2A84A

Crystal structure of a pantothenate synthetase complexed with atp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
277
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantoate--beta-alanine ligase
publication title Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 88
structure length 277
sequence length 287
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a84A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a84A01
2J07A 2A1TR 2YXNA 1NURA 3S3TA 3UMVA 1WXEA 1NUSA 3FG9A 4J76A 4JFAA 3FIUA 4CT0A 4MW5A 3P0IA 3QE4A 3KT6A 4EG8A 4ZCRA 1YIDA 3PXUA 4PBTA 2A1UA 4MWDA 4MUIA 1NYLA 4MW4A 4OUDA 2QUKA 1QU2A 2QJFA 3IUBA 1I6KA 1MAUA 1PG2A 2CYBA 2YWCA 2ZUFA 2GKSA 3N05A 4HJXA 5K0TA 1IRXA 2X3FA 2JANA 5HUJA 3SDBA 1O0BA 4KR9A 3ELBA 4TS1A 1ULHA 2XRYA 3N8HA 2PZAA 4ND7A 3ND5A 3Q10A 1EFVA 3MLBA 4U7JA 4MVYA 3VRHA 1GTSA 1OWPA 1M8KA 3HZRA 3IOBA 1T6YA 3UOWA 3AL0C 1P7PA 2DR2A 2PZBA 1XNJA 3GLVA 4KR7A 1U7XA 1N75A 1IH8A 3FI0A 3SEQA 2D13A 1TQ8A 1KH1A 1XNGA 4R2MA 3ND7A 5FO0A 3QTTA 1M83A 4PBRA 3FETA 1IQRA 1T6ZA 1X6VA 2DXIA 3COYA 1TEZA 2HZ7A 3H05A 4MUKA 3SP1A 3FOCA 3P0HA 3A2KA 4JYZA 1M8FA 2CSXA 2E21A 1TYBE 3CLTD 4PY2A 4DDKA 4DLPA 2CYAA 2PZ8A 4L2IA 1K97A 4EG3A 3VGJA 2DETA 1FFYA 4ZCQA 1N2BA 2A84A 1JEEA 4ND6A 4JZYA 4KR6A 1MBZA 3PNYA 3FNRA 4DE5A 1JILA 4A91A 4K0RA 4ZT2A 1N2OA 4DDHA 2OQ2A 2CYCA 3IH5A 4ARIA 1EFPB 4MWBA 1S4MA 1WXIA 1G8HA 4RUKA 4MVXA 3TZEA 2RE8A 3COVA 5FNZA 3H9CA 3UC5A 4E1AA 1OWLA 1KP2A 2JAXA 4MW6A 1KQNA 3E27A 1G8GA 1KP3A 1IFXA 3U1VA 1O96B 1OBHA 4GRIA 5FO1A 1M8GA 3CLRD 2O8VA 1N2IA 1J09A 3CLRC 3COWA 2WSIA 2YY5A 3PNVA 5K0SA 1N78A 1X8XA 1T9GR 1J1UA 1NZJA 2AG6A 1NP7A 3ZJUA 1IQUA 1KQPA 2G36A 1OWOA 3K9WA 3FDXA 3QTBA 3CLSD 3IOEA 4NDAA 5J5AA 4HJRA 4F3RA 3COZA 1TYCA 4MVWA 2BYTA 5DEOA 1BS2A 1LI7A 3X1MA 4DNXA 3RFFA 1T6XA 1QRSA 3IMCA 3IDFA 2QTMA 1PFUA 4U8HA 5KHAA 4MWEA 3OTWA 1OWNA 3RHSA 4ZT6A 2H29A 1JEDA 4EGAA 2EL7A 1ILEA 4R2LA 2AKEA 4MUFA 4EF6A 4HK4A 4MW7A 3P0JA 3SZGA 4ZCPA 1O94D 1A8HA 1O94C 4G6ZA 3IVCA 3IMEA 3X1JA 1UFVA 2E89A 2A1UB 3SYTA 2EJCA 1WJGA 2A86A 2O5RA 3TQOA 3KT3A 1KORA 1QNFA 3RK0A 2VXOA 1PFYA 2A1TS 3ZIUA 1N2HA 3CLUD 3BL5A 2R5WA 4YP5A 3AG5A 3FWKA 2QTRA 4NATA 1O95D 1JIJA 4MUJA 1PFWA 4U63A 3HFJA 1GN8A 1K4MA 3F3MA 1EFVB 3ZUGA 4EG1A 1PFVA 5IHXA 1N1DA 4WSOA 1I2DA 1H1TA 1V8FA 5J58A 4MUEA 4PBSA 2VTBA 4MWCA 1EJ2A 4J75A 1NUQA 2QUHA 3Q4GA 3H9BA 1KH2A 1OD6A 2CFOA 3G6KA 1VBKA 1J70A 1ZJWA 3CA8A 4QBTA 1YUNA 3H99A 4X0EA 3MUEA 1V47A 3NV7A 1KAQA 1U7DA 2HMAA 4ZT5A 1GLNA 4I6EA 1R6XA 3NBAA 1VBNA 1MC1A 5HUHA 3ISJA 3FH0A 1TFUA 5TGTA 1COZA 1D2RA 3CLTC 3TQIA 4L2IB 3KT8A 4CQNA 4MQ6A 1KQOA 3N2YA 1JIIA 3TZLA 3ILVA 3GUZA 3MMXA 1F7UA 3AKZA 1XJQA 5TS2A 3CVYA 3KT0A 2Z3VA 3G5AA 4S1OA 4ZT7A 1WXGA 2QJOA 3HL4A 4CDMA 4MW2A 1M8PA 1NUPA 3L92A 1PG0A 3DV2A 2CV1A 1KR2A 4H3SA 1CT9A 4MW9A 2TS1A 4QRDA 4GU5A 2XRZA 4AS1A 5DB4A 4EG5A 1GZUA 1Q15A 4ZCSA 4F4HA 3UK2A 4K03A 2X1LA 2D54A 2X1MA 3ZGZA 1ZUNA 1JHDA 1N2EA 3VU8A 3Q12A 3RJZA 3RK1A 3G59A 1WZ2A 1GPMA 1Q77A 1JIKA 1N3LA 1QRUA 2I1LA 4UZFA 3ZJTA 5F23A 5KCMA 3ZXSA 4ZT3A 3K32A 2H2AA 1NUTA 4HPWA 3C8ZA 3CLSC 2PG3A 2V0CA 4MLPA 3ZXIA 2RD2A 3FHJA 1EE1A 4MUNA 1VBMA 2DPLA 5LLTA 4DDMA 1T9GS 1JECA 4AQ7A 2PIDA 3PRHA 1NI5A 3IVXA 4MULA 1K4KA 2CV0A 3JXEA 1H3FA 1R6TA 4MUGA 1F4LA 1EXDA 5AHWA 3M5WA 2D5BA 4CDNA 5LM3A 3LE8A 2DERA 1OWMA 4YP6A 3IMGA 1KH3A 4RPIA 3H97A 1H3EA 3HGMA 3IUEA 2HGZA 4KPUA 3CVVA 4XFDA 1IQ0A 4XSVA 2GOYA 3SEZA 1QRTA 5BNZA 3AG6A 1ZH6A 2A4MA 4OUDB 4XFJA 3HMQA 3UY4A 3D6VA 4NAUA 4EG4A 1IHOA 1RQGA 4OJMX 2E0IA 1XNHA 3CLUC 1LW7A 1B6TA 1YIAA 1EUQA 1QU3A 1MOPA 1JZSA 1MRZA 1O95C 3CVUA 3SZ3A 1R6UA 1WY5A 4FZJA 4Q93A 4YMIA 2WQ7A 4MVCA 3GMIA 3AIIA 2Z09A 3X1KA 4Q16A 2VTBB 1SURA 4I6GA 1QJCA 1J21A 1F7VA 1Q19A 4YP7A 1TYAE 1N77A 1O6BA 1K92A 1JMVA 4I6JA 3FY4A 3D6UA 2ZP1A 1IVSA 2IJGX 5HG0A 1Q11A 3DPIA 2DLCX 1NSYA 1KKUA 4QREA 1MAWA 3CVWA 1WOYA 3TNJA 1LI5A 5KWVA 1O97D 4WNYA 1MB2A 1O97C 4MUHA 3ND6A 4MW1A 1HYBA 5IJXA 5JBNA 4G5FA 5DK4A 4EFKA 1I6MA 1YULA 4EG7A 4ZCTA 1G8FA 5H7XA 3INNA 3MLAA 3RBAA 1YI8A 1VL2A 2E18A 2C5SA 4MAFA 1WXFA 5LFAA 4MW0A 4KKVA 1TYDE 1WXHA 2IELA 1N2JA 3N9IA 2A88A 1U0BB 5TEWA 1WQ3A 1NUUA 2QUIA 2JA2A 3DLAA 4G5YA 4ARCA 2B7LA 2CV2A 2V0GA 1J20A 3AFHA 1J1ZA 5J59A 1FYDA 1MB9A 5DASA 3A05A 1M8JA 3PNBA 3LOQA 5EKDA 1ZH0A 3CR8A 4BWVA 1G59A 1H3NA 1DNPA 1EFPA 1U3DA 4DJAA 1Y42X 1GAXA 3HV0A 2BTEA 3MXTA 3I05A 1WQ4A 2J09A 1KAMA 1O5TA 2DEUA 4R0NA 5H16A 1U3CA 3A4IA 2J5BA 4P2BA 1O96A 3TS1A 1N2GA 2AZXA 1M1ZA 1JGTA 3NBKA 1O0CA 2J08A 3L93A 1WKBA 2QTNA 2A7XA 1F9AA 1MJHA 3DO8A 4ZT4A 2DUMA 2CUZA 2CT8A 1I6LA 2GM3A 2NSYA 4NX2A 4YBRA 4NZPA 4EG6A 1YUMA 2NZ2A 2WQ6A 2Z08A 1VLHA 2WB2A 2J4DA 2IP1A 2X0KA 2QJTA 4UZEA 3P52A 4JXXA 1OBCA 3ZJVA 5TEVA 3KFLA 2YWBA 2PFSA 3CVXA 2ZUEA 1QTQA 1QQTA 2PXHA 3IOCA 4KPUB 4JXZA 2OV4A 1JZQA 2QUJA 3IODA 3IVGA 3A04A 3LCJA 4NAHA 3OP1A 1GTRA 1EUYA
chains in the Genus database with same CATH superfamily
2HF7A 1VQ1A 2J9RA 4K6FA 4KN8A 1Z7BA 5TDHA 2BUBA 4OAPA 3OZVA 1XZQA 2D2VA 2L2QA 4C4AA 4CLHA 2PH1A 4MQLA 2O8EA 2I4RA 3GFSA 4CE6A 4TS3A 3IIIA 1UPAA 1IJFA 1CD5A 1KNQA 3DFUA 4NPCA 5K4GA 3IILA 1ENPA 3RNOA 1HE4A 1ULUA 1Y7HA 3HJNA 4HAZA 4HD8A 4PBTA 3UANA 4MUIA 1AXGA 1PZEA 5KX5F 2XB6A 2Q4DA 5A4JA 3WK8A 5LIRA 1TZMA 2C88A 1RCFA 2OCLA 3H8WA 3UA3A 4JKOA 4TWAA 5AW6A 4LY9A 1OFGA 3TBKA 4GXNA 1U1GA 1YR3A 2IA5A 2C4VA 1GUZA 4H17A 2ZG6A 1ML4A 3FWHA 4TZ0A 3W2IA 5K3BA 1ZMTA 4XCVA 1DBVO 2ARKA 4DA9A 4KR9A 1OXXK 4BDSA 1YTUA 4PF1A 1GTVA 3UAZA 1H5UA 1C8BA 3N8HA 1RKQA 3K2EA 5AM5A 4WLVA 4DMUB 2Y0PA 2EFYA 3I9MA 4FJ0A 2R87A 4TQUS 2LGJA 3HUFA 3M9LA 3SHFA 3IP1A 3F2IA 4NWIA 1G4HA 2QQ0A 3ENQA 3HWSA 2LR0A 3EVFA 4OG2A 1P7PA 1Q92A 2Y8EA 3MT7A 3DB2A 3GNTA 2WE8A 5ALPA 4F6CA 1QOQB 2BFNA 3OQHA 1YF3A 3GJSA 1Y98A 1S4QA 3KCNA 1T8UA 1TD9A 2Z4SA 3G9XA 4DARA 4TV9F 1DG3A 4ZVLA 1WZIA 1J0EA 3DTTA 4R2MA 1Z0AA 2RHGB 2ETVA 3AFMA 4GRAA 4PBRA 3FETA 1JQ3A 4C5AA 2CL7X 4ZK6A 4TMTA 5BV0A 2FJ0A 4K9OA 4LJYA 4NNPA 3VPHA 1CZHA 5F9HA 2F8MA 1Z0SA 3RTGA 3R76A 3RUIA 4EH1A 1VIMA 1C0LA 1EUDB 2W00A 3MCVA 4LNUB 4MS1A 2AJBA 2GN4A 4E5YA 3GJ8A 5EXTA 1MH9A 4LHWA 4B9AA 4ACAA 1NNLA 2Y66A 4XAQA 1OX4B 1Y6RA 2VDWB 3HR4A 2DWCA 5IBCA 5BNTA 3B1VA 1J8MF 3PWKA 2ZJ0A 4BC1A 3PFGA 1US8A 1OF1A 2QL7A 3CN7A 4NVRA 3FB1A 3EW9A 3BA6A 3AF4A 2ZWMA 2EATA 3D6FA 3M89A 2XGOA 4JZYA 4O59O 1TTHA 3T0IA 3SZLA 3GZJA 4PE5B 2C2WA 3DEHA 1VIYA 3IUNA 4HC4A 4B87A 4ZEVA 5BPHA 5EJ9A 1RWBA 4PYQA 4DJEC 3OF3A 5KPDA 4LV5B 2XOKD 2FPPB 3G5LA 3GU3A 5JMOA 3HBJA 4L0MA 2CJYA 1KMCA 1YASA 2PX2A 2JAHA 2VO1A 3KD3A 3P0EA 3M3HA 3H19A 4PW0A 2BC9A 4Q39A 3DJYA 2O07A 4YONB 3UWPA 4ZYTA 4NCAA 4MW6A 2O52A 1Z7WA 2JA1A 3G2KA 4RK4A 2JLWA 1FSGA 2XT6A 1GTG1 4FNAA 4RK7A 3WTBA 3MTQA 3T4EA 3PFFA 1B26A 1L1EA 3MHPA 4Z8YA 2PA3A 1SBZA 5GONF 2N1BA 2XNCA 3FPSA 2H4HA 3JPYA 1NJ8A 4GYKA 3AY0A 4I36A 1MABA 3PNVA 1OKKD 1SR8A 3PUYA 5DHFA 3N2KA 3E03A 4H1VA 1X8XA 4D8TA 3PX2A 2FQYA 3HKDB 4TUYB 1XX6A 2FFHA 4ETWA 3IP8A 5CB8A 1H4VB 2UDPA 4FIZA 1QHSA 1U0TA 2WZCA 3RKRA 4BNFA 5AK0A 1KQPA 1RM0A 3O8QB 1T3HA 5TV2A 2QX8A 1I1OA 4UEKA 5E95A 1A7JA 2IYUA 2X2EA 2XGGA 2AUNA 3F7TA 3TTVA 2GM4A 4U5QA 5B2ZA 5T3YA 4M38A 4YRDA 3AKCA 4N6OA 1RLJA 4Q19A 5LXTB 2PL1A 5JQGF 1S3SA 3H5VA 4PANA 2B2CA 3AKDA 2ZBFA 4BNVA 1EDZA 1VCNA 3MJVA 2I9KA 4B32A 3D3KA 2XNDD 3K1JA 1U8ZA 3DE2X 5TX7A 2FPWA 5M7EA 4LV8B 4Q18A 3K70D 1NJFA 3SDZA 1G9SA 4EBFA 1NGSA 1TLTA 2J9XB 3AL2A 4CL8A 2P4HX 3LT4A 3R5XA 4IQFA 1OXBB 3W1EA 5IJZA 1QRAA 1JDZA 4MQMA 2I2CA 5BN1A 4ALMA 2H7VA 2WKRA 1CY4A 2ZYUX 3FYSA 1JALA 1HYEA 2PKQP 3GQBB 3LT0A 1DIGA 3LKZA 2W2NA 4WFKA 3WRVA 3DT6A 3GRYA 1O94C 5CVVA 2HF8A 3OESA 5LBTA 2ORYA 2FW7A 1FP4A 1E2KA 5CCDA 4WWHA 2FEMA 1PFQA 3AW8A 2QD5A 1KORA 3PFBA 2RCNA 4E5SA 1GGMA 2ZUUA 4AX8A 1X0VA 4NG5A 4B34A 3QHAA 1M1YA 1V4VA 2R5WA 2XITA 1ISJA 2XVAA 5C8XA 3AG5A 3KFXA 2MOKA 4F5ZA 2H5LA 2ZWIA 4BNWA 1B1AA 1M1YE 2A9OA 2OO7A 3H4IA 5THQA 2NSJA 3DF9A 4KRGA 3WYDA 4NBRA 3F3MA 3S2FA 1LPNA 2PMKA 3QX3A 2FSSA 4L8GA 4LYAA 3OF5A 2FFQA 1PFVA 4WSOA 4UVEA 3CG0A 5HILA 1FX1A 2IYQA 4HRVA 4LJAA 2PKCA 2PJZA 4X90A 2FP3A 4Z9YA 2RJNA 3BT7A 1R0LA 3W2HA 2C2KA 3I0MA 1E9FA 1JEQA 5ALQA 1BDMA 1EJ2A 5CYPA 4N3NA 2M6SA 1YI0A 2QPAA 3SXUB 4BTEA 1L5VA 2ECQA 3PQ5A 4PLCA 5HKKA 4UDXX 5CFLA 3AKYA 4O4JA 1P61B 3OTHA 4DS3A 1VBKA 1DKNA 5B1YA 3KSDO 5FTKA 3N3AC 4XCXA 1WB5A 2A9JA 4X0EA 4AW9A 5KAPA 3ZHCA 3B2NA 3NV7A 4LCBA 2P1ZA 2DRIA 4D99A 1SD2A 1ICEA 1XR3A 3BH7A 3H7AA 1JT2A 3KXKA 1R6XA 3NBAA 1HT1E 2WNHA 3SX2A 2LDXA 4R8SA 5HX7A 1V11B 1QH1A 1VBNA 1WCXA 2PJDA 4NBSA 1VRVA 3FLBA 3NHYA 2R1TA 4XYGA 4QAQA 2ZPTX 4H60A 3AVTA 3E5MA 1VZ3A 4NJEA 5TGTA 3CLTC 5KYNA 1M2FA 1Z0JA 4YAGA 1ID8A 1H0KA 4Y1RB 5GIOE 3G2MA 3IMKA 4E5MA 1ZITA 4UQOA 2WWVD 1ZGZA 2FWAA 3KXIA 4LHXA 4F7DA 2DFDA 1E1CB 2FRVA 3HLYA 1H2WA 1I1NA 3ME5A 3OQIB 1FRFS 2E1PA 4MA0A 2YN0A 4YRGA 1M34A 4P4TA 1JQ5A 3T1NA 2CNKA 1POXA 1VB3A 3CEAA 3A9WA 5I8WA 3C16C 5CCXA 2RHOA 1FE8A 2ISSD 4CKXA 1W9HA 2FEWB 3KR2A 4QUIA 3B9RA 1I5RA 5C37A 4H7JA 3FWPA 2QN7A 3OJOA 2OYSA 1VPEA 2PKQO 5LDGA 3KOUA 4BPRA 1DADA 4NBUA 5JSKA 2RH9B 1DBRA 1QDLB 1Q15A 2EJVA 2EXXA 4EZBA 1NLMA 2VF7A 4LYJA 4UASA 5AW5A 3ZCTA 5MF6A 2ACVA 1Q57A 2ZT6A 4EJFA 3KYBA 4S05A 1U02A 3VM6A 1QMGA 3VU8A 1RW4A 1VJ0A 2DPYA 1QGUA 2AFVA 2Z8XA 1NV9A 1ZN8A 1YR1A 4MWOA 4MYRA 5ERGB 3VC7A 3A6GA 1CQXA 1ES9A 4FJ2A 4IGIA 4UM9D 5CGQB 5JO9A 4B4WA 4RQBA 3WO0A 1X3SA 4CM5A 2AN9A 5JE8A 3G1WA 3R20A 1T5HX 4BVHA 2ZLBA 2OO5C 1LNZA 2Q5FA 1EGAA 4J0JA 4KO1S 4A5SA 4C01A 1KYVA 1XZEA 1E1LA 1W4BA 2EW8A 1L5WA 2Q46A 5CLIA 1QIEA 4EKDA 3EZXA 2EFCB 3IALA 1U8FO 4G09A 3OT1B 1SHLA 3IB3A 1ZSVA 3WICA 3ABSB 1KYXA 2QYSA 1O57A 3LBYA 1Q0QA 4HWGA 1YC5A 3HO1A 3FZNA 3HDHA 3A1UA 1NWCA 3BERA 1SZDA 2B78A 3PL1A 4YR9A 1VCHA 1MH1A 2KI5A 4IIEA 4X6LA 3EHEA 4B6QA 5LD2B 8ABPA 2BFWA 3WADA 5GPBA 2FLWA 3ZDDA 4QVIA 2GEBA 1I9GA 1IBSA 1OZHA 2YV3A 5IW8A 2BVNA 3M82A 1V37A 3OHPA 2C7OA 2JI9A 4Z9BA 3K6SA 1M2KA 1O6CA 2ZKLA 3D2BA 2WYHA 4MV5A 3SFVA 3HEMA 2O2ZA 4HZUA 1U0HC 2YHBA 2MYUA 3F4LA 1VL6A 4XM0A 5IYZF 2HXGA 1QYVA 3UT0A 1CF4A 2XB4A 2W2KA 1SRRA 3CV3A 3H97A 3SZUA 3HGMA 3IUEA 1S89A 3CVVA 3KYDA 3C5VA 4RJKA 2G40A 4K86A 2Z6UA 2VEDA 5HQ3A 3AG6A 2FI1A 3AU8A 4ZQIA 1I33A 2EQ5A 2VRCA 3D6VA 3OOWA 3WO1A 5G41A 1IHOA 5DULA 1GD1O 3BZUA 4JLWA 2FPIB 3PB3A 4NYJQ 1QC5A 4MRVA 4PG7A 1JE0A 4JENA 1BCSA 3ACDA 5LQAA 1YMQA 4MARA 3IHKA 5K3FA 5JQWA 4HEA1 2G4LA 2H31A 2KLBA 1M2GA 3QVMA 3RS2A 1JLKA 3JZDA 1Z07A 3LBNA 5ADWA 5DYYA 4Y9TA 1CYDA 3NEPX 4CTNA 1QPGA 1QM5A 4MI6A 3CVUA 1KSFX 3KQQA 1S01A 3F9IA 3CZPA 1J90A 3LVBA 1ZN2A 2HXSA 2WEKA 3I72A 2VT7A 3AIIA 3SFTA 2XE8A 1JEYA 1I2CA 3QYAA 1GLVA 1N0VC 1RU3A 3QM1A 3A6PC 3OZDA 5KU7A 5KTRA 3MNFA 4ZI2A 1Y34E 4N9QA 4Q16A 5JWRA 4NKRA 1B3RA 3D6TB 1QE5A 2GF2A 3B7PA 4IDOA 2C94A 4MS4A 1VSBA 3RODA 2PLRA 1W30A 1H6AA 5DW0A 1VSQA 4JEHA 2X0EA 3S1AB 4YMUA 2AMVA 1JQKA 1JKJB 1GGHA 4GGPA 2FFJA 4Z2AA 1F48A 1A4XA 4XQCA 1URPA 5EMHA 3FLMA 3CX6A 3O7MA 4HVTA 3L5OA 4D8UA 1XCPA 5D85A 4D5EA 1J5EB 2IV7A 3W9SA 3CVWA 3JQRA 1T0PA 2PSSA 3ANNA 4FFPA 4I14A 3TNJA 3NTOA 4AJHA 4D3XA 5ITSA 5KNLA 1RXSA 3B78A 1CJBA 2VH1A 1Z4NA 3MS4A 2BHNA 4LJKA 3ZCXA 1TVKA 2YWGA 2F1JA 4RLQA 2OD9A 1KBOA 2AE2A 2WQZA 1SCIA 1QLJA 2PGAA 4EENA 3V4SA 2QN9A 2ZUWA 4Q7KA 4LF6B 3L3BA 2PRZA 2DZDA 1A69A 3I9FA 4YAEA 3KR9A 4RVHA 1EP2B 3I6YA 1K7SN 1DRJA 1QCYA 2OVFA 3CW2A 1UXGA 1QYWA 4Q34A 5G53C 1SC1A 2QW8A 4KKVA 2W70A 2GWRA 1NRXA 4LVOA 4J90A 4O4IA 3ES9A 2DH5A 3TEMA 2JF0A 1RXWA 3LK7A 1F60A 5F1PA 3ZE6A 2GCIA 3AM5A 4Z4CA 3CIOA 2VBGA 1A95A 5DM0A 2JA2A 3OF2A 3UK1A 1N57A 221PA 5JFGA 4UBOA 4W5NA 5F7JA 3VU0A 5KDDA 1OZAA 2VVTA 3H6GA 4IGKA 3B3FA 2I29A 2ZW9A 3T38A 1CSEE 2P5YA 1V1JA 3RS9A 5K4AA 1EHCA 3Q9SA 1Y5RA 2NU9B 4BE4A 1GTL1 1SOVA 1M8JA 4EJ0A 2YV5A 2V7QD 2CLKB 1F2VA 2OYCA 4G8JA 5ALEA 1GRVA 3BGSA 4EMSA 3N2KB 1RC1A 4G85A 2B4RO 1NP3A 4OIMA 5TXGA 5KYXA 5BV2P 4P22A 4NFLA 4OLFA 3WB1A 5IM5A 1TUBB 1RWWA 1GOTA 5CK5A 3TCNA 4EFMA 2VAMA 5KIAA 1R3DA 4RE6A 5CD1A 1T26A 4X45A 3RUHA 5TARA 3P9NA 2QMEA 2XGMA 4GVPA 1ZM9A 3FTEA 3QGMA 2N9UA 4FQ7A 4F3CA 3SQXA 5LZ4A 1AHHA 2REQA 2P11A 3C45A 1GWNA 1GDDA 4TLBA 2QNIA 2J3DA 1YBVA 4RWZA 1PEAA 1U4SA 2DWQA 1Y3BE 1EVLA 1ZN9A 2OM2A 4I8XA 3DBLB 4X91A 5DSTA 2A7XA 3DO8A 2CUZA 3Q1KA 3AERA 4N0EA 4RJTA 4PO1A 5IJWA 1COWA 1QDUA 4C29A 2TRSB 1ONPA 1UOQA 1A27A 1YUMA 4NZPA 5J2UB 2P6OA 2LCIA 2HK6A 2Z5GA 3NONA 2E4XA 4DJDC 1EXWA 1KXZA 3C8UA 1WNTA 5EIFA 1OBOA 3LH5A 3RH0A 1QAMA 2WMYA 3PD1A 5DT2A 4ESOA 3SYLA 3D4IA 1PYOA 2R1UA 1M0EA 2GCGA 3KZVA 4MGKR 2VHEA 4Q3OA 2G76A 2QY9A 5LMUB 1Z8FA 5HNKA 2V74B 2YRFA 3F6YA 3HDQA 4KPUB 3MAJA 4BN4A 4CJXA 4ZI7F 1NQAO 5KHLB 3KQLA 5FEUA 1X1SA 1PLJA 5DTIA 1V2HE 3K96A 1AKWA 4CKCA 4D3DA 5IT4A 3I6ZA 1HRDA 1DLJA 1HDXA 1L5YA 3B8HA 1IBKB 1SCBA 3WWYA 3SC3A 1M1YB 1XEWY 4HMOA 4GSYA 4BZPA 2IBSA 5F1YA 2PT5A 1VMEA 2WF8A 3FIUA 1Z7EA 1ZK3A 4C0JA 1YL6A 3LVQE 4J8PA 1NYRA 1ZMBA 1Y9EA 3D1LA 3ELYA 3HO6A 1T13A 1VG0B 1T0IA 3PXUA 3VSBA 2AF3C 3X43A 1K0UA 4BEBA 1LU9A 3K0SA 3S70A 3GGCA 1VPVA 1SIBE 4MWDA 1G0NA 2B3TA 1EXMA 2V6GA 1MC5A 1Z0FA 3QMPA 1NVVQ 1IZ8A 4H6PA 4QO8A 4OGWA 3ZTWA 4LY0A 3RYCA 3DOUA 1JLHA 2ISCA 3H2IA 2DFPA 4R8LA 3U48A 4QVGA 3H84A 4TMFA 2PD4A 2OBFA 2XMBA 4PWZA 1SVSA 4X7RA 3WXBA 1FSZA 2EQAA 3WL4A 5ALXA 3M34A 3ZPXA 5FLKA 3TI7A 3CU5A 2WD8A 1XGKA 3L7MA 4QJ4A 1XDWA 2OILA 1P7VA 2JCSA 3K9GA 1Q0ZA 3ND9A 2VP0A 3JR7A 3U6KA 4M53A 1X1BA 1CRZA 2CVHA 1ZL0A 3HJAA 3I83A 2JFBA 2OSVA 1IHUA 2DWPA 4QHTA 4BNTA 1KI6A 4Q4HB 1E2HA 2CZGA 1ZUHA 2NQ2C 2R1TB 4V2IA 3WWPA 1LJLA 4A23A 1BDHA 2WU8A 3GNSA 4KXUA 2W8BA 1N8TA 5KTTA 5MGNA 2VHCA 4PZDA 3LCVB 5DO9A 1SOWA 1N8KA 4DLUA 1ADJA 4MDYA 2VA8A 4X8OA 3RFVA 3V7YA 3V8RA 4UHKA 2I2BA 3VYWA 4P0PB 1XWWA 2VT3A 3SKVA 4XRGA 1U28A 3CF0A 1Q0RA 2AD1A 3BMOB 3H05A 3VU9A 1OH7A 1B93A 4RPHA 4BC0A 3L1KA 1A5ZA 1XN1A 2J1LA 4HVCA 4CF4A 3RUEA 4LE0A 4PAGA 3WSWA 3GH3A 4GZMA 2L82A 2WTBA 3BSWA 4B81A 4QXOA 5JSQA 1TA9A 2PXXA 2PZ8A 4RHYA 2JLVA 2GCPA 3ZE0B 1TU4A 4EG3A 3IKTA 4OXYA 1L3IA 3GLFE 4I4TA 4YI5A 2IXTA 4FFVA 1LY1A 2FZ5A 1AK2A 3EJWA 4V2UA 4ZCQA 3RPEA 1W0JA 2JI8A 3AHHA 1MO6A 2R6HA 3KKEA 2Q62A 4HB2A 3CNEA 3D2AA 4CM8A 1RYFA 4IJMA 2OQVA 3DAFA 3RFXA 2BKXA 1QGUB 4X62B 2X7HA 4FGZA 1DX9A 3KSZO 2LW7A 3HFGA 4IDDA 5DHTA 4JUCA 3ZY2A 5LA6A 4BJ3A 4D3ZA 3PFHA 4MVXA 2ZJZA 4OM8A 1K27A 3SIXA 4CMKA 4DV1B 3COVA 4CKYA 3JQGA 2EDAA 3R40A 1XSEA 3TD6A 4W7SA 1OWLA 3L8YA 4ROSA 1H69A 5IK2D 4HDCA 4K8OA 4UBJA 1DE0A 1P4GA 1PDVA 2JFWA 5JYCA 1A2BA 1C1DB 5JAPA 3E7WA 2QNBA 1C9MA 4PGFA 3U1VA 4C6TA 3BZWA 4CVNA 4GPEA 2NTVA 1R50A 3CLRD 5CT9A 3H1EA 2WVJA 1WCYA 2Y9MB 3HCBA 2W22A 5DGHA 3DV9A 3ZLVA 3K09C 1QGYA 1WD5A 1Q1NA 1FUUA 2ZIGA 1A2QA 2GDJA 3WJ1A 3WWOA 3I53A 1JXMA 2FVXA 4MYHA 4EB6B 4URYR 4KZPA 2Q0QA 2JZNA 4HBGA 3CRMA 4MITA 5IVIA 4D9KA 2EARA 4KIUA 4KBGA 1IQUA 5B1DA 2QVBA 2P35A 3ULKA 4DMFA 1JDBC 3W5DA 4FFBA 4BO7A 1L5FA 1GEEA 1LDNA 2QI9C 4BQEA 1ZX1A 4W5RA 5KJ1A 4KXVA 4R1PA 4NDAA 5LUAA 4L5YA 4YASA 3LAWA 3PWTA 1ESMA 4N76A 2PGXA 2Q5EA 2H1FA 2Y99A 2IXGA 3B36A 4HLQB 1BS2A 3OQOA 1ZWLA 2J3IA 3LCMA 2GVDC 2H92A 4YJ2F 2G7ZA 4PICA 3EXIA 5REQB 3V7WA 3X1MA 1JAXA 1Y8QB 1CJTC 1AB5A 2J7PD 3KAQA 4GOLD 5IMBA 3PFWO 4YUXA 2GD0A 4DMCA 5C1IA 3EUWA 4E1VA 1ZJYA 1FDOA 3GN2A 3P32A 3ZH9B 3RU9A 4AL4A 1TFRA 1OWNA 3U4AA 5K8JB 4GMKA 1FMJA 3WWEA 5ES4B 5FWAA 1PQ4A 5DGIA 3EWIA 3B9PA 2QRGA 3DKKA 2BBWA 1BCSB 4ZQBA 2ZAOA 1VSTA 2VSFA 1A97A 3PXBA 4C1BA 1Z6AA 3WP0A 4UVGA 5ADHA 1YZVA 4TTRA 5IXJA 1V25A 4AZTA 5B6JA 4GWGA 4G2NA 3T35A 3CLVA 4U0JA 7MHTA 1U9ZA 2ILVA 1ZI9A 1UFVA 1QGZA 1N0IA 1WB9A 4F1WA 2VWQA 5CA1F 1P2DA 2IZ5A 3KALA 4TZTA 3RU2A 2I7CA 3KHSA 3UJNA 3NAQA 3MRVA 1E7YA 1OH5A 2HPZA 3GT0A 3EVNA 2JIOA 2WIGA 3JCZA 1PKXA 2A5LA 4GNKA 4U7PB 4XQ0A 4L8WB 3CX8A 1CUAA 3L8DA 4MS4B 1JR3A 4MV7A 5A1JA 1DAEA 1CUWA 2QTRA 2GYVA 4YV2A 4H7FA 3I6MA 3JZMA 4TYNA 4JOBA 3B6KA 4LNAA 1F8YA 1JR3E 1ORIA 2BEJA 3QLJA 4K0KB 3AHEA 4KXWA 1QCDA 3GAFA 2B4AA 2F1HA 1EZZA 1GGEA 2PZFA 4RTOA 4KFUA 4RKQA 1P0FA 5AWFC 4ARUA 3MT9A 5F3RA 1EU1A 1KJ9A 1V8OA 3QIVA 4PBSA 1V6SA 5CJPA 4DADA 1E3EA 3IV7A 2DKNA 2VUHB 4M8LA 1XZCA 2XUIA 3HP1A 4TV8A 2GR8A 4GYWA 2YBDA 4AJIA 2QUHA 3UCEA 1TVKB 1P9NA 4RVCA 1U2PA 3H9BA 1N2SA 1H0RA 5D7BA 2ZRDA 2YJZA 4ZO4A 1FW6A 1H2EA 1VPTA 4LKRA 1HNXB 3DYBA 4EOGA 4IKOA 4N3AA 4OSOA 1DX4A 4W4TA 5AI4A 1YTLA 3BBLA 1CNEA 4B3FX 4Y1GA 4WKBA 3FVVA 4PLZA 3N2IA 1BHJA 2OCGA 1Y4SA 2EAUA 3TLBA 1LKZA 4O4IB 4RJLA 5LB2A 2LBPA 1GXSA 4UTOA 3A9RA 4A8HA 1ECBA 2XMDA 3DM5A 2O3SA 1I4TD 4TQ9A 3IQWA 5FH9A 4JBWA 3S5JA 3EGDA 3TBHA 4URHA 4YRBA 3PFCA 2QE7D 4YCSA 4GOJA 3GX1A 4E5KA 3RFUA 2JGMA 3PSAA 4RAOA 4C7BA 5GIPE 2GFIA 2IZ1A 3T7TA 1BRTA 4MA5A 4JLMA 5CB4F 4YVFA 5AKHA 3RW9A 4B6EA 2BI8A 4LWQA 1NVWQ 2O05A 4FR5A 5IAGA 4CM7A 3EOAI 2XHZA 5I01A 9GPBA 4CLOB 2RGRA 1I7LA 2OBMA 1U7HA 5KYWA 1R8JA 3U7IA 2YHSA 1DB3A 5EMLA 2OFXA 5G1NA 5AT1A 2XUZA 4FONA 2AZ4A 2OSBA 3CKLA 1AOXA 2P9TA 1ZUNA 5JVDA 3TN7A 1RXEA 4M88A 4H1UA 1DARA 3MQ4A 1ABEA 2OWEA 1CFJA 3IERA 2OO3A 3A6DA 3AERB 2ECFA 3IPYA 4OATA 5HZKA 1Z38A 5I7FA 5H8WA 1ECLA 2X8JA 3JATB 1P0IA 4CUJA 1C7JA 9LDBA 2JI6A 1MF7A 5H83A 3R0QA 1QNLA 1GVNB 4BIIA 5C7LO 5IAAA 1D1SA 3U4MA 1ISMA 2YFQA 3N0XA 1RHKA 2JLSA 1EWVA 2BHSA 4BEVA 2A5YB 3THWA 3ASVA 3QFSA 2RD2A 1J22A 1YBFA 5I5GA 2WNSA 4IEFB 4L0DA 4RTNA 5DTQA 4Q9LA 2A5FA 1IZ9A 4L5BA 5GZ3A 5HPYB 5HIJA 1XCBA 1ODLA 5LLTA 1T9GS 4JS0A 3S99A 5HTKA 3KYJB 3PRHA 5CNIA 3VSEA 2B21A 1B14A 2B7CA 3BMQB 4BQFA 5A5DA 5BVGB 2AS0A 4KO3S 2VNAA 3TL2A 3HMKA 4IRUB 3UWOA 1YA4A 3L0YA 1ZCBA 1SBYA 4M8IA 2BH9A 1X8JA 4Y9RA 4C4YA 2HWWA 5JJLA 4ILKA 2XZPA 1C3JA 4XSGA 5ESXA 2DPGA 2JIBA 1C8KA 5LM3A 5AH0A 3H87A 4IXNA 1C9YA 3HXLA 3INTA 5KOIA 1G42A 4D80A 3F1KA 1OYYA 2ENUA 2VUIB 1R9GA 4NCNA 2VDUE 5JS8A 3LNCA 4YDSA 2W6PA 1ZKMA 3LS2A 1CJKC 4WJLA 1QIMA 2QSZA 5EIEA 3HMQA 3QOFA 3UY4A 5KKCA 4FBLA 1ABBA 4YGXB 2Z2ZA 2FETA 1LPSA 2VIIA 1UF9A 1IC6A 3N6VA 4Y98A 4RPKA 2CLSA 4EFLA 3D0RA 2XT9A 1BVHA 2JCGA 3BQMB 2C59A 4ZP1A 4IIBA 2ZTMA 1QU3A 4B85A 3WIVA 1JZSA 3RC2A 2R6ZA 3PFKA 2NT4A 2YRWA 5JNWA 2NQTA 4NHEA 1RR6A 4KH1A 4W99A 1WL8A 3WL7A 1WW8A 1W36C 3MTAA 5IAEA 3I3SR 1CUHA 2BKVA 3AEQA 3QUAA 4B6OA 5BWCA 4LZNA 3WAJA 3P9XA 4GICA 2A4KA 3LBFA 2FYTA 2G63A 1ULAA 2ZRHA 1G38A 2W8BB 1A9TA 3TLZA 3IJEB 1JV2B 1V39A 1CNFA 2CL5A 2I62A 2C2BA 1UDRA 5BW0B 3LD9A 3MRTA 3NHRA 4FOPA 4LRQA 4YP7A 5A9TA 1E1KA 4DLSA 4IMJB 1PK9A 1PS8A 1YHZA 1B8VA 2HIMA 4W9RA 3PCTA 2NZJA 3OA0A 1NY5A 5HG0A 2IOHA 3G13A 1D2CA 1RI2A 1KKUA 3L0CA 4BZZA 2YOGA 4QHYA 3RK4A 3LX5A 4ECEA 2O5VA 4TTJA 3WLFA 5IVPA 1LI5A 3BD7A 3HB7A 5AXBA 4YDQA 2ATIA 4FYWA 1Z82A 3GLFB 1MB2A 1TGYA 2NADA 4BNMA 3UH1A 2HI0A 3AR2A 3NP7A 5IJXA 1VECA 2WSSD 4C88A 4Q3AA 4N39A 4I3GA 1ZMRA 2DMRA 4U6NA 4ZEXA 4HVLA 1YE8A 2PS0A 3A3OA 3GD5A 3GLTA 4YO7A 2XIJA 4KQ1A 2RGAA 5FPQA 3ITKA 4ZKDA 2BEKA 1XCOA 1A8IA 3AZQA 4KE7A 4PCVA 1LF5A 5GVRA 1CB7A 1JWLA 1ZR2A 2PGDA 2PCLA 5KBYA 3HK2A 4YQFA 4FZVA 1A1SA 1LTHR 5LA6B 3CWZA 1WQ3A 4NESA 2BR3A 3PIDA 3E9QA 2CLDX 3EVEA 2QUIA 3HKBA 2GK3A 3DGEC 1BMDA 2MMCA 3UT6A 1GA6A 4XIFA 2QSUA 3S55A 1FY2A 3Q7TA 1JKXA 2V3CC 1B4DA 5IP5A 4ZVOA 2ZRNA 4S2EA 1L5ZA 4JB8A 2QGZA 4C6TB 1MXHA 1GUBA 1UT5A 2A3NA 4NQRA 5C35A 3TSOA 4A82A 1UBTS 2F64A 3O1JC 3OCCA 3Q7PA 3MMSA 4RA6A 4DLYA 4DM7A 4HDOB 4TL8A 6PFKA 4ER5A 1NF3A 3HXMA 4XA8A 4X64B 1AF4A 4S04A 3G7UA 3L8ZA 3E81A 2VNJA 1C4WA 4CT4B 5TF0A 4HQ0A 3NH9A 2H08A 5JPDA 5ECWA 4DUGA 4BUJA 3FMIA 4G2TA 2ZATA 5B58T 2WV7A 3ZXYA 3K72B 2CL6X 3EFOA 4IJ5A 4RGQA 4B3JA 4R0NA 3WAGA 4ENWA 3O94A 4IUBS 6CHYA 4G0VA 3OPYI 4F3KA 3E58A 3ZHSA 3WYEA 2O3QA 4YRQA 2WJIA 1UBFA 3KSMA 2HLNA 1L5OA 3ONVA 3H1PA 4LJ5A 1J97A 3EXIB 4R2KA 2C7QA 3X2EA 3NFYA 2Y76A 3R9WA 4L9WA 1T8YA 1ZH4A 3IIJA 5EWJA 5EZYA 4MMYB 1DXQA 3SC2A 1F06A 3PYMA 1YRQA 1OLUA 5DTEA 4QUDA 3WKDA 1UT6A 3WMGA 4Y1EA 5A3QA 4UZSA 1W6UA 3ZHBA 2I65A 2OQRA 1LS1A 1Q12A 1K3FA 2JFNA 3FX2A 1GFZA 4BNYA 3SKXA 3R9XA 2AC4A 5AKGA 3B3QA 1GIAA 1T5LA 2YWBA 3B7WA 4Q1FA 3RRZA 4ZYUA 2BL4A 1OH8A 4JX9A 2PXHA 5CVJA 1KDOA 4N3BA 3U3XA 5CVTA 3Q3JB 1U2TA 4DNQA 1X70A 1Z4LA 2W6IA 1NA5A 5FPPA 4GR5A 5JS1A 1MFPA 3H2SA 4MCJA 1Y4AE 1XTVA 3RC9A 3RFCA 1SK8A 1D0VA 3KBBA 3B1WA 3UMGA 3G0HA 1FDTA 3OC6A 2WM8A 4IIJF 2HQ1A 3ZWKA 1H93A 1YS6A 4MTLA 1JSLA 3FFTA 3JYHA 4J76A 3RYHB 3IE0A 3S2EA 1EK1A 1EQAA 2ANBA 1SXJE 2G06A 3EY4A 1IZ0A 3B52X 3RIXA 1V5IA 1SAYA 4TLMB 1K8ZB 1YIDA 2PZGA 3D8UA 3G0DA 4P53A 3R74A 4DZTA 2HWYA 5CX1A 1NLFA 4HDSB 3HYSA 3PC2A 2CNWA 5FT9A 1P0QA 1NI3A 3BRSA 4H27A 4BAGA 1QHIA 2YWCA 1MAAA 3EG9A 2BHRA 2CWWA 1SUPA 2JANA 2K7FA 2OL4A 1MQSA 3IA7A 4HDRB 3W9BA 3GG9A 3FYUB 1RHMA 4A27A 3DNPA 5EE9A 4F4UA 1SCUB 1UK6A 2CFIA 5BMVB 1W5SA 4F4IA 2BHLA 3LZDA 4RL4A 1I0LA 3Q10A 3HKEA 4JKYA 3H2JA 4PN3A 3PNPA 5EWMB 3OFKA 5F1OA 2BE9A 1CRQA 4JQSA 5FBLB 2X22A 1ATZA 1DV2A 5CA0B 3U56A 1B6SA 3M49A 3N76A 2I8AA 4DQ0A 5EESA 4B6SA 4EY7A 1M2WA 2O8CA 1BTOA 3A3YA 3TE7A 3KKZA 2ZRJA 1P4HA 4C6SA 1XROA 1LSUA 1TM4E 1CF2O 3PE6A 1TQ8A 3ZU2A 3TG2A 2IOFK 4JQCA 5A0TA 1FDVA 1LBQA 1D7AA 7AT1A 2A57A 2VXBA 3PKIA 3WBBA 3NDPA 1DAOA 3JPWA 4B6JA 1QYDA 5B4UA 2Y0BA 3KKPA 3NHMA 4I3HA 3COYA 1XQ1A 3KUUA 3K4HA 4LPSA 1AY0A 2R60A 4NE7A 1HSOA 3DVRX 4R6XA 2FSVA 4GQBA 5G0TA 1MNQA 4F2GA 4QLBA 1SPXA 3DP7A 1XELA 2C2OA 4TKUA 5ALRA 3SSOA 4N48A 4D56A 5HKAA 1CDOA 3QTLA 4HEHA 1RZRD 3Q3EA 1E7RA 2XE6A 1YZHA 1U0RA 3NP9A 2E21A 3G9QA 4LXTA 3WMEA 1EVEA 3ENVA 5LDDC 3GPLA 1AO0A 4W6QA 3EYWA 1RPJA 2YW2A 4IHJA 4KK3A 5CURA 1ZD5A 3L41A 1SD1A 3ABZA 3N8IA 3RBXA 3RVLA 1NNI1 3W1WA 1PJ8A 4M46A 3OO1A 4KO8A 3MBOA 1ZUNB 2WPDA 5FOSA 1M6WA 3STYA 1C1HA 1R88A 2DUWA 4I9GA 4X97A 1N32B 3QLUA 1J2RA 2JJMA 2WWYA 4A1OA 1JLLA 1AKEA 4CI0B 1C3LA 2V45A 4DLTA 4I2VA 5DYWA 1WHTB 2BIFA 1G8HA 4KQXA 3P97A 4GWLA 4OV6B 3TZEA 4RD6A 4OGFA 3OU7A 3GLKA 4HNAA 4I4NA 1E60A 3K1ZA 5U4XA 2W2TA 4LPKA 1JR6A 2V55B 1J1IA 1P2UA 2XYVA 3BIOA 3BQ9A 1VLJA 3ICOA 5CLHA 4EQZA 2Q6KA 4R0MA 2BUCA 2QD4A 5MFZA 4J3JA 1WW2A 4NMLA 1M8GA 5DM4A 1CEEA 5HDQA 4R5HA 4P4SB 1GKYA 2AI2A 4QYWA 4H0FA 3IURA 4BKMA 5EUCA 1JA9A 1J24A 2H2GA 1L7EA 2F59A 2JIZD 3QPDA 5AM4A 2AMYA 4BEJA 1JX6A 2J30A 3C8MA 2ROQA 4MYTA 3PP8A 2IEAA 2G5PA 3BWBA 2AW5A 2CUTA 3N1UA 5DI9A 1GSOA 1AT1A 2A9QA 4D0LB 5TQ2A 3IIMA 1MLDA 1TMOA 4GZ5A 821PA 4QX6A 3ND8A 4BWYA 3PXGA 3FDZB 2IHYA 2FTKE 2VP2A 2PTGA 4UFPA 4YXFA 2R7LA 2DECA 4F85A 1Z83A 4EY8A 4EL5A 3VHXA 1HDEA 1ZJ5A 2RGXA 4E4YA 4EZIA 5CU7A 1DAIA 3M9XA 3RFFA 2WABA 4DQLA 1U9JA 3WL5A 1J8FA 2FMHA 3A4YA 3I6IA 3HDJA 1V8PA 3GP3A 4N3CA 3Q5DA 4R8KA 4LBZA 1AGRA 1H8HD 4O33A 3RB8A 3W2EA 4FINA 1TDJA 3ZHQA 1SH7A 4EAQA 3RHSA 1RFLA 3R9IA 3RS5A 3DVSX 1Q3KA 1RYDA 1DUSA 4MUFA 4EF6A 3FPFA 3JTMA 4E22A 4G0MA 1F1JA 5HDBB 2W11A 3SZGA 2VP5A 3A1WA 4G0ZA 1O94D 4H1TA 4JC0A 5CW2A 4DG8A 2PMEA 4FSDA 3E7DA 3L02A 1L1FA 4UQPA 4EELA 4A6EA 3AZPA 2QYHA 4QSMA 9ATCA 4XIYA 1T8TA 2O5RA 3SYKA 3VU1A 3M0EA 1L7VC 4Z9XA 3EDCA 2CBXA 1A76A 3PNMA 4OYHA 2EFHB 1ZSNA 4P83A 5KREA 2AN3A 4LRTB 3FCEA 5DNYB 2QN8A 3BB3A 1SQ0A 3HA5A 4M1TA 4OFXA 4YP5A 3UHPA 1YI1A 2FMXA 3S2UA 2H1VA 2JKZA 4LWOA 1QX4A 4RVGA 3R7LA 1JJFA 4IJ6A 1M7BA 3WX0A 1T2AA 5TY0A 1BROA 3QPBA 5ENDA 4G01B 1J39A 3EASA 4GM4A 1KMNA 3TTWA 1NOJA 4NOJA 4IH9A 1D7OA 1M66A 1KTVA 3UHOA 2XCRB 3BCRA 1UJNA 4KUHA 1L5LA 5AVQA 3DZKA 2RHWA 2GZRA 3P9ZA 4IUCS 4MWCA 5ARDA 4AVYA 2O19A 2JGJA 3UJ9A 1JQEA 1SHJA 5A4KA 1MJGA 1EWQA 4YJ3F 1M72A 3HB4X 2O14A 4RABA 5AHXA 5CR9A 4D7AA 1NI4B 3CI0I 5C31A 2V58A 3NHSA 1V2GA 1XUOA 2WUEA 3E8XA 4L51A 4NZOA 4WECA 4E7OA 2JJ2D 5D87A 2GSDA 3MUEA 4JYCA 3O2JA 2WA2A 1PLLA 1S2MA 2BFOA 4FMDB 4NICA 3ZWAA 2WJAA 4QJ3A 5HF8A 5HEKA 2BBTA 3V8EA 4KO2S 4LI0A 5B37A 3IBCA 1S7CA 3JAWA 3DZGA 3UJ7A 5SZIA 2N42A 4DIFA 2R5NA 4RTJA 3HKBB 2YTZA 4RHEA 1E2FA 2Z0MA 5BT8A 4I9FA 5GMOA 1KEWA 3QMVA 1QUFA 2PV0A 1TUGA 4P3PA 4Q9IA 3SR3A 1IJBA 3U37A 2PUFA 2AFHA 3N2YA 3TZLA 4E94A 5K7SA 4MIKA 4JELA 1E77A 3WA7A 4V39A 3CVYA 3A36A 5IS2A 4BB9A 3V5NA 5F9MA 4L76A 2RETA 1BO6A 2AFHE 3EDQA 1LPBB 1QP4A 1IPHA 3NS7A 4KO4S 1QHHB 4BAUA 4W9MC 1ZLYA 2R25B 5EJIA 4OXRA 4NDNE 4V0QA 2BZ1A 4QICA 3RVMA 3A1TA 4G1FA 4L3VA 4BJ5A 4CT5A 2I4TA 4E4RA 3UJAA 1R3UA 2XR1A 3VR4A 2QM3A 5K0JA 3TGLA 3EFOB 1VI5A 5IC4A 3EZLA 1JFVA 1RHRA 2I4OA 3RASA 4C76A 1P44A 2DBYA 1RCTE 2HCTA 4ZCSA 3TXYA 3AR9A 4JR1A 4N7BA 4LGMA 4BO8A 5JOQA 3UK2A 2VJMB 2R6R1 1ZZEA 2X1VA 4FNGA 4ZVPA 3V6LA 2IZ7A 3M3DA 1EEHA 1JHDA 1VI6A 5HP4A 4KLAA 5EERA 3A58B 3Q12A 3L0BA 1FX0B 4WHMA 4B48A 5KMGB 3STTA 5EWJB 4J6FA 4EPVA 4O4HA 5ECYA 4UBIA 3SC2B 1SQGA 4B8YA 3W78A 3QNUA 1ZCAA 2OCXA 3GHYA 1OLUB 4DQVA 5HIIA 2GGSA 4M60A 4UZFA 3GFQA 1S2GA 4N41A 1P1CA 1HE3A 1RWNA 4FS3A 3OEHD 1RXCA 2H2AA 4UTZA 5L3RA 3ZR4B 1XHLA 1GNPA 4QFBA 3T9BA 4BYMA 3ZJYA 2PNJA 3AIKA 4DKJA 3TW8A 4KPEC 1IRIA 4OSEA 3WLIA 1SM4A 4TMYA 4TYWA 1U28C 3GJXC 4W5HA 4MUNA 4MJLA 3IV9A 2FSUA 2C4HA 4M86A 3NVDA 3VA7A 2BOVA 2V5VA 1VGVA 3H65A 4HPJB 3NTLA 4YP1A 2PBFA 1OXUA 1HMYA 3S7ZA 4KP7A 4NCBA 3DM9B 2WFLB 4MDHA 3TR5A 4FSXA 3ZD9A 1TK9A 2QGFA 2FNAA 2Z5LA 4OHPA 3U6BA 3JXEA 3W6PA 5E4YA 5FI5A 2PXCA 5B3JA 3ELUA 3DKRA 1SXJB 1JFLA 2QMQA 4A8PA 5K05A 2AQ8A 1PNRA 4O4LA 1X7WA 3VOAA 2GPAA 4BZQA 4QD3A 5KTKA 4TL6A 3H4VA 2BRUA 3UXYA 5CK4A 4G26A 4G8BA 1JSRA 1WCV1 4GYYA 4RPJA 5AVKA 5EG5A 4RJ2A 4C7KA 2BM9A 2HGZA 4C4ZA 1E5LA 4DRZA 3Q3CA 2OGSA 2GFQA 4YCBA 3EH1A 2OUKA 2I87A 4O6VA 3IRUA 5JSZA 4QGHA 3ZVRA 3IKVA 4GYJA 2ST1A 4XDYA 1Z37A 1X2BA 4OFZA 1RQGA 3CE6A 1KI1A 1NDUA 1PYDA 2YJTD 3EG9B 4KIWA 1OQAA 4TXJA 2D1RA 5DZSA 4BKUA 1KZ9A 2GLUA 3DZHA 4GUAA 1EFAA 1XFAA 3SMQA 1GKUB 3UMRA 1P1RA 4BX3A 3B5EA 1UC9A 5C53B 1N9GB 3M4XA 3T34A 3GPDG 2YZ7A 3DAPA 3IJPA 4FZJA 3VVLA 3HKEB 1WLSA 3UV6A 3V8VA 4BVLA 2RHBA 3N28A 1B0UA 2ZUSA 3N6XA 3RSOA 5CDYA 2FR8A 1MMFB 4C7VA 3PJGA 3SBXA 3Q7QA 3V1TC 1U11A 1SURA 4I6GA 4AKIA 1GG9A 4RK6A 2PH7A 2RHHA 3U60B 3VNVA 1IOZA 3HVJA 1PDOA 1EK6A 3HI4A 2VZ9A 4CM1A 4QTXA 3O83A 4WV3A 4ESHA 2PBLA 3CRW1 1SZPA 1TM5E 3ZVNA 1JMVA 2ZDHA 3E5NA 4I50B 3UPUA 2FDCA 2V59A 2QX6A 4MUBA 3DHEA 1W9MA 1V9CA 3HBNA 3FSEA 4KI7A 3IHTA 5SY6A 1LRLA 1PTJC 3DPIA 4QPCA 5DNWA 3R7AA 2PEYA 3IQDB 4QPPA 2B8WA 1RYHA 2HJSA 2J0UB 3EZ9A 4UDYX 2VATA 1Q22A 1WOYA 5BSKA 2ZZNA 3AIMA 4Q0MA 4WKGA 2A54A 2EBWA 5AHOA 4H7DA 5KOHA 3QI7A 4Q4AB 5IWAB 1ADYA 5JXGA 5ICFA 3NJRA 1J56A 2JB9A 3MM4A 4EFKA 3CMMA 4FZ3A 3LC7O 1OYOA 2IOQA 1EGVB 1KK1A 2QPLA 4M7RA 4ZCTA 1MA0A 1Y7IA 1ZIPA 4UTNA 1SHTX 5LQJA 1AU9A 3GA0A 1JIQA 2PR2A 4KAJA 2W2QA 4PZ9A 3AWIA 1KO7A 3ZGXA 1P60A 3MPOA 4FFSA 4ALJA 3OMXA 3LYAA 3LTNC 2UUPA 2ZB8A 3NHPA 1CY6A 2EFGA 5K9ZA 2DUUA 3VTZA 3ASUA 2YXEA 1IUKA 1O5OA 1ECGA 1YDGA 1MVNA 2E82A 2RGUA 3QV2A 1I7SB 1KVSA 3H4MA 3JQCA 4Y1FA 2XOXA 2R8OA 4KMMA 4JGBA 1ZBDA 3EPHA 3FTFA 1SC3A 1J5PA 3TUZC 3SBDA 2VPYA 1PP4A 3NWBA 2FWPA 2WW8A 4QT0A 2BMWA 3ZOZA 4Z7OB 3F7OA 3IELA 1AA9A 2Z6AA 1Q0UA 2VQ6A 1XNQB 2FZGA 4MDFA 1L4MA 4AO6A 3FNIA 3KZKA 3SLRA 2QP9X 1IZ7A 1CWUA 4FFDA 2C1EA 4AECA 1U5BB 5COAA 1IULA 1MC8A 2QORA 4BDTA 3K8QA 3KQOA 4XUGB 1G59A 1QDEA 3NGXA 2RAFA 4IQ0A 4YCAA 1OCEA 5J63A 5BV8A 2L19A 1FRVA 1ZIYA 5GY7A 3VOBA 2AOTA 4OJNA 1WQ4A 3QBVA 4B44A 2VAXA 1PV2A 3Q2KA 3U5TA 2ZM5A 3T7IA 4GEKA 3VPSA 1C0PA 2WE7A 4M0CA 1Z47A 3CF6R 3AOEC 3DMRA 3H83A 1UBHS 3TS1A 3VC1A 2H2HA 4LXXA 1FJXA 2ZE8A 3HN6A 3RF6A 2WKWA 5I6DA 3CEMA 5JRDS 2V7PA 1AS2A 1UWVA 5G1PA 1IOWA 5A3SA 4S1VA 2ZWAA 2CT8A 4UFOA 2W2LD 2ZI7A 2ZXFA 1HYGA 1KK0A 2VZEA 4P36A 5CXSA 5DDIP 4I99A 1GGFA 5IKMA 2DBRA 1UFQA 4R68A 4EEXA 2NZ2A 2Q9CA 4R9RA 5HGJA 2WQ6A 2WUWE 1ZIOA 2VDVE 5TMEA 1R8SA 2Z08A 3GROA 4XB1A 4C0HA 1QB8A 2FEXA 5CD9A 3UMFA 3SN6A 2WZDA 3P52A 3GFTA 2RK4A 3FWZA 1JE1A 1K6EA 1QQ6A 2HNAA 1PJ3A 4WN9A 4BX8A 3AVQA 1P19A 1T1IA 4BL5A 2D5IA 5FI3A 3U1BA 1O89A 2AZDA 1BWPA 2XZTA 4HZIA 4JLBA 2OEPA 4MVJD 4Y7DA 4ITVA 2R84A 2GETA 2NOAA 3I9V1 3M8KA 3TB6A 4P7GA 5A7GA 3CM0A 1YR8A 1A7AA 1R66A 4HNHA 5F77A 4FBMA 4CW7A 4ER7A 2ZITA 4PSVA 4TS4A 2UZIR 1FFEA 5CFMA 1S8NA 2I34A 2J07A 2V9ZA 4EFNA 3BMCA 1THGA 4GR9A 1QH8A 4P35A 1W47A 2BLLA 2JGEA 3IBGA 4QE3A 4DPLA 3MIIA 2XTZA 3H16A 3H1GA 3NOQA 3E22B 3W5HA 4QYIB 3V55A 3ANXA 1XQYA 3PUHA 5ITVA 3K9QO 4NBTA 4WL0A 3KQTA 1CB0A 3S27A 4QXPA 4G0XA 4C43A 1RQ7A 4X8LA 3C0KA 3PD0A 4GR4A 2WTUA 4NU5A 4YLYA 1A5TA 1Y48E 3B1ZA 3W5IA 3GJ4A 1E9DA 2AEMA 2DHRA 3QRWA 5KKAA 3GQVA 3PQCA 3QELB 3RNLA 4DMHA 4PX9A 5JADA 3L7LA 1DAGA 3D43A 3JWEA 2YDYA 2GKSA 4AT1A 2DQZA 4NLLA 5KX5A 1IRXA 4PCAA 4M99A 4Q3BA 4DXHA 1RPNA 4GKAA 2EZ9A 4ZAZA 1CR1A 1HX7A 3UAOA 5HSGA 3KZMA 4ECAA 4RTLA 1PR9A 3PC4A 3NVKI 4EPXA 4DG5A 4YJGA 2ZVDA 1BE0A 1R10A 1E9EA 3OLWA 1UH5A 4H9GA 4J0IA 1U99A 2WWWA 4JLDA 5LYYA 4CMGA 4BQIA 2HSJA 3AR7A 4TTAA 4P9NA 4ZQCB 2P91A 5JT1A 2FV8A 1KZ7B 4F9EA 1LA2A 2FAXA 3IYLW 2RBEA 4ITRC 3WGQA 3NDRA 5LQDA 1E2BA 2GN0A 4RHUA 3QYFA 4BUCA 3V33A 4KYTA 2WU3A 2ZJ5A 3KXDA 1ZQ1A 2H1LA 3FI0A 1R5NA 3JALA 3O2NA 1EEXB 1REQB 1SHUX 5I7WA 4Y6LA 1H9CA 3B51X 3UPDA 4DRXA 1V16A 2AFHB 3IP9A 4HS9A 1M83A 2H63A 4F60A 2IX3A 3VR3D 3J81A 1FTNA 4CFZA 2NU6A 3K0AB 2C7PA 3P2KA 2Q29A 1ZL2A 3WFJA 3UKDA 3U80A 3CPHA 3C3MA 2IV3A 4CDRA 5LWHA 1OI3A 1E96A 3SWWA 2NZUG 2VWGA 3SP1A 1U94A 2OT3B 3CUTA 3MYYA 4MIOA 1GZ3A 3VPDA 1J9EA 2QQFA 3WGZA 3WK9A 1G21A 4CM3A 1GPDG 2JW5A 4DDUA 3AESB 3UMCA 1HKUA 1XI2A 1Z4JA 5MGBA 3E61A 2CYAA 2NNWB 3U7FB 1EUZA 4Q15A 4DC9A 5JMPA 4UVIA 3SF8A 1SO8A 4ND2A 3M7IA 2V9PA 3IR7A 1DKPA 4MEBA 3W7VA 1B0ZA 3A1CA 5CIQA 2EX1A 3B6ZA 1QTIA 3FVTA 2ONCA 3FNRA 3LPNA 4YREA 3CBQA 3GN1A 4KLCA 5EQDA 1JJVA 1CDEA 5IANA 1BNCA 3TL6A 4L78A 3VPAA 3ZDBA 3C7KA 4DR6B 3GDOA 3LF2A 1S4MA 2ODTX 1FVFA 4O4HB 4QXAA 3OLYA 2CHEA 4X63A 2CXXA 3E70C 3D8RA 1GZ6A 1OFUA 1E7MA 2HV9A 3EEBA 1KQNA 4BE9A 3F7NA 1E79D 4BHRA 1XRLA 1IK6A 3IJ5A 2GI4A 2WD7A 4C89A 3OZTA 4TX1A 4EAAA 1RAHA 2HA2A 4GRIA 5FBZA 4Z7NB 1ZGGA 1VMDA 1U9CA 2E6UX 1O95A 3EGWA 4ZMRA 4CLRB 1XZJA 2I76A 4V0NA 4JC8A 4ZV7A 4A2CA 1I7PA 2X9VA 3SD7A 4E51A 4UREA 4F6RB 1W0KD 2PX5A 3R09A 2O2JA 4BBPA 3DLPX 3IGFA 5I7RA 4LOKA 2E55A 3IIEA 1K08A 4NNJA 1NZJA 4G5HA 1G8YA 4HYEA 2ZI5A 5E7QA 2YHUA 5EYPA 4BO5A 5JH7B 2EG9A 1J2EA 2A9KA 3GZTB 3UPTA 2BGLA 2NPOA 3FLAA 3ILYA 2QMYA 3ENZA 4I55A 4O4LB 2QGNA 4HJRA 1O1YA 3A1VA 3U3JA 5INTA 3JQAA 1Y4UA 1GVHA 4DR4B 2K87A 1LI7A 1NN3A 1XYVA 3B2QA 1RJFA 1QVZA 2IUFA 4J1SA 1Z33A 2O9JA 4XDZA 3WL6A 3NOVA 4Y2PA 2OXRA 2AJLI 3IMCA 1H0HA 3ZQUA 4II7A 1E20A 4O2AB 3M9WA 2YJNA 3PQ7A 4Y0VA 5HHTA 5JSZB 4WACA 1RP1A 5PNTA 3THSA 2QPOA 1FK8A 2FWRA 2IYTA 1OV4A 1RQNA 4KR2A 1WB6A 5HZMA 1HE5A 4PZCA 4UE2A 1TAUA 1JMKC 1JEDA 3UVEA 1BQ3A 1G6HA 2EL7A 4TSFD 3KUCA 4BJ1A 2YJGA 1DO0A 3FTCA 3LHFA 3ADBA 1C4XA 1EFHA 4JUIA 5BW5A 2OZLA 1TAHA 1TT5A 2CY0A 3CVJA 2Y77A 4MVJI 4PQEA 5CYOA 1GO2A 5JJBA 2M6RA 2OHGA 1L4BA 4MKRA 1U98A 2X0RA 3D1VA 5H68A 4Q05A 4Z51A 3DVAA 3T5DA 4LGVA 5GJCA 1VMIA 3CR3C 3P2OA 1NATA 2PS3A 4JLPA 5BSVA 5KNBH 3WMWA 1U9IA 3C24A 4H3VA 2HBRA 2EJCA 2KB0A 1NMQA 2V98A 3PNOA 3OG9A 2CXUA 5HIAA 4GZLA 4TWBA 1N5MA 4C4TA 5F7ZA 4AMZA 2EW2A 4JROA 5GAJA 1WP9A 3V3KA 4X1OA 1B15A 4TKVB 2IS4A 5K51A 3EAFA 4F91B 5JYBA 1SKYE 2DF8A 3WQQA 1H2BA 4L9SA 1U6IA 3UHAA 1KBZA 4BVGA 2Q2QA 4MCAA 4O02B 4NMHA 3K5HA 2FQWA 1NAHA 1EFVB 4H0CA 2CXHA 1EZ4A 2QTCA 1CZLA 4O5AA 1N1DA 3CVOA 2I3DA 1QKJA 4L9RA 5ARBA 4H31A 1K6XA 4NCIA 3U0BA 2AEFA 2QIPA 4KC0A 4JJEA 1GFIA 1KARA 2IF0A 3MWEB 4Z0HO 1DEOA 1RYYA 3UHJA 1WLYA 3COJA 5KNDD 1FFBA 2FZKA 5J9FA 4DA0A 1AKYA 4JJAA 2BFCA 5CH8A 3FOZA 3F6EX 1L7MA 3E84A 3RSCA 1ZD2P 5H59A 1MTZA 2YZGA 2H0QA 3STVA 1J6UA 5C1OA 2DCMA 3DOFA 5HUHA 3JWJA 1SOAA 4PRZA 3JTEA 1MAHA 3DONA 4XGRA 4A73A 3WJ2A 2B9EA 1VPDA 2P0YA 1NUAA 1T4BA 4EA9A 4K6KA 5JAQA 1YU6A 3C39A 4EEKA 4TWZA 4FN5A 1IOVA 4E31A 3ILVA 3GUZA 5DK6A 1ZRMA 2GXUA 1DAHA 3PF9A 4P0TA 4UUAA 6YASA 1W4LA 5IKXA 3DC2A 3P9SA 4KDFA 2XUOA 3BE5A 5M34A 1D4ZA 1FVXA 2VG8A 2C9DA 4D6PA 2JL1A 4NI5A 2HU7A 3V9AA 4H7PA 3BD9A 3DEKA 3L92A 4IX9A 1G19A 2Z95A 2C61A 1E5VA 3DV2A 3LUDA 3LBAA 2DWUA 2GZDA 2AGVA 2JLAA 2A5GA 3A6KA 3HPQA 4HH3C 4LEIA 1D4OA 3PNKA 4MW9A 4BTLA 4AKHA 5EVJA 2XT0A 3E35A 4QC2A 4EO9A 5JHHB 4I1OA 2XRZA 3T8YA 4PSDA 2QSYA 4ADSG 1LB1B 5CLGA 4OFWA 5F9FA 4MV9A 3CURA 1YSCA 3IP6A 1B23P 2GF0A 1KJYA 1PDWA 1C29B 4OXKA 2FN9A 3AUYA 1N5OX 4XD7A 5KSPA 4Z4QA 1NF8A 1R74A 1X1DA 3LA8A 1UDCA 5IBQA 3QVKA 5FNVA 3TQFA 3WC4A 3QJGA 3IOYA 2CDCA 3FDJA 4UAJA 5EIHA 3OJWA 1BJTA 4TROA 4QYXA 1BVUA 5E4FA 4CIXA 3ZX5A 4PHTA 3F71A 4WIAA 2I1LA 2R4TA 1KP9A 2ZJ4A 1YQGA 4O2BF 2BPOA 2GJKA 2O48X 3HWX1 3OCJA 3Q7IA 5B6PA 1P1IA 1A8QA 1PJQA 2UYQA 1MHPA 3N6RA 3PG5A 3QKSA 4FI3C 1XWIA 4J0HA 4WN9B 4RTSA 4Q82A 3ZHTA 1LPMA 5AJTA 1GZ5A 1QF6A 1EFRA 3O95A 3L82B 3RWMB 2FSVC 5IDWA 5JD6A 4D02A 2WYVA 3U39A 1DC5A 4FUQA 4EX6A 3EPRA 3COPA 4ER0A 3PA8A 2PVSA 4IIFA 1Y81A 5LYJF 4N7RA 3NWOA 2JLRA 2ZS9A 3VC2A 3LKDA 4I81A 5EAIA 1MPXA 2WVHA 3A25A 3I2FA 3ID6C 4EY6A 1HOTA 1I3NA 1F4LA 1SNYA 3LLCA 2ZRKA 1GAJA 1D5WA 2O6LA 1IAQA 1V26A 5FUVA 1P0PA 1QVWA 3ZHOA 1EFKA 1ZCJA 2JATA 2D6FA 3KEQA 3LYLA 3FPLA 3R3XA 4D97A 3SYNA 4L7VA 3T3HA 4OQZA 1VE9A 2GD6A 2P0EA 3QLUC 3TIGA 1SVKA 5IYZA 3DUWA 4U7WA 1UWCA 3O38A 3C3AA 3CCCA 2HCBA 2A4MA 2Y0DA 1K86A 3VOTA 4GLLA 3T5PA 2UXBB 4JLUA 3U44B 4IGAA 1VRCA 1A2OA 2ZYVX 4RMJA 3HBMA 4MLZA 2QE6A 4NF2A 1T2NA 3NEYA 5CXQA 2AUTA 1QFYA 4CKWB 1X87A 3HS3A 4QULA 3T06B 2BWJA 2CCJA 1TE2A 3VC3A 5IAJA 3WRXA 2DULA 4AY5A 2RH4A 3A6JA 4AI6A 2ZUBA 2IEBA 3RRFA 5IJ0B 1MRZA 1P72A 2YQ5A 3PEFA 5AUNB 2ATEA 4LZZA 2ODPA 4IDPA 4YMWA 1U4OA 3WE7A 2OHXA 3CZRA 4HEA6 4Q93A 3ZE7A 1WVIA 3B85A 4YMIA 3HR8A 2JAWA 3SFZA 3RROA 1A9XB 2VDMB 1NWHA 1T29A 1UFKA 2NPIA 1R0KA 3GJZA 1Z88A 2QV7A 3L4SO 3LQYA 4JOSA 2FUCA 4LKOA 4F5YA 2ZTLA 3Q8KA 2PUGA 2OCIA 2HUNA 5AYVA 1A9YA 1E66A 2DFNA 1KI8A 1QJCA 5JS7A 3LNTA 1NQXA 2ODAA 1W5AA 3WXMA 1BYUA 3JALB 2IVZA 4OXIA 1A4RA 4R2JA 2NSHA 2ZBRA 5C34B 1TYAE 1O6BA 1G8AA 3MWJA 4DRXB 4UDOA 4OHCA 1ILWA 4UW9A 1DJPA 1FYXA 1Q14A 2NU6B 4QJ5A 3CUVA 1GTJ1 4X7BA 4FYXA 3WHIA 2KYRA 3AVXA 2IJGX 2PU5A 1DIBA 2GK4A 1E5DA 1MGPA 1EI9A 4UHBA 4X1YB 3GUUA 4IQGA 5CTAA 1FL9A 3G8YA 4KMRA 1PT6A 3QUBA 5A4AA 3V7UA 5ABPA 3DZDA 1MKYA 5AW9A 5HZHA 3QX7A 2R0QC 3TJRA 3L0SA 3PDIA 4IY1A 4GECA 4MIEA 2ONYA 4WESA 1KYIA 3D1JA 3AETA 4OU5A 1ICIA 4BE7B 4AY2A 1HYBA 2O54A 3CUWA 3T1QA 3UWMA 2XUHA 2E37A 4NOLA 4AKTA 4G5FA 4W82A 5C8YF 3OQJA 5CIYA 1I6MA 1ZW6A 2QRQA 4JUDX 2XWJI 1P1JA 1EG2A 1ENOA 4FFLA 3OO0A 4N8DA 1E4VA 1HDRA 1JHMA 3WYNA 1MDFA 3PVZA 3ESCA 4MKXA 2X2FA 4YALA 1K8QA 1S2OA 4B2PA 4EJ2A 5LZ9A 5TS3A 3V1NA 2KE5A 4FMCB 2XMGA 3KVYA 4MW0A 1UIRA 3NTQA 4RETA 5CM9C 2JK0A 2J33A 3PE4A 3A0UA 3H2YA 4JJ7A 1L7AA 3MCTA 5H4HA 3UXEA 4Z6KA 3HDYA 2HSZA 4ZVVA 1JBEA 1OB2A 2EWWA 4DQXA 3DLAA 3OJXA 4XJVA 5H9VA 3RANA 1PNVA 2GYYA 4HN4B 4BO3A 3BRWA 1MW9X 3MCZA 4PHGA 2BFMA 1WEHA 1UC8A 3A70A 3ZZ0A 3ICWA 2QW1A 4YH1A 1BRMA 2V0GA 5K03A 4YHHB 4Q9NA 3DE0X 1BS1A 1I30A 4LVCA 1G2IA 5CAEB 2JARA 3MSCA 3OAAA 3U7RA 4WBNB 4LZJA 2XUPA 1EVZA 2CUKA 4KB5A 1X9GA 1TEVA 3N2NA 5EKDA 3CR8A 1BIFA 3LP5A 2PQ2A 2QRUA 3CXRA 3VV2A 2IHBA 1N0HA 1U0EA 2FOIA 4BRZA 3QSGA 3OOSA 1WA5A 4XX0B 5DMXA 2F8TA 4ZVKA 5HKKD 3D7SA 3GBVA 2QL5A 2CE2X 2H9YA 4J2OA 1RP7A 3NTVA 4XWAA 3S81A 1I3MA 2AMJA 3QJ5A 5FOUA 1C30A 3PVSA 4I55B 1FJGB 3EXEB 1X3LA 2H1WA 2XKKA 2JRCA 1RTKA 4B80A 5YASA 3JQAB 3T5BA 2GUGA 1UFRA 3I0NA 2C96A 2Y1WA 3KDSE 1KJZA 3R7NA 4JLVA 2CVOA 2GPYA 1GT91 1NUHA 2XUQA 4K88A 2Q1WA 5AI5A 1NXTA 1BEZA 1XOIA 4C3OB 4KG7A 1F9AA 3DWFA 1Q0PA 1Z26A 2DUMA 1GYPA 4WNAB 5JROA 1AUPA 3WIOA 1NRJB 3BEDA 4A10A 1U1EA 4HNQA 2P75A 1YVDA 3DFKA 2HLDA 5H82A 1F0YA 4LXQA 3BHMA 1MT3A 1JB9A 3IEIA 4PCLA 5ER6A 1O6GA 2IP1A 5DEIA 5DV9A 2PAFA 2H2FA 4LJ7A 4BNKA 3OCVA 5A03A 2IPLA 3G02A 1IOLA 5IVHA 1TT5B 3IULA 3OA2A 3WNCA 3N0WA 3GXBA 4D57A 1LDEA 1GPJA 3DVAB 2OV3A 3MGGA 5JFTA 2IXBA 2DQKA 1WOMA 3UAGA 1FDRA 1HY3A 3DDUA 3VJKA 2VPPA 3AP2A 3NYIA 1KDZA 2H1RA 2B35A 4ZI7A 5GV7A 3OT4A 3MN1A 3YASA 2I67A 3JX9A 3IBYA 2FX3A 3FGNA 3I01M 1SKYB 2IIPA 1KK2A 4N0QA 4OA5A 4QNRA 3ZZMA 1NBMA 4CYMA 5D8DA 1PS0A 2P9JA 1X7YA 3VMFA 1AS3A 2VP3A 3KB6A 4GWKA 2R6GA 2CXPA 5CVDA 3L7AA 1LBEA 4MW5A 3QE4A 3WNVA 5JNSA 2COUA 4JVSB 1R64A 2BJHA 4R9UC 1AMOA 1YFKA 5JC8A 2DBVO 3EWNA 4CKEB 4WEOA 4Y6OA 3HB0A 1ODTC 4X1KB 3E53A 3ZHUA 3VVBA 4CPDA 5I4CA 1ODSA 2Q4OA 4ISCA 2EZTA 1PWZA 3KZ1E 3AR5A 2QS9A 2O3RA 3T0FA 2IECA 1PZFA 2I6XA 3FMOB 3Q72A 3TOXA 5KC9A 1XJWA 3ESDA 2BFDA 4ASUA 4DLRA 2I6FA 3BGWA 2RHRA 4N9WA 1CNMA 4NZZA 4JEIA 4M1SA 5HUJA 3FPCA 2C2GA 3W7BA 5G02A 1Z08A 3H8VA 3OE7A 1VXRA 5LDHA 3LP8A 1VE3A 4D9FA 1HUQA 1M67A 1N1EA 4UMDA 2DYKA 1YQEA 3L43A 2EF0A 1PO7A 4U7JA 2VN8A 1E92A 1A7KA 1OWPA 1Y7TA 2MT9A 4IG4A 4LWZA 1P45A 1T6YA 2GEUA 2QTWB 3PC8C 3KQHA 3W8NA 3Q11A 2X7XA 4H7EA 5ER9A 2Y1GA 1RDFA 3SLGA 4KR7A 4AQ7A 2IS2A 2XMCA 1U7XA 3RCBA 1CYEA 4HSGA 1DC4A 1N75A 1LWOA 1ZIDA 4IIYA 4WXRA 5B3JC 1IMJA 5TMPA 1U8TA 4W5OA 1HNZB 2RHMA 1HT0A 3MOGA 3SEQA 1I2ZA 2Z04A 2FG5A 3O7WA 1A71A 1XLTA 3A6ZA 5F35A 5HIMA 2XBMA 2PVCA 1M1NA 1UMDB 3AF0A 2Q9AA 2BRUC 1EIZA 2ZAYA 4C06A 5CLFA 2GRUA 3EFEA 1USIA 4HDNA 4QYTA 1IN8A 1QKKA 3M5DA 1KR5A 5SICE 4B1FA 4JP3A 2DXIA 1KFEB 3ICEA 1KMHA 1YS2X 3QU2A 4JB2A 2IUSA 4XDHA 3HJRA 3G5UA 3EVBA 2D5AA 4AXXA 4ZOAA 1BDIA 4CFSA 3NCHA 5A02A 3L01A 3LT2A 2GN6A 1M5TA 2G70A 2UVPA 3ROEA 4JBHA 4JJGA 4EHBA 1IWBB 3IFSA 1Q2UA 3VPFA 3I8SA 3OMLA 1M6HA 4JJZA 3UGKA 2NYUA 4KIGA 1OC4A 1VDZA 4K9SA 2XH8A 2JBWA 2NYAA 3HHEA 3F3KA 2J4CA 1RYZA 3LXRA 1FP6A 1DTSA 3SBEA 2C42A 3DE5X 4F8YA 1P31A 2P7HA 3CLHA 4EKNB 4J0FA 1PZGA 2B34A 5D51S 1N6OA 4K0RA 1UPXA 5EA2A 1ZNYA 2ECOA 5H02A 3KWMA 5A7HA 1W5EA 3FF4A 4RY9A 5FNVB 3AXSA 1RLMA 2FR8C 3GGJA 4LE1A 3BXOA 1WUTA 4NENA 5E4TA 5EHGA 2YYSA 5B1EA 3EMBA 1FTWA 1VMAA 1Z4KA 1Z0KA 1YL7A 4OHWA 1WMDA 4J2HA 1ZXLA 4H59A 2HU2A 3JYPA 3KSAC 1E18A 4CUZA 2C1ZA 3C48A 4OL0A 3FDIA 1QTNA 4FP9A 4PSKA 1IN4A 1MB0A 3HCFA 3INRA 3QKSB 1YK1A 2BFBA 1O96B 1YVUA 3I8XA 3LBIA 3PV0A 4B09A 1ZK0A 5DXAA 5FO1A 2A30A 2ESRA 1KJNA 5DYTA 4ZTBA 2DSNA 1E1RD 2R6CA 3OM8A 4L22A 2HR1A 1U2ZA 4R1TA 2ZTUA 1SBIA 2JLBA 2MSEB 3TKLA 1LVHA 1XALA 2AHOA 4ZAFA 1PX0A 3ZGNA 3IVAA 4DJFC 2ODNA 1UP7A 1L3CA 1PR3A 4GIBA 2G1JA 2CHUA 3HH8A 3E3OA 3IXLA 2FDRA 4PV7A 2ZSUA 2IYSA 4JWKA 3AHFA 4Q9KA 5JAUA 5JNUA 3A9UA 3SYRA 3BWVA 3I9JA 1TYCA 1V3QE 5KNBA 3UJ8A 3VHLB 3U13A 1Y3IA 4GHWA 4ZOLB 1TYZA 1FNDA 2MWMA 5JIBA 4PAOA 3U17A 4JX8A 1RSZA 2BSAA 2C95A 3L1UA 4OHOA 1CIVA 2C07A 3G9UA 1ETHA 1WF6A 2FHSA 1PEYA 2C82A 2HA5A 4DY4A 2Y1OA 3G8BA 2AR9A 4YJ2A 1E2JA 2NXNA 4U8HA 3UGJA 4K6OA 4MRRA 3ZYCA 3D5EA 1QFMA 5P21A 1EJ6A 1E0KA 5E9QA 5F2EA 1GQRA 3ZU4A 3BF7A 3I32A 4RCZA 1TMKA 4ETMA 4N03A 1YCDA 3GAAA 2FG7C 3IV6A 3K0EA 3PXCX 4R7TA 5IDVA 5C9ZA 2BR4A 2ETXA 1USGA 3TTSA 2EFEB 621PA 4G0WA 1HZZA 3TW4A 2Q28A 4LXYA 1FBNA 4AY3A 3ZZUA 4HS4A 4H4DA 4NE2A 3VZCA 3IVCA 5I3CA 4KACA 1GU0A 2FZLA 1ORVA 2J9ZB 2E89A 4RM2A 1F5SA 1P5HA 4Y2JA 3KETA 3K8OE 3X1ZA 4JBYA 1V41E 5LP6F 4B3TB 3JYQA 3QZUA 2VDJA 2DFLA 2NUBA 1L8OA 4KOEC 1BEUB 4RSHA 4CMBA 2YW9A 1XJ0A 2RCYA 1CZOA 1JSXA 1PFYA 2IDZA 3AYZB 4PYIA 4PYRA 3G2LA 5T3UA 1X80A 5AHKA 1R6DA 5A6VA 1VKHA 5BQOA 1D09A 5L6LB 3FPKA 2OZKA 2X41A 4CF6A 3EX7C 4AJ2A 1R0YA 4G67A 4WLEA 1XVIA 2A94A 3ANLA 1DBIA 3E9EA 3ZH2A 2R4QA 1X94A 2GZAA 4KAAA 4DWVA 1S96A 1IDN1 4D6XA 1COWD 2HQBA 1T3SA 1WPGA 3MQ2A 3U4CA 4ZD6A 3II6X 2IWHA 3AY7A 4OQYA 1GSHA 1XL0A 3WNDA 4Z54A 5IDXA 4HTAA 2Q3DA 5J58A 5K8UA 2EVWX 4MUEA 1Z74A 3ZLUA 3PDIB 4KQWA 6LDHA 5AI6A 1EVJA 4WESB 1NUQA 2O7NA 4CU5A 4XRRA 5KZMB 2VP4A 5CEEA 2QMUA 2XNJA 4FFNA 1XKQA 4GMGA 4D5GA 1YVEI 1OD6A 2O57A 3NB0A 5ICCA 3O92A 2HHAA 4XEHA 1P62B 1N6IA 3GZ4A 4Q9AA 5FBHA 3D59A 3W4JA 2B1RA 3MJ4A 4EVIA 3K94A 1BMQA 4Q1CA 1X14A 1NR7A 5ETJA 4DHEA 3PIIA 4D4LA 1KAQA 1QSGA 3V2UA 1MD9A 3OLXA 1DT5A 1KIAA 6REQB 3RGGA 4OXXA 1XB2A 4LSWA 2J59A 3CZQA 4IJVA 2JCYA 4LE2A 1TZBA 1LEHA 1VE5A 2C4UA 3AJDA 4LVUA 4YMHA 3QE3A 5ITZA 4AS2A 2XTMA 1HTBA 3EFHA 3AFNA 1J5XA 3OEWA 5F2NA 2J46A 2YVAA 3KT8A 4UE6A 5ALFA 1NF2A 5J2TF 3CINA 1P1HA 4ME6A 3QU7A 2I7DA 3H18A 1KE2A 1RC0A 5MHTA 3EDYA 3TJZA 3RJTA 1XJQA 2Z3VA 3IPRA 2WT8A 4DA8A 2QLJA 1OGIA 3VPCA 4UU7A 1T0UA 4QQFA 1U7OA 4R84A 1WXGA 3RC8A 1G1AA 4DUPA 3LC2O 3HL4A 1O08A 4IUDS 4QDOA 3G0OA 2FHPA 2JAPA 4IRXA 5E9AA 4JY7A 4ZVTA 1SUAA 3EIQA 5WRFA 3UFBA 1PL8A 3ZHXA 3LJKA 3CO0S 2VRWA 3EDRA 5CB4A 4J7XA 1OPRA 3UAWA 3QX9A 2V7VA 4CI9A 3QHQA 4A8JA 1XVLA 4EG5A 1PVOA 3LDGA 4MH0R 3E9ZA 1CJMA 4Y6PA 1MJ5A 5EEGA 5A5EA 3O8CA 3MW8A 3W5UA 2ZI4A 4F4HA 3OE1A 3MFQA 2INGX 1SUFA 1MORA 4K03A 4S0XA 4B2LA 4BKQA 3DW1X 4FYMA 1Z17A 3C7CB 4OHKA 1N2EA 1UP4A 2J31A 4LZLA 2PMFA 2R79A 3HYLA 3A37A 2K5UA 3U4IA 3BJZA 2FPRA 4HAIA 3MT8A 4QJIA 2E85A 2M6KA 2P2CA 2ZT7A 3KKKA 2YHIB 2ZVQX 3BG5A 6Q21A 2C5BA 3DUFA 1UXIA 3F74A 3OC0A 3TIXB 1DJOA 1ETUA 2OCKA 4DQDA 4ZAGA 2G0TA 2HO5A 4A9AA 1JYSA 4X84A 1DT3A 2XODA 4P54A 5CX4A 3LVFO 2HMTA 3UJDA 1BA2A 2W6JA 3CLSC 4KV9A 3ZWPA 2XCOA 4YFYA 1GL3A 4BXOB 2RDMA 2JCXA 2X8AA 4KGXA 2ZUVA 3NT4A 4YCCA 5A0VA 2CHQA 4QJBA 2FE4A 2CUNA 4Z7QB 4E5UA 1QLWA 1SXGA 2DPLA 3A6LA 4UNSA 4BO2A 3GK3A 3QP9A 5K3EA 1QVRA 4LXGA 3LOPA 3HKCB 4DUYB 2FUG1 5ENZA 4LBVA 1IUNA 1BSVA 4MQFA 1ZONA 4MUGA 1SGWA 3SDSA 4LDNA 4D8WA 4DZRA 1GL6A 3V32A 3GWZA 3HUUA 1W0JD 1XTTA 2X42A 3AUSA 3AM3A 5KSZA 1QMPA 3L8MA 3H5IA 3MQFA 4N8EA 4ILEA 3N39C 3BULA 1AC5A 5CDSA 1E62A 2K2QB