RA 1EXNA 2DJIA 2HI0A 3PX2A 7MHTA 4A6XA 1GKIA 3OUUA 3K70C 3IKTA 4G0XA 4K6KA 5A1TA 1TKAA 4E31A 3L92A 1ST3A 4DSAA 3M6LA 1C9NA 4OUDB 2JA1A 3GD5A 4M9QA 1CJTC 1GGHA 3FMOB 4CT0A 1NN3A 3IUNA 3B3FA 4HOYA 1SCDA 3VHLB 3VO8A 4YJ2A 3I6QA 3IULA 4II7A 4LJ9A 2QZPA 4HRYA 1NUAA 2J4CA 1I13A 5TF0A 1QTIA 2J6IA 1D4OA 1ZM9A 3RHFA 3RANA 4EG1A 2I4TA 2KLHA 1PTJC 3IBFA 2AFIE 3ZKAA 3GJ4A 3NO4A 2O2DA 1E5XA 1U2GA 2IYLD 2JFWA 3K1ZA 4G1MB 4KHZA 4MS1B 3SQDA 1EQAA 1ZA2A 3EDRA 1R00A 2P6OA 3H5LA 2E21A 3DW1X 3D6NB 5EZQA 1ISIA 1Q83A 2P30A 1Z16A 5FNZA 4AZ0A 1S2IA 4CV1A 1QLHA 5GPBA 2A58A 3F5SA 3UGTA 5KJ1A 3OQPA 4J7AA 2INGX 1C4KA 4TYPA 5AQEA 1XRRA 2I4NA 3D59A 1DFHA 3KCQA 3GZJA 2FPOA 3U3XA 4UW9A 4Y1RA 5SZHB 1PR3A 2WK1A 5EG5A 1JQ3A 2QBYA 3RUIA 4EUEA 5IPFA 4OYHA 4FD3A 2FW8A 5J2UA 3EVBA 4V3CA 1FTYA 1Y0BA 4P2GA 2REQB 2V9CA 2WM9B 3FYUB 3R0XA 1IM2A 3W3AD 3W5VA 3SS9X 3GLFA 1TUBA 2QW8A 3OQ6A 2Z5FA 3M5DA 1AKYA 1BXGA 1M1YB 3CEJA 1FDVA 1JLRA 1U8XX 2XYGA 3BJZA 3KOMA 3OX1A 5IAKA 4YDQA 4RANA 4AN1A 5EKUA 4KYVA 4QQFA 5JJIA 1N2EA 1OA1A 4OGFA 2PM8A 3E9RA 1NT4A 1HSZA 1SB9A 1EG2A 5AWFC 4OK6A 1GSHA 1QTRA 2CXXA 2ODEA 2RGDA 3K09A 4PCAA 5DO9A 3ETNA 2XUOA 1G8AA 2H5JA 5FBZA 3TLAA 2GD6A 3HJTA 1U3VA 2ZT8A 3LT1A 3MRTA 2AMYA 4NYMQ 3UM9A 4BOYA 3GX1A 4C3ZA 1A71A 1YTUA 2VTEA 4CLRB 5I7WA 3OTWA 4CLXA 5GVSA 3E7DA 1C3VA 4GZMA 1MOSA 1XAHA 1KI9A 5JAMA 5B3JC 2MSKA 1KETA 5DMHA 4NJMA 3QVGB 1CPYA 1PYGA 3KV1A 3PC2A 1I4OA 4O08A 3BF8A 1IFXA 3Q5DA 1STOA 1M5RA 1GVHA 4L4XA 2OYSA 4ZVLA 2BGMA 4G5RA 4U7GA 2AXPA 2W8BB 4MH0R 2OCPA 3BULA 3JZIA 3VKWA 3HBFA 3R5JA 2C4UA 1KIAA 3TNJA 1Y7LA 2ZYRA 3UA3A 1IBSA 2YHUA 1KVUA 5FLEX 1N77A 2RSLA 2I65A 3UV3A 4NWIA 5EQDA 3V33A 1V1JA 5AJUA 4M9XA 2VKQA 3VKVA 1DPGA 3RODA 1RWQA 1C30B 2MSDB 4OQDA 2YJZA 4LE2A 2HSEA 3BFJA 3OEHA 4FCWA 2PMWB 1Y8QA 1DC6A 2H7VA 1XXHA 1P5ZB 3A37A 3H4TA 4MV6A 4V3BA 3JR3A 1AK2A 1H9AA 1OXBB 1YRAA 2VWHA 2DBVO 3I37X 3OQ1A 1VRVA 2O0MA 1IC6A 2IUEA 1ZK0A 2WT4A 3C85A 4BMVA 2IS1A 5JNWA 1KDZA 3UWMA 3KTFA 1TEXA 3H13A 1S2GA 3HWX1 1K3TA 3I6IA 3LQ2A 1G7RA 3DXZA 4LVUA 3WSWA 3RD5A 1WTAA 4UCFA 1Q12A 2JB9A 1EK6A 1XWFA 4I2NA 2JK1A 3PEYA 4JGBA 4FWBA 4D43A 4X41A 3WBJA 2EG5A 4BHTA 1T2UA 2Z8XA 4FC6A 4GBMA 1P0MA 2FU5C 3P9XA 6NULA 3ND7A 1A9XA 2K2WA 4RKEA 4GE0A 2OESA 1U9IC 1YZVA 5ALQA 1FS5A 4I55B 1G98A 3C74A 1NG9A 1K6XA 1NVBA 5EMHA 1Z8NA 2PBZA 4Y2JA 2H5LA 3GIDA 1RSZA 2AE1A 2Z9BA 2Y6UA 4A8JA 3O2JA 3AHEA 3R7WA 1BXKA 1K9VF 4AO8A 4UM9B 4KPUA 5DWQA 2R1ZA 3JQQA 4WNYA 5E7IA 3ANNA 5KDOA 4TQ9A 1QQ6A 3AZQA 5JZBA 3PEEA 4PLYA 5DIFA 2RHDA 4XSGA 5BNZA 2ZT5A 3P94A 3F1LA 4NE2A 4TMZA 1NVWQ 4DSZA 4XD7D 2E0IA 3DSRA 3FAKA 5HIKA 5B1DA 3R7DA 4TMYA 5AVYA 1F6DA 3VJMA 1QVWA 1RBMA 4JN6B 4NCHA 2I55A 4J2HA 3VDXA 3PWTA 1U0JA 3S2YA 1Z8FA 4OOEA 1KEEB 4W5TA 4YWHA 2J08A 1VJ0A 5B4UA 3GEHA 4EECA 3T9EA 3CVVA 1K7XB 4PZDA 1YZKA 2FPWA 4I50A 4MO9A 2VH2A 3JS5A 1H2WA 3LX4A 4ALIA 4PN3A 5BOSB 5AI9A 2ZBEA 2XUFA 3TQQA 1J00A 4JBYA 5AKYA 1XL0A 2NXJA 2OXFA 3GARA 3ZK7A 4G26A 1K86A 2DY1A 2CMFA 2JHAA 3FLAA 3PLRA 2FQ1A 4OHKA 4B43A 4L16A 3THYA 1DELA 3KDSE 3LWDA 1OLSA 1N1EA 2CK3D 2J6HA 3BWMA 4GGPA 4PHFA 4C6HA 2H48A 2OZKA 1BN6A 1UWCA 4RSRA 5D86A 3LK6A 2B4RO 1EE9A 5GJWC 1XD2B 2LDBA 4X45A 3V42A 1VLZA 4V1CB 4H0CA 4JI1B 1JLLA 2KMLA 2YWFA 1SQ6A 1EAMA 2VNIA 3FWZA 3KKQA 2G1UA 1J21A 1JSLA 4Q9NA 3RYFB 4EJ6A 5KNBH 4KV7A 1QS0B 2V7BA 1YQWA 3FZGA 3GMTA 5NULA 3DPUA 4B3IA 1QIKA 4BASA 4MCJA 1R3UA 3W8DA 1NXPA 4RQBA 5CPFA 3CRVA 3ENWA 3MF4A 4OU4A 2WFAA 4KITB 5JLJA 2VWPA 1GL9B 3DLHA 3RFCA 4OHYA 1FA9A 1DWQA 3O6VA 4OQXA 1NU6A 1U3CA 1C8VB 2Z83A 3BFXA 5E1BA 5CDTA 3KKNA 5BMVB 4NHEA 2XUGA 1F0KA 3H6GA 4ENRA 3LGXA 3WX0A 1X9HA 2O3RA 3AUKA 4RXUA 5CAEB 4P7BA 3OECA 3OQVA 3RJMA 3D3WB 1Q74A 6YASA 1UDAA 4DV5B 2I34A 4HTFA 2ZRGA 5CX4A 5FWDA 1WSWA 2UZIR 1RLJA 3RAJA 3NEPX 3DHYA 3U13A 3A3YA 3LCRA 4L8VA 5JBNA 4HFRA 4J9UE 1MXFA 2O5RA 2A1TS 1M0WA 2IXEA 2IYEA 1Y81A 3C4QA 3H99A 3HLKA 4PAWA 4KC0A 3UFXB 5IKXA 2FOXA 4YCDA 3IMFA 3AJDA 5DM2A 3I01A 3L9WA 2ZSAA 3P0IA 4MI6A 3Q2IA 3LKZA 2FMFA 2PZFA 3AVQA 2O57A 3FOAA 3MTIA 1E3JA 1ONBA 3W6NA 4YR7A 3P9PA 3CJQA 1HETA 4BCCA 4JENA 4JBWA 2ZAGA 2L2QA 3Q3VA 3UMFA 5FOQA 1IZYA 1ZXBA 4TS3A 5SY4A 3H9CA 5IVPA 1EWTA 4HR7A 1TPZA 1QPZA 1G4AE 3GVPA 4YACA 1M2OA 4MRNA 1PVOA 2VFAA 4E5MA 2F8MA 5K8IA 1PWZA 3N59A 1QDEA 1SQ5A 2Q3JA 2C88A 2NACA 2XAAA 4Q34A 1QPGA 1FMFA 3A1TA 3VDRA 1PGNA 2CUZA 4EITA 2O2SA 1OJLA 4B87A 3TUIC 4QZVA 4PLHA 2BZ0A 2M6RA 2Q7XA 1EP1B 1CY8A 1C8LA 3LHDA 2QVBA 2YQZA 4FBGA 4OQYA 2HSDA 1C4WA 3UIEA 4CG2A 3FF1A 4G5FA 2RHCA 3S7TA 1OWLA 2FWPA 2P6UA 2CLLB 2YWDA 3T9AA 1DBPA 1R6BX 4HGPA 4BZZA 4R9SA 1IN1A 1X7ZB 1Y1RA 3N5CA 4HPXB 4GKVA 2DPXA 2VAVA 3TQFA 1JDUA 2GCIA 4RCVA 2VTBA 1JMVA 2BHSA 3LDUA 2XCQA 3AU8A 2J3DA 3DVAA 2HFJA 4PQRA 4DXAA 1CY0A 1U8TA 4HUJA 4MUGA 1P4RA 4TXNA 4MQ5A 3LIIA 1IWOA 3PPXA 1XDSA 2QVZX 4G85A 1SU7A 1ZOPA 4MR8A 2LCIA 2HV9A 4GU5A 1GQYA 2B5WA 3T3IA 4RPCA 4XWOA 3PS9A 3TLXA 1P2BA 4BX3A 3PD1A 1DRWA 1VJGA 3O1LA 4ILKA 5AXDA 2HBZA 3PUWA 2MYTA 3KPVA 4ZOQI 2XDYA 2P79A 2R60A 4E6PA 2R68A 3RARA 1DEKA 3WDMA 4PO3X 5GIPE 5JVDA 4LOAA 1QG6A 2JIZA 5CXUA 4Z7JA 4D79A 4TYNA 5J2TF 1GPKA 4K03A 5D85A 1DLIA 4L08A 4Q7MB 4RHUA 3PF8A 3EZ2A 4YAOA 3R9KA 1WDMA 3L5OA 2CWWA 1OLUA 3OPNA 4FDUA 4DOMA 1JSCA 3HA2A 2JHPA 4QJIA 4S04A 3KFXA 1BCSB 1YZHA 1EB8A 4HNUA 3WXBA 3T8YA 1FVFA 4AJ9A 4EHFA 2Y9PB 2OFWA 1GZDA 1VECA 2GPSA 4G9EA 4HX2A 1SQGA 2Q8PA 1RJEA 4INAA 2J67A 5L40A 4LQLA 1CS4C 1JNYA 4NNPA 4CEJA 2XVZA 5F77A 1MO4A 1N4DA 2XYHA 1S4QA 3WB2A 3T5PA 5TPZD 3VPAA 4RTLA 3OKPA 5IHXA 5DW3A 4R9UC 1NYLA 5ECGC 4MQEB 1U2QA 1P2TA 4A73A 2FSGA 1JHRA 1K63A 4BP9A 2JFUA 4GM0A 4B8YA 4EUHA 1QQBA 1M9NA 2M1XA 1B0UA 2B99A 4XVCA 5H16A 5B6PA 1F0PA 1W1UA 2AZDA 4OIMA 2GR7A 2IZOA 2X8JA 2JLBA 3GLRA 5JBQA 4BY9E 2YBEA 3WYDA 4C20A 3QLEA 3N8GA 5JD5A 3UH1A 3QXGA 4HDNB 5ELLA 2X3FA 1UUFA 4MA5A 3KUXA 3M6VA 1LRLA 3PEUA 5I8ZA 2QMQA 5HRAA 2YUIA 3L46A 1EDZA 2O1SA 5K20A 4BPRA 1OTXA 2QIPA 1IHPA 4QTYA 1QTNA 1WSAA 2X0DA 4Q24A 2G2SA 3CF4G 1YJBA 2WT8A 4CQMD 5AT1A 4D7AA 2ILTA 4NENB 5ESRA 1KNQA 2EHJA 3L3BA 1CIVA 3KAJA 1JP7A 1L0BA 1VJDA 4AG3A 5JOQA 1CEYA 3DTVD 4R31A 3NHUA 1WV0A 1CVRA 4U9IS 1Y3DE 2PZAA 3L6CA 3M49A 3O4VA 1VI2A 3C6MA 4HP8A 6GPBA 1TZCA 1HDYA 1W93A 1WPRA 3TH5A 2WMOB 1CUJA 3UYLA 4TRRA 5JJ5A 1H0KA 1W4LA 4FLFA 1UK6A 1SC1A 1XRLA 4I5GA 4O4IA 1S89A 3RWBA 4XR4A 3GUYA 4X6YA 5MGNA 1Q7EA 3EX7C 4DUZB 4O6VA 4M8IA 1U80A 4MV0A 1RYFA 1TW2A 3ADOA 3LT4A 3R44A 8ABPA 2XUZA 4A0GA 3UK1A 1W4AA 2F3QA 2BYTA 3KQTA 4IH9A 4TL9A 4AKSA 3ZEAA 5AM3A 5JPDA 2TS1A 1RQ2A 2W4MA 1N5OX 4UC0A 5K4HA 5FBRB 4ITVA 2IECA 3ZZUA 3WKEA 2NPIA 1KAHA 9ABPA 3DEAA 2CJPA 1PJ4A 1R6XA 3KSUA 4Y1GA 2V7WA 4EYOA 1N25A 2ZUUA 3P2EA 1M2VB 5JALA 5CURA 4FVTA 4BN4A 2F3RA 1Q0QA 1IM8A 3QUCA 2P4HX 5BSWA 4QQ8A 4AX4A 4W5QA 1ILEA 2C5LA 5JYDA 2JLZA 5JMWA 3M1LA 2XNDA 3KQKA 3HUFA 1FYXA 1WHSA 4ETMA 3COSA 3HXQA 2QR2A 1HLGA 1ZK2A 2VSXA 4IF4A 5ALKA 1YMQA 3KZCA 1YZGA 1X1DA 1Z35A 2WQ7A 1MOQA 5K99A 1WMEA 1HKHA 1EFAA 2QRUA 3HMQA 3VPHA 4Q3DA 3OEWA 4XIJA 5THQA 1YMUA 4Q3EA 5GIOE 4LRWA 1HZZC 1F4VA 2AA3A 2ROQA 3INGA 3AHGA 3LP8A 4Y1EA 4MIYA 4EM6A 4QJ5A 4S24A 2EJBA 3GPLA 2RGEA 4D46A 1OT3A 4TV8A 4D6YA 1P1RA 4F60A 1QU3A 3OX2A 3DO5A 5E6RB 4HQ6A 1GDHA 4JSYA 1G21A 4FYIA 4C3OB 3HG7A 2AG6A 3DBIA 2R1TB 5B1EA 3HV2A 3TX6A 4FGZA 1BVYF 3KETA 1QHSA 1LH0A 2CHVA 3EQZA 1GNRA 2WJWA 2QLJA 2IPOA 2QJTA 2ZRPA 1BHSA 3QE2A 4YH1A 2SCUA 2Q2WA 4MRAA 1EM8A 4BJ3A 2IV3A 5HUQA 5IYZB 5D5PA 4IW3B 4AZ0B 3G79A 1PX0A 5HKAA 2JVJA 3PNYA 1XTTA 4DV2B 1UOOA 4LY0A 2XEDA 2AN5A 3NEAA 5H7XA 4MUXA 4FMCB 2GHTA 3P4UA 5LD2B 1Z68A 4R84A 2VJBA 4P53A 4PR0A 2PGXA 4J6EA 4RQAA 4GQAA 1T9CA 2W6ZA 4YT4A 5LMNB 1T3TA 4FOLA 4BXOA 3DW3X 3GRYA 1HC7A 5EXPA 2E9SA 1BW9A 1QLJA 1VA5A 1W4ZA 2OGWA 5U4XA 1N32B 1WO8A 2AVDA 2PLWA 5HKKD 4KR2A 5EMMA 2C2WA 1EXVA 3WFIA 3SJ7A 4C29A 3KVRA 1Q1EA 4C3VA 5BW5A 1MHTA 1YB1A 4HWPA 1BS2A 4RF2A 2EGHA 1YJ8A 4I81A 4WKGA 5DTRA 4E1VA 3VI3B 1P91A 2OEPA 4NTZA 1SHLA 1XRMA 1BIFA 5CVTA 4FYXA 3CWCA 1B2LA 4PYMA 1G55A 5A5VA 4TMTA 3DYBA 2X1MA 3ISJA 2WJZB 3JCZA 4PPQA 2EZ8A 4PSKA 1MAUA 3TEMA 3FSEA 1G8KA 2YV2A 2O2GA 4OK5A 4R3NA 1V6AA 1SR8A 2ZS9A 5HZMA 2ZYGA 5C18A 1U1CA 3L8HA 1LVGA 4F71A 1MDFA 1T29A 1Y9AA 1U3UA 3VR1A 5IULC 3N0RA 3MG9A 1V3VA 1RYYA 1QZ3A 2PCLA 3TRIA 4OJMX 5IT9A 3KPWA 5CUQA 3KQNA 4CM9D 1M76A 2OLEA 3QXSA 2OD7A 3BCHA 1X92A 4PYIA 3ULKA 1K4KA 5UKDA 3DAGA 5H3CA 5K5EA 1VE3A 1BMFD 4CU5A 2C57A 4H7KA 1F4PA 4JC8A 5JS1A 2XWQA 2Q9UA 2JGKA 2HPZA 2PWZA 3NBXX 3HA3A 3BDIA 4RENA 1OXVA 3IESA 4ZXPA 3KYJB 5KYTA 4FHCA 2BISA 4XIGS 2NQ8A 4ZK6A 1NJFA 3PQEA 3UAWA 1V6CA 5CK4A 3IO3A 1L7OA 2J9ZB 2QM7A 2ZB3A 2G07A 1QK4A 2V1UA 1KY5A 1Z17A 4Z1MD 1Y8ZA 3PBKA 4RQUA 2XYPA 5IKMA 1W76A 3BXPA 1T8YA 5JY6A 3R1IA 4H3KB 4IH4A 4I9HA 3K4QA 3NIGB 4IPTA 1FFAA 2J7PA 2GM3A 4YAEA 3IXQA 1QM5A 4L6CA 5IH3A 1EK1A 3P20A 3TRDA 2CNOA 1R9MA 2ORED 2FR8C 2UVQA 1EFHA 1W19A 4I6JA 3T9BA 2V65A 3TB4A 1BVHA 3KDPA 4FXOA 1I3KA 3AETB 3CZ9A 2ZVPX 3FMGA 3OU7A 4XJVA 1NKSA 3MHPA 3O26A 3AVTA 1YCGA 3UMRA 3PTLA 4PSVA 3PIDA 1N1DA 2PGDA 3EARA 1QHEA 4LKRA 3PGLA 4QBGB 2ZDHA 5AVKA 5CFZA 3SHVA 4CRWB 5BSHA 2C20A 3HCCA 4G1UC 4JVMA 2HK8A 5G0SA 1JVNA 1QG0A 3PC7A 1R6AA 2ISCA 4AZ3B 1JJIA 2ZFUA 3I8SA 3Q6IA 4ARSA 3ZCQA 1H4TA 4M0KA 1RYNA 4AF7A 5KNCH 5KOJB 1E18A 3R7WB 4EUFA 1T6NA 3E81A 2C2YA 3EBLA 4OHVA 4WXHA 1TZ2A 3DV0A 3QXJA 5CGQB 1DZ3A 3RS8A 1KK0A 3EOAI 3E48A 1D09A 5I9IA 4ZYYA 2RGRA 3HUUA 3FUVA 2R8RA 3QFRA 4M8LA 2OBBA 4ZOEA 1KKMA 1EFDN 1FDUA 1OSNA 2F9FA 3CPHA 3DUFB 2GN8A 3G9TA 2NZWA 3BHJA 3HRIA 3RJTA 4L9RA 3UJBA 2Q0SA 4ENQA 3GMDA 3OCYA 4Q7QA 4TGLA 3TW0A 2WAOA 2Y71A 3IDAA 2EJCA 4EVSA 4CMIA 5BWCA 5IK2A 4BBAA 5JMTA 2GB4A 2ID9A 4S0ZA 4UNQA 3T7EA 3K05A 1VKJA 5G3YA 2DVMA 3JZAA 4QLAA 1WZEA 4X3PA 5ALJA 1NVKA 4JLWA 4GXRA 4KQGA 1TJ5A 2GBLC 2G67A 2Q3EA 4TLEA 1AH2A 1CK4A 1LPSA 1R0CA 1W48A 4NATA 4OYRA 5DBIA 3WBBA 4RZHA 1EQ2A 4DLSA 1FJ2A 3H1AA 2OP1A 5EPEA 5I51A 1DRVA 1NXVA 1WCXA 2O8BB 2FOLA 1TJ3A 4WZBB 2DFKB 2XF2A 2J4FA 5CXSA 3LW8A 1UK8A 3UJ7A 4F46A 1EUZA 1DTWB 1Z0ZA 4TTSA 1KJJA 2DM6A 5CJPA 4HT3B 3CR3C 4FHDA 4X1KB 5IJXA 3MWDB 4UBLA 5LP6A 4GKAA 4E4TA 2EYQA 2HPVA 2XCSB 3DMGA 4IDGA 1TI7A 1CLEA 3NATA 3TW4A 1VYHA 5LDDC 3B9PA 2HN9A 4TKLA 3K6SA 2O3QA 2XOKD 4KSCA 1TUGA 3RHZA 1GILA 1ZJ5A 1TM7E 2KM1A 4MPPA 5BSKA 2ZSUA 3GLUA 2RMKA 3FCAA 3NBQA 3K9HA 3STXA 1Z07A 4QM7A 1GCUA 2GF0A 3PJGA 1O87A 3E3LA 4NMLA 4XJSA 3Q88A 4EJFA 2QN3A 3HVRA 3OZCA 2UUBB 1C9KA 1JPUA 4K6FA 4V2UA 5CPBA 1ZSNA 3HFGA 3L7JA 2FY8A 4XA8A 1EFKA 4KK4A 3WISA 1WUHS 3ZNQA 1PJ2A 1SKYE 2NO9A 1G291 4P3KA 4RGVA 3V48A 1X3SA 1S3SA 1E2KA 1UDCA 2BEJA 3NHBA 3PC3A 3W79A 5CEFA 2EEPA 1P9LA 3E2PA 3RYIB 1DPFA 3R76A 1PNOA 1NFRA 4HTFB 2OBLA 4G4IA 3WQRA 1GWNA 1T6ZA 3GH1A 1C1HA 2JVIA 1ZSYA 2R11A 2VJQA 3AR8A 4R69A 1VE5A 3W4IA 3ZDRA 3DT9A 3QBTA 5I7AA 4YMUA 1DKNA 4BJ1A 2XKAA 3T4PA 1JR2A 4PM4A 1JXAA 1JDVA 3ENZA 3N6XA 4PZAA 3DM9B 2X5OA 4DWJA 4BO2A 4WBNB 2NTEA 3OZDA 2YXDA 4O4LA 2CKMA 2FPPA 1U3WA 1QF7A 3BRWD 4HVLA 1OI2A 1NU8A 3EA4A 1G9TA 1C4XA 1LLCA 3MWYW 2YZMA 4OH1A 4RIGA 3TUJC 3V3KA 4AKTA 2ZCVA 2F64A 1EP9A 2VHYA 1O95A 1ZAKA 5JYBA 2YYSA 3GXOA 4IGEA 3N86A 1RRKA 1R4NA 1JU4A 2JDID 1H3FA 1I4DD 1TW3A 2C7PA 4ARUA 1H85A 2IYYA 1KVRA 1OGJA 3EFBA 3G0CA 1RNLA 1XPRA 2A4KA 4I1IA 4KVFA 2PJDA 4HAIA 3FNFA 3I8OA 3K2BA 4RY8A 1LFAA 1EA7A 2WJAA 1USWA 3EMDA 3DWIA 4ROSA 4YMHA 2WSLA 5P8WA 2PL9A 3LFUA 1OKKD 4Z49A 1K9SA 2C42A 1L5VA 3IUBA 4JJIA 2W43A 1GTG1 2NSDA 4D8TA 1QGUA 3L7IA 4GL4A 5JRJA 1WZCA 2GTPA 2EYUA 1JEDA 3G8YA 2C4TA 3C7DB 3FB1A 4ZVPA 2K5UA 4QPNA 1P6QA 2NTJA 3QVXA 4OXYA 4PLCA 4BX2A 4F5ZA 1GJRA 2ZM5A 2R0QC 4C30A 2QRQA 5BQPA 1G59A 2WJJA 3WWZA 4LF6B 3AR7A 2ZRHA 4IX1A 3A4VA 3VNSA 4I2VA 5AI4A 2CLEB 2XTNA 4HSGA 3KWLA 2XXBA 4JEMA 3K5HA 3V8BA 1L5KA 4YJ2F 3TRFA 3FTPA 3E84A 3RAGA 2A56A 1LKZA 4MS4A 4WN9A 4W9NA 1BDJA 2DKOA 1ZN9A 2XA1A 2XGMA 2JA2A 1T9ZA 4ILEA 4ETIA 1OLOA 3Q40A 4HLUA 3MJSA 1II9A 3TRHA 3FZNA 5ILQA 2OVBA 2PEZA 4JWKA 4I7EA 1JUDA 2YHSA 1DIRA 2I0FA 2OGTA 4N0DA 3FZQA 1Z25A 2CXUA 2WD7A 4D9MA 1MHPA 4TXLA 2WHPB 1TAGA 3MWEB 1VPLA 4CLHA 2IIPA 5T3UA 2PE5A 2JBAA 4JQZA 4IXNA 2RAFA 1KJNA 4CKCB 1ZZEA 3OPYI 1Q0HA 5FV4A 1TTTA 3JX9A 1A5AB 3VYVA 4G0ZA 5J2UF 1P75A 4DMFA 2RK6A 3P9QA 1E3SA 3CA8A 3LUBA 3SIXA 2D5CA 2N1BA 3VTKA 2DPMA 2GVDC 2Z95A 3PJEA 1USIA 3QELB 4FOPA 1P17A 2NU9A 2XMRA 3AYZB 4HD8A 4J1SA 4OBWA 2R66A 3NCTA 1R0YA 1Q44A 1JHDA 3RVRA 3TSCA 3EGWA 5CLFA 1PT8A 4BBZA 2PTHA 4WNCA 3UKOA 3T3OA 3O92A 1URPA 4JI0B 4IRXA 1F9EA 4H7FA 3AERB 4YJFA 5DXAA 2XUIA 3ED5A 1FP4A 1JFRA 1U0TA 2F43B 5GJVC 4WNAA 1VE9A 4MKHA 3QEOA 4HK4A 4ACAA 1LVUA 3V6LA 4LMPA 1FTSA 4F6CA 5I4KA 1A2BA 1RWKA 1GDDA 2IUUA 3W5JA 3JVDA 3LL4A 4DLVA 5ERYA 1GLNA 1L7PA 2J32A 3P0EA 3QOFA 4X97A 4Y0VA 4XRGA 4IINA 3DKRA 3DTTA 5ECDA 4GP6A 4A23A 9MHTA 5IVIA 4ROTA 4E94A 2J3LA 3JQFA 4W5RA 3OWOA 4TTVA 3K9LA 3FSRA 4TUYB 2IYUA 4ND3A 4LTMA 2PZMA 4MW5A 3X1WA 4ADSG 5YASA 5J23A 3HCRA 5F5LA 4YLYA 2WTUA 2CJYA 3BYZA 1NW8A 3GFGA 3QSYA 2FN9A 3AF4A 5E3IA 2XIQA 3NKVA 5ALGA 2XQKA 2AUMA 3ZLVA 1MABB 2D5AA 3PXBA 5BSVA 5IN4A 5KQSA 2R6GA 3V4LA 2D2FA 1D4ZA 3C3JA 5LJLA 2DX7A 1RHUA 1KZHA 3HSSA 3JD1A 1W5BA 2GN2A 3TZCA 3GOHA 2RGBA 2FI1A 4HF7A 4B34A 4EZEA 1N3YA 2P9ZA 3CT4A 4EHNA 5FNVA 3V2GA 3COVA 4ZU1X 1KYYA 1SA0A 1W88B 1CY2A 2JATA 3WWEA 2VH5R 2ATVA 2R9VA 1OFHA 2YZ7A 1XX6A 3AIMA 4RMJA 3V2UA 4FTWA 3BWXA 3EVCA 4Q9IA 4OLBA 1GPWB 4TTPA 1G3IA 1JA0A 2PYDA 3C7TA 2XD4A 4IR7A 3U4CA 4Q1FA 3GWZA 2XZOA 4ONEA 1I6MA 5BWBA 4RV5A 1HDOA 2A5GA 2CDAA 3UJNA 1DQSA 4FZ3A 3CKMA 3C87A 1IN8A 4NLLA 4H77A 4LOJA 1WQ3A 2RAPA 2X6QA 2XNCA 2Z8YM 1HDIA 1TT5B 3VC7A 3EGIA 3ZKWA 5BRJA 2H92A 3FHCB 3QOWA 1DTSA 4L9AA 3O4GA 4JIGA 4F21A 4GC5A 1P1CA 4HLNA 4TTAA 4Y2TA 1KDVA 2BE9A 3IBGA 3RRFA 4CM8A 4E7PA 4C4YA 2NO5A 3HJBA 3CX4A 4I6GA 4LHYA 4RV9A 2F17A 3BWVA 5JCJA 2A33A 3QFSA 5ADHA 2PGIA 3HUTA 4DBZA 2G77B 5FPQA 1TK3A 5CT8A 4K3VA 1G8YA 1JT2A 3ORHA 4C43A 2BPOA 5JBIA 1X7WB 1G4UR 2DYKA 2IL1A 3SEZA 1I1NA 1OW3B 4JBNA 4Q3CA 4OGKA 4MI3A 1JXQA 3U19A 1X19A 1FFWA 1X1QA 2E89A 2X2OA 2P90A 5E1DA 3RSSA 4BBPA 4C87A 5E2BA 4DRXA 1BEUB 4BMPB 4HNTA 3V1YA 5EHZA 2O9JA 4BLOA 2DTXA 2G6TA 4XX0A 5K3FA 4FONA 1GNTA 3BCRA 3I4CA 4TV8B 4U39A 1UJ2A 1YVRA 1SB8A 5EKSA 2PFKA 5D3MA 4YTEA 4ZCPA 1QDLB 4BAGA 1HE5A 2QZ9A 3VA7A 3MJVA 1WZUA 4U5QA 1AHPA 4H15A 2LBPA 4YYEA 4I50F 1D03A 1QPBA 2KBEA 3P7MA 3K3PA 4RPIA 3IIEA 3PNVA 1RJFA 2GCEA 1JBEA 1JQLB 2P2YA 3NU1A 4ENTA 2IS6A 1HTTA 4MZXA 5J2TA 3WL8A 3MGGA 3LFHA 2BRUC 5I6DA 2A54A 2Y1XA 4OY3A 3KOZA 5LB2A 3B85A 2DHEA 2G4LA 4DIOA 5B37A 2H2IA 1WB5A 1E69A 2W48A 4E1AA 3EYAA 4ZK2A 3T41A 1Q0PA 2CHGA 3W7AA 2Y93A 4TV9A 2D06A 1GAJA 1Y8RA 3JY6A 4BLRA 3OAAD 4Q6WA 3ZH9B 5B57C 5JAZA 2XDQA 3I83A 3PQ2A 1DJNA 5HYVA 1H0HA 1QCYA 5KKCA 2QL7A 2V0NA 1LJUA 4ESVA 1A69A 1UH5A 2FXVA 3FHLA 3GLIE 3N0WA 4YAIA 3NDPA 4JB8A 1SD2A 2DH5A 3L8ZA 1RQPA 2JGNA 5LZ5A 1PQUA 2JFBA 3TLGA 2A1UA 1MPTA 3L93A 4O25A 4XW2A 4D3YA 3BDVA 4REOA 2ZQ5A 3CR7A 5C52B 2TSYB 1JQBA 1UQRA 4F92B 4RIIA 3IVGA 2DUMA 2H3HA 4MKIA 4LX8A 3GVHA 4BB5A 1C7JA 1PEKE 2XITA 3DE2X 4NY1A 2GZHA 2YN2A 3ZCSA 2IUSA 3N39C 2MSEB 3M1AA 4I8XA 2EFHB 2V54A 1SKBA 3ISVA 1XRJA 3BMXA 2JGFA 1MW8X 1I80A 1Z6QA 3CR8A 2GXSA 1J2RA 1DMSA 1QIMA 2G1JA 3CKKA 3THXB 1P62B 4UHDA 3S5UA 2WFZA 3M9WA 2RBKA 4ZVTA 5IXYA 1ZWKA 5IDWA 5KKNB 3FWNA 2BUAA 4G67A 3M83A 2JCVA 4Q12A 4TMWA 4QULA 4E4YA 2PD4A 2NSYA 5TGDA 3EIOA 4G8BA 1U8AA 1GT6A 1JGTA 2L42A 1TPYA 3EXAA 4W63A 4RHXA 4Z4EA 2IU3A 4OFWA 4DJDC 4F2WA 4RD6A 4DADA 3GB9A 4MRPA 1ZWLA 2CHQA 2J5KA 3MBOA 4FX2A 4Q4AB 2BT4A 4NU5A 4Q9AA 1KRWA 1SVKA 2OV3A 4OJNA 1XELA 2OG2A 3DE7X 4RK6A 1AGXA 1O97C 5CDFE 1G7SA 5MF6A 3HJHA 2GYUA 2RB5A 3M6XA 4RZQA 5E7JA 4ZCSA 3ZEIA 2EG9A 2ZTVA 4M38A 2B1GA 3VZRA 2RJOA 2IEGA 2B0CA 1G16A 4WKNA 3F8SA 5F9FA 4DYDA 1FBTA 4JOCA 4TKUA 5BN4A 1WLYA 1XVAA 2VUHB 3TX2A 2H4FA 4CNQA 4UUPA 1HMYA 2C2BA 1UJNA 4IDQA 2VK2A 3EG9A 1B8NA 1D8AA 4IWYA 2NYRA 2Q6IA 5FHQA 3V4RA 5FTNA 3BHMA 2B1IA 4PC1A 2WU0A 4UHHA 4N8EA 1UAGA 4BIIA 2PIAA 3LKBA 4YRFA 3QBDA 4NYIQ 1JIIA 4GRDA 3FJOA 5JRDS 4RZ2A 5HF9A 4U2CA 2KB0A 3FLMA 4KGZA 5KDDA 1IG0A 1PNQA 2QTWB 2HEIA 2I9KA 4M6WB 4ATNA 1HRDA 1NULA 3GDWA 4G2NA 3WA7A 4UQPA 2AVNA 3RYCA 2QLNA 3UJCA 4EKEA 3FMPB 3CT6A 1MX1A 1VGRA 4EJ2A 4Z3KA 1MPXA 3LUAA 1ZI9A 1N9KA 4MUEA 1NMZA 4HXYA 2VDJA 3FCCA 3ORSA 3JZMA 3PSAA 4B6PA 1E2QA 2UYQA 4Y8VA 5FFNA 1ATZA 2IGBA 3UTCA 2P69A 1C3JA 4BNZA 4FFRA 4F3KA 3UG6A 5BVHB 3T35A 1UZLA 4CUJA 5JVDF 2W2QA 4ZYUA 3IXMA 8ADHA 3RW9A 2AFIA 4CMIB 3WMGA 3F3YA 2QVLA 2RI6A 1M74A 1WE2A 2ZXFA 2AI1A 4TWRA 5AW4A 2VPTA 3EEYA 4OXQA 3UICA 1JHAA 4U7HA 2VN8A 4JYBA 3T7SA 1POXA 5CM8B 5K05A 1EUCB 1IPEA 4JLDA 1NW6A 1VCHA 4DA4A 1TZMA 1EAYA 4PHTA 1UPBA 5DJ5A 2QNRA 3OT1B 3M0EA 4HH3C 2PH1A 2CVQA 4L78A 5DLQC 3B20A 5ES3A 4Q3OA 5KYYB 1L3BA 2GZ2A 4LJ5A 2PBFA 1CIPA 4H16A 4RNCA 4LZPA 5D00A 3G2QA 1M8PA 3VKUA 3MCAA 1BEZA 1JAZA 4QPPA 5I4CA 4BV9A 2XRFA 3QXHA 1KK1A 2ZAYA 1CQWA 2AG0A 3W8EA 4Z1OA 3STYA 2JARA 4Z2AA 5BXQC 2ODNA 4I3FA 2BSQA 1PWEA 3PXEA 1Z2CA 5A6SA 4Z0HO 4QYMA 1U3TA 4PGGA 1INLA 4EVRA 2A5YB 2FG6C 3GWGA 5TNXA 4E11A 2AJLI 3GA7A 3JALA 1UQUA 3LPLA 3QWFA 1P4GA 1F0NA 5FADA 2PUGA 2C5FA 4I9GA 2PMKA 4GSLA 1F48A 1E3EA 2FJ0A 2OK7A 4MOWA 4MRMA 4MWSA 5I3ZA 4DA0A 4YMGA 4B9AA 5KTSA 4D74A 1ID8A 2J5BA 4V0LA 4BNFA 2FZ5A 3MLAA 1WU7A 2GNAA 3DOIA 4QYSA 2F1JA 3ZZ1A 4MVJH 3NYWA 4BEJA 1DFIA 2BUCA 3KD3A 5JFOA 5ICGA 3C14C 2A88A 3HO8A 3IT2A 1S3GA 1XYVA 4HGQA 2CB0A 3NTUA 4NESA 5LB4A 5KMGB 4KGVA 1QH9A 2IW1A 2G76A 4N82A 2CZGA 1FSZA 2F2TA 3K32A 4TXMA 3DTNA 2C2OA 3BA1A 3ZIAD 3I5YA 2C78A 4QATA 3ISTA 4XPZA 1NMYA 3DWGA 3PB3A 3UBMA 4QGGA 1XHEA 4GVLA 3V1KA 1NFQA 2Q5JA 3B7WA 4O4IF 4B47A 3UK2A 1T8WA 1Z5NA 4ENSA 3OLWA 1SKMA 1U7PA 3K15A 2WDPA 4O4LB 4UUMA 4EX7A 4UTRA 3ZDAA 3FDZA 3GUCA 2P5SA 1ZQ9A 4ML3A 1RRMA 3NTQA 1DRJA 2QUKA 5FO0A 1N2OA 3T4EA 1B0PA 3HDHA 2FX3A 4LCBA 1D6NA 5H68A 5FBVB 2PKWA 4P0TA 1FXWA 1YKSA 2FCRA 3FWYA 2WV7A 1RLMA 4FKBA 1KQGA 2DHRA 1NYTA 2R5FA 2JLXA 4M1OA 1TA9A 4JVNA 1LS6A 4LVOA 4CMCA 2XGSA 4KYUA 3ZE8A 1H42A 5AI0A 3MM4A 5LU9A 4DR1B 4TS1A 2R00C 1CJCA 3SBDA 1D2NA 2PKRA 4NCKA 1DWOA 2Z3WA 4RS4A 3ORYA 1ZY2A 4QQNA 5DM1A 1G2QA 3MELA 1F2VA 3FNHA 4GICA 3FYTA 1A9PA 4WD3A 3RFFA 2AN4A 3S1AB 4KJXA 1BX0A 4CUKA 1MJGA 1IBLB 3FTNA 3GDGA 2GAIA 4LOIA 3GJYA 2FETA 5A5DA 2X4IA 1NOKA 5GOZA 4TYQA 4ZEOA 1OYYA 4EABA 4GOND 4HWOA 4DC1A 4EB6B 4XVQA 4OHFA 2NW6A 2AH5A 2XNJA 3WK4A 3UJAA 2VNSA 4XQGA 3W1VA 3EPJA 3PVSA 3RWOA 4PF1A