2A84A

Crystal structure of a pantothenate synthetase complexed with atp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
277
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantoate--beta-alanine ligase
total genus 88
structure length 277
sequence length 287
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a84A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a84A01
3CVXA 1O94D 3D6UA 4R2LA 2Z08A 3IVGA 4PY2A 3IMEA 3M5WA 2CT8A 2QTRA 4I6EA 1RQGA 4ARIA 2EJCA 3KT0A 2Z09A 2WB2A 2A1UB 3VRHA 3DPIA 2CFOA 1JZSA 2CV2A 1O96A 4MVWA 1GLNA 3RFFA 2HGZA 3SZGA 5DK4A 1O97C 3A4IA 1WZ2A 2HZ7A 1TYCA 1EFPA 4E1AA 2QUKA 1JMVA 2A1TR 1MC1A 1K4MA 1O96B 1KH1A 1IFXA 2E89A 4JXXA 2R5WA 1R6XA 2IELA 3OP1A 3UY4A 1G8FA 4YP6A 2I1LA 1JIIA 3OTWA 3IVCA 1N2BA 3FNRA 3C8ZA 1H3NA 1Q77A 3FY4A 4I6JA 2DUMA 3UOWA 4WSOA 4MW4A 1LI7A 1ZH6A 4DDKA 4DNXA 3KT8A 5BNZA 1V8FA 4GRIA 4PBTA 4F3RA 4QREA 2CV0A 4MUNA 2QJTA 2CYCA 1OBCA 1LW7A 3IVXA 4OUDA 2X0KA 3AG6A 4K03A 1O94C 1EE1A 2J4DA 3ND7A 1O95D 3PXUA 3LE8A 1MBZA 3HV0A 2PZ8A 1EUQA 1GN8A 2PIDA 2RE8A 5LLTA 3ZGZA 1D2RA 4MULA 4MUEA 2QUIA 3H05A 1T6ZA 3INNA 2V0GA 1J1UA 4NATA 3IOEA 1ZUNA 2NZ2A 1XNHA 5H7XA 3G5AA 2VTBA 1I2DA 2V0CA 4MW6A 3HGMA 5LFAA 4AQ7A 1NSYA 2YWBA 4HPWA 3RBAA 3SDBA 4YP5A 1U3CA 3L93A 2J07A 4CDMA 1TYBE 1N2EA 2E18A 1NUTA 4EGAA 1Y42X 2OQ2A 3TZLA 4MW2A 3P0JA 2A1UA 1M8PA 3COVA 1WY5A 1P7PA 3Q10A 3TS1A 4MVXA 3ZXIA 1JEEA 3HFJA 4L2IB 3LCJA 4MW0A 5FNZA 1ILEA 3AKZA 1M8GA 4MWBA 1WXIA 3G59A 2PXHA 2A88A 4PBSA 1F9AA 2A7XA 4ZCQA 2HMAA 3N2YA 1IVSA 1QTQA 3FHJA 2ZUFA 3S3TA 3IUEA 1PFVA 3H9BA 3H9CA 3Q4GA 1IQRA 1N3LA 2O5RA 4J75A 5FO1A 2A4MA 3RK0A 4RUKA 3UC5A 4HK4A 3CLSC 1PFWA 1F7VA 2CV1A 1N1DA 2D13A 3TNJA 4NX2A 4Q93A 1OWMA 1OWOA 4KR9A 1JGTA 3FH0A 3N05A 4MWEA 3SEQA 3CLTD 1X6VA 2CUZA 1OWNA 1I6MA 4KR6A 1T9GS 1TQ8A 3PNBA 4ZT5A 3IOBA 1N2JA 2VTBB 3MMXA 4Q16A 4UZEA 5KWVA 1TYAE 3QTBA 4U63A 5KCMA 5IHXA 1MOPA 2X1MA 3A04A 1QNFA 1FYDA 1NUQA 5H16A 2AG6A 3COZA 3ND5A 5J58A 3MLBA 3TZEA 1QRSA 3NV7A 1MJHA 2CYBA 1EJ2A 2PG3A 2PFSA 2YXNA 4NAUA 1Q11A 4R0NA 4P2BA 2IJGX 1IHOA 4RPIA 5EKDA 3IOCA 3L92A 1J09A 5KHAA 3Q12A 3SP1A 3DV2A 3ZJTA 2JA2A 1JECA 2QUHA 1QRTA 1DNPA 3ZUGA 1NP7A 1I6LA 1IQ0A 1JIKA 1UFVA 4X0EA 3X1JA 5IJXA 2C5SA 3CLTC 4ZT6A 2CSXA 1KQNA 2A86A 4ARCA 3NBKA 3CLRC 2X1LA 4KPUB 3ZJVA 2J5BA 1N2GA 4CQNA 1WXGA 4K0RA 1O0CA 5AHWA 3KT6A 3SZ3A 2QTMA 4WNYA 1N78A 1WXHA 4EG6A 1PG0A 4MW1A 1QRUA 1NI5A 2E0IA 3ISJA 4MUHA 3IMCA 1K92A 3P0IA 4NDAA 1M83A 3FDXA 4DLPA 1S4MA 2NSYA 3UMVA 1YIAA 4S1OA 2BYTA 5TEVA 3CA8A 3CLUC 2JAXA 4ZT3A 3CVUA 2A1TS 3PRHA 5DASA 1QJCA 3VGJA 2EL7A 3N8HA 4JZYA 1IRXA 3E27A 1NUPA 1VLHA 3H97A 2D5BA 1K97A 4MUKA 1CT9A 1ZH0A 4EG1A 3X1KA 4EG5A 1H1TA 4UZFA 1O97D 3BL5A 1OWLA 3FI0A 4YMIA 1TYDE 4EG4A 2TS1A 3PNVA 2Z3VA 3A05A 4MLPA 4DDMA 4EG3A 1COZA 1NURA 1V47A 3G6KA 2DXIA 1M8KA 3MLAA 1H3EA 1FFYA 1KKUA 1VBMA 1BS2A 4KKVA 1PFYA 4MW5A 5J59A 5K0SA 1KH2A 1WQ3A 2DEUA 1KQOA 2E21A 4HJRA 2YWCA 1QQTA 2IP1A 3CLRD 3K9WA 2ZP1A 4NAHA 3F3MA 2XRZA 5HUJA 4MUGA 2DLCX 4YP7A 1U3DA 4ZT7A 1A8HA 1N2OA 1M1ZA 1ULHA 4F4HA 4ZCTA 2WQ6A 3CLSD 4JYZA 3PNYA 1IH8A 1WOYA 1N2IA 1YUNA 3ZJUA 3K32A 5FO0A 1KR2A 4TS1A 4ZT4A 1MAWA 3NBAA 1OD6A 2YY5A 1N2HA 1KQPA 1WJGA 4J76A 1WXEA 4DE5A 1KP3A 1KORA 2X3FA 4L2IA 4U7JA 4CT0A 4ZCRA 3CVVA 1M8FA 2ZUEA 1T9GR 1X8XA 2G36A 3A2KA 4ZCSA 1NYLA 3FIUA 1VL2A 1I6KA 3IMGA 1JHDA 2DR2A 1PFUA 1KAMA 3ELBA 4BWVA 2H2AA 1JIJA 1B6TA 2BTEA 3GUZA 1QU2A 3CVWA 2AKEA 3N9IA 4QRDA 1R6UA 1N77A 3DLAA 5JBNA 1J20A 4EFKA 1WXFA 3ZIUA 1O95C 1MB9A 2CYAA 1U0BB 1O6BA 4QBTA 4XFDA 3VU8A 1EFVA 4JXZA 4OUDB 5HUHA 1M8JA 2O8VA 1YUMA 1U7DA 2DETA 4MW9A 1G8GA 2GOYA 5TGTA 3IDFA 3HZRA 4EF6A 1GZUA 3GLVA 3HMQA 3FETA 2QJFA 1YULA 5TS2A 1NUUA 1NUSA 1LI5A 4MUJA 2B7LA 3DO8A 3FG9A 3COWA 3JXEA 3RK1A 1MRZA 1JEDA 4MAFA 4YBRA 3AIIA 1KP2A 3P0HA 2QTNA 1R6TA 2QUJA 3D6VA 2OV4A 2PZAA 3KFLA 1GTRA 1XJQA 3ND6A 3QE4A 1O5TA 1OWPA 5F23A 4XFJA 3AG5A 1G59A 1TFUA 2RD2A 3ZXSA 1U7XA 1XNJA 3SYTA 5DEOA 1OBHA 4MWDA 3U1VA 5K0TA 3ILVA 3LOQA 3COYA 3MUEA 1MB2A 1Q19A 1XNGA 1T6XA 2AZXA 1J1ZA 1T6YA 5LM3A 4MW7A 4MWCA 2A84A 1VBKA 4MVCA 1YI8A 2JANA 1EFVB 1QU3A 4I6GA 1KAQA 2DPLA 2WSIA 1J70A 1WQ4A 3H99A 3CVYA 2GKSA 1HYBA 1KH3A 3CR8A 4G6ZA 4H3SA 1F4LA 1G8HA 3RJZA 1ZJWA 4GU5A 3IH5A 4ZCPA 1EXDA 4AS1A 3QTTA 1GTSA 3CLUD 2DERA 3AFHA 4ND7A 1YIDA 1GAXA 1SURA 3IODA 1IQUA 1JILA 1JZQA 2GM3A 4R2MA 3HL4A 1EUYA 2XRYA 1MAUA 1J21A 5HG0A 2D54A 3P52A 3MXTA 1GPMA 4OJMX 4MQ6A 4MVYA 4PBRA 1N75A 3FWKA 4EG8A 3RHSA 4KR7A 3KT3A 3UK2A 2WQ7A 4FZJA 3SEZA 5J5AA 2QJOA 1EFPB 4U8HA 1WKBA 4XSVA 4CDNA 4EG7A 4HJXA 4MUFA 3I05A 2PZBA 1Q15A 3TQIA 5TEWA 1TEZA 4G5YA 4NZPA 1PG2A 4G5FA 3GMIA 4ZT2A 4A91A 3IUBA 3FOCA 2VXOA 3TQOA 2J09A 1H3FA 3X1MA 5DB4A 4DDHA 4JFAA 1O0BA 2H29A 1VBNA 1K4KA 1NZJA 4ND6A 4KPUA 2J08A 3AL0C 1F7UA 4DJAA 4MUIA
chains in the Genus database with same CATH superfamily
2WSBA 4UE3S 1A9PA 1VLQA 2XT9A 4PO9A 1T4CB 1Z36A 5D84A 2IIBA 2Q4BA 4WLUA 3S2SA 1ZC3A 1QZTA 3ZWWA 5AFSA 5KNCA 4PPQA 4HWGA 3I3OA 5FF9A 1PTJC 4WRRA 1QF6A 5IYZB 4OXIA 4E09A 3F5MA 1J5PA 2C20A 2FWMX 1G6HA 3NHJA 4UVDA 4E46A 1P0PA 2C3MA 2J1LA 1GLNA 5EZ5A 5JXJA 1BJRE 2NU9A 3SZGA 3OC0A 1I2MA 1II0A 1RXCA 2DBVO 2W2VA 1GDDA 2WKRA 2YJTD 2XAUA 3FHOA 3HI6A 3L7IA 4BKMA 1K3TA 3FM9A 1XWFA 5GPBA 1C9YA 1XCMA 3DEFA 3ORSA 1BQEA 1ZNQO 2ZBUA 4V0OA 1OFVA 4NV0A 3VNSA 2OC9A 1JMVA 2QN1A 3R41A 2A1TR 4LYGA 2I33A 2PBRA 4B1FA 3U61B 4W9MC 2VQEB 1IUNA 4C43A 2FZEA 3LPLA 5IM5A 4CMIB 4ETIA 5CEEA 1XU9A 2DFNA 3K4PA 5JAPA 2BFFA 4IEIA 4YP6A 4CMEC 2R8EA 3VC2A 1M0SA 2XVZA 4I5IA 3UJPA 1MCZA 1UT8A 5H3HA 4RTQA 5GIOE 3RVLA 2FWRA 3KSDO 2ZGVA 4R71A 3DGFC 5BOVA 4S1NA 4KB5A 2G09A 3EEFA 2XCRB 1X7WA 1DKRA 2QVXX 1JHMA 3PPVA 4J29A 4PYKA 2Y27A 3LY7A 3LKDA 5LA6B 5BWCA 1KOLA 1IXYA 8AT1A 2RGDA 3OQBA 3PD1A 2DJIA 1NQAO 2PD3A 2XH8A 2G07A 3Q8LA 2CV0A 3JQ7B 1DEOA 3GIWA 3CFIA 3RVOA 4BNHA 5JU6A 1AGRA 1WW8A 1O94C 2FU5C 2E4ZA 2IEBA 2VDOB 4PW0A 1O95D 4RQTA 1TU3A 3D5TA 1E5VA 3DTNA 3E4DA 1ZMXA 2AG8A 3VISA 4YMGA 3DHNA 2PIDA 1R10A 3W5HA 1BJTA 1KEKA 4AO8A 3JQBC 4J0CA 4FE7A 1URPA 1QRSA 1KFCB 1VYVA 2PKQO 4I9HA 1XNHA 5AQEA 1JIUA 3D6FA 4B2PA 4NBTA 4MVJE 3FNHA 4F92B 3TNDA 2GHIA 4HFMA 1T29A 2XE6A 3L93A 3MMZA 1M2EA 3O38A 5HGJA 1ZGCA 1FTYA 3D3EA 4MI6A 1W4ZA 1NW6A 1NBMA 3I2KA 4BNUA 5A9RA 1LS1A 1J0EA 1JVSA 1P2FA 1Z45A 2P5TB 1I1HA 4KMRA 4Q4DA 4CMIA 4P0QB 1FRZA 2VCEA 1RXUA 2O8EA 2FGKA 2DF8A 1SCNE 2ZRGA 3ZLUA 4UMVA 1G0NA 3D2CA 4RZQA 1U1EA 5A71A 5JCPA 1G38A 1Y81A 2IYUA 2Z2KA 4HWKA 5FI1B 4PO1A 4HAOA 1GTZA 3DOIA 1A2KC 4IW3B 4YAIA 1FNBA 3D3QA 3KQTA 4OXQA 2X6RA 3V46A 1QAMA 1Q50A 1XC7A 4OQEA 4IIYA 5JV5A 3PUYA 3I6ZA 4S1WA 3HCOA 2A7XA 1A9OA 3P9XA 3EH1A 3HSYA 4UU7A 3I4FA 4EKYA 4NBNA 2P4QA 1FYVA 3BSYA 3IUEA 1CQJB 1TAUA 1SCDA 5COAA 2DHCA 4F5DA 1NNUA 1JI3A 4AZTA 1ODIA 4QXOA 1NGSA 3QVXA 5HQ3A 4QOEA 1P0QA 3C3CA 3IUPA 1N1DA 2FN4A 4ZVVA 3SXPA 4HNUA 4DRXA 4L3OA 2HCFA 3DS8A 1COWA 4HLUC 1VA4A 3BD6A 5EMJA 2ORED 2QY6A 3V6MA 1CZLA 3QW2A 4WFKA 3K0CC 3WGTA 3HO6A 5HFAA 1EBUA 2X4GA 5D5QA 2R8RA 1DWQA 2VWPA 5IU6A 2O8BA 4ZAWA 4PQGA 1MX9A 2Q5IA 3LK6A 1SVUA 3CWCA 3EYWA 1DBQA 3VZCA 1OLUB 1SKAA 2FSPA 2P62A 621PA 1YB1A 2X1HA 2XLCA 2C9YA 5DCUA 4R1QA 1J99A 2WZBA 2VXCA 3ROZA 4CW7A 2ORIA 2HBQA 4RJIA 4QVKA 4TM7A 3ROTA 2W93A 4B3HA 4D0LB 4L8WB 1GCUA 5H16A 4BTLA 2YZ2A 1JR6A 3TLEA 3PFNA 5IXSA 1G16A 1NRXA 1AB6A 5CAEB 1DKQA 4YLEA 1YL6A 2BFBB 3DL0A 3ESCA 1B3BA 2PUCA 2Z30A 4R2IA 3EBLA 5E4YA 2CNDA 1GZVA 1Q21A 1NPDA 2NO6A 4KWEA 4P2BA 5AHXA 4RZSA 5D86A 3VYTB 4PM4A 4RD1A 3K35A 4X1OA 1EU1A 3L92A 3FD8A 3L4SO 2QVYX 4QRHA 3TBHA 4WXYB 4HZIA 5DBEX 1ZH2A 1B0PA 1XV5A 2XX3A 4MQ4A 2GBLA 4UMDA 3ZC3A 4BVEA 2A53A 4G97A 3BAFA 3JQPA 5LOVA 4DR5B 3KEMA 4EKGA 2P6UA 3HJCA 5IVDA 1RTTA 3DEHA 3NVDA 1ZD4A 2FEAA 4ZT6A 4DYVA 2MINB 1P6UA 3HDHA 4JMPA 5BYBA 3RS7A 3FCAA 5JXIA 3NBKA 4ARCA 3W6OA 2AXQA 4YXFA 1JHUA 2H7YA 4GI5A 4DA6A 2EKBA 3AHHA 3R3HA 3TIXB 3GBSA 1WXGA 1YUBA 3VR2A 4XWAA 1S4QA 2CMFA 2ADOA 1P39A 3LKVA 2GRUA 4WK6A 4MGEA 2R6AA 1LBQA 2WJ3A 1DINA 2C77A 4O2BB 2B0JA 2NU8A 4PLCA 2PR7A 1FRQA 2RGEA 2NOAA 4NBVA 1E5TA 4C7MA 3TMAA 1JKJA 2CJFA 1KOJA 4EVRA 2HMYB 5KQPA 4XD7A 1NI5A 5ECWA 4TLMB 3D4PA 4MUHA 4JKYA 1I3KA 2OB1A 3LSYA 4DCTA 1F3LA 4MYDA 5E6UA 5HK9A 1VIMA 4O63O 3CY6A 1RE1A 1WUYA 4A9AA 1YZQA 3CMCO 9ABPA 2LZ0A 1H6DA 1XFDA 4DMHA 3Q3GE 1XXHE 1LD3A 1THTA 1NW8A 3G9TA 3I32A 3U3DA 3R7BA 3R3ZA 4W6QA 4LJ8A 5FJJA 4C29A 5BWBA 3TBKA 4OYHA 4BUCA 1W1UA 4DG8A 1BWQA 1X7ZB 1BDIA 3MT0A 3C3PA 2VATA 2R2AA 2XGMA 4FVTA 3R8FA 1RXWA 3NOQA 5KYWA 1T5IA 2JFOA 4QIHA 3IAM1 3X2SA 3GLIE 1M6WA 1OFGA 1Q84A 3D3NA 2Z4TA 1PEKE 1YVPA 3I73A 3EGXA 4X66B 3GYGA 1Z74A 3Q7RA 1A9ZA 1WZIA 2WJVA 3R6TA 4GVXA 1GT6A 4I5FA 4BMVA 5FWXB 2Q0QA 4GX5A 4BNFA 2A50A 3B6JA 4J6EA 4HNQA 5K0LA 3MGAA 1NXSA 1PYGA 2QM7A 4B3CA 2IH5A 2Z3VA 2XV1A 1SIBE 5DIZA 4DSAA 1G66A 4N54A 1PG5A 2RGWA 3ESRA 2XNCA 2IHYA 3HV2A 5GVRA 2FN8A 4YCCA 1EP3B 4LV8B 4Q3NA 2W2MA 4NMLA 3WBJA 3JQQA 2GAFA 4Y2YA 1UZUA 4YS6A 1DCFA 2EFEB 5J59A 1F2TA 3R8CA 1XXHB 4KLCA 2OPHA 1P1KA 3M89A 3KL4A 2PKXA 1DE0A 2GB4A 2IUTA 3DTYA 3OG9A 3U4IA 2J5KA 3B9QA 1QQTA 4OHXA 5E6UB 4O4IB 4D4KA 1NI4B 2HMSA 2CLCX 4M8SA 2VSQA 2XRZA 4LX8A 5JAQA 1T25A 5I4IA 2FRDA 3T52A 1KI4A 1VKHA 5IFKA 3K8ZA 3CBQA 2PBZA 4Z9XA 4M1EA 5E8RA 3KB6A 1X0VA 3OLYA 1RYFA 3OPXA 4DLUA 1KAHA 4H1TA 3KUCA 4ZQCB 3V4LA 3FTCA 1VE6A 1Y6JA 5FO0A 2OXFA 1CW2B 3CRZA 1XZNA 4XYLA 3IB3A 3KLNA 3KZNA 3TRIA 3A27A 1SM4A 3SN6A 3S2ZA 2WMYA 4O25A 1GEGA 4EW6A 5BYAA 2CCKA 4QA9A 3MWEA 3T1HB 2YHSA 1MD9A 4XJSA 1KL7A 2JD0A 2ZJ8A 1YNSA 1IUKA 1RWOA 3KZXA 3PS9A 4L8GA 3EVBA 2D74A 2PYDA 1SCUB 3BWVA 1YJXA 3NTRA 2ZS7A 1N5RA 4HWPA 4QJ5A 4BFSA 5KVSA 1FPQA 4EGSA 2R751 1XRNA 1BRTA 1N1GA 3TTWA 2YWFA 1Z3IX 1J8DA 3U4MA 2PAAA 1E69A 2G1KA 3QVLA 3IVRA 1SQ5A 4GMDA 1XOIA 5J2UF 2UXDB 4LISA 3JQRA 4R1TA 1PWYE 4CI0B 1GR1A 1GVNB 1NQ5A 1WBBA 1CY7A 4URHA 3AZQA 3J7TA 5KSPA 5JAHA 3TUJC 1Y6GA 4O3FA 4NP6A 5K6AC 1QTNA 3GGOA 3WYBA 3KELA 2AK2A 2G9ZA 4Q3LA 5TY0A 5EIOA 1RYBA 1YR9A 2BDEA 1Q20A 1RXYA 5K8LA 4XFDA 4MRMB 4OUKX 2BKXA 2G9VA 2QTAA 3IUSA 1NQVA 4A2WA 1FMJA 1VGVA 2W11A 5LZ9A 1IM8A 3JASA 1QUEA 1N5KA 2C5HA 2Q7XA 3D8UA 3A1CA 4N01A 4XQEA 4HB0A 3JR7A 5HZMA 3HZOA 3HHPA 2FFBA 3GWZA 3OPVA 1GZ6A 3B6MA 3F9RA 1T2AA 1JJAA 4LXQA 2DJ5A 3U4AA 4BMYA 3ULKA 4UBKA 5JMTA 3ZD9A 4Y6LA 4C22A 1QX3A 1EJ6A 2H1CA 4YAEA 2XB6A 5KNCH 4MB0A 5KNBA 5KYYA 1GUAA 2LCIA 4AECA 1VHDA 1P4HA 5FTNA 2OCKA 1UXKA 4RVNA 4U7PB 3V1KA 1HE5A 1RM3A 4D4HA 3P0HA 1Y9JA 4UMFA 5DP2A 4ZPJA 1HE3A 2AE1A 4D44A 1F20A 4B7ZA 4PGHA 3TECE 4P7GA 1ZR2A 3WGZA 3SEAA 2O3SA 4WCFC 3WAKA 5HJ5A 1YMUA 3GT7A 1H2BA 2TMGA 2OENG 3G88A 3MJTA 1KMHA 3NAQA 4W8GA 3CQ9A 3VOTA 3ZXSA 3VAAA 1K98A 2VFAA 4ZMSA 2HA5A 3U1VA 2FUKA 3ETDA 5IHPA 4WLOA 1J33A 1RMYA 3GHHA 3N7AA 1K8RA 3BCHA 4D6PA 2ZWMA 2AZXA 1R64A 1I14A 3WK9A 4EHIA 1Z2NX 2YDYA 3W4IA 1SA0A 1BHSA 3SX0A 1DC4A 1BGXT 1MJFA 2Q50A 2X9NA 1RAHA 2QSUA 2FPSA 4MWCA 3W7VA 4UNNA 1GM5A 2V0NA 2J9ZB 2DGDA 1G3UA 2ZAMA 1EIZA 4RIHA 4TXHA 4L15A 1T3TA 3ZU4A 3QEMA 3M33A 2CDBA 4RF3A 2ZWOA 3AV3A 5EJIA 4Z0NA 4IIDA 3D7LA 1P0FA 3TGLA 4RZHA 4I1SA 3HA7A 4IILA 3K6RA 1EHIA 1HDIA 2O57A 4G6ZA 4D0SA 2G8LA 3HSSA 1CYEA 2BEJA 4HBGA 1GQQA 5CX1B 4JNCA 4PHGA 1VZ3A 2GTHA 1L5MA 3GH3A 2BHRA 4GYYA 4S35A 4WPGA 5KNLA 4ARZB 3G0GA 1CIJA 3DR3A 4DJFC 1OILA 2R1VB 5EIBD 1ZHHA 2C4VA 2JPDA 4RIFA 3CCCA 2YMLA 2Z5VA 1LKZA 3GCXA 2RC5A 3I9JA 3PNSA 4U02A 1QQBA 1XJCA 1FOEB 1CRWG 1IL0A 2AHRA 4EW1A 4G2TA 5JCOA 4NE9A 3H65A 3C6MA 3UWSA 1GL6A 2VPPA 1Z2EA 1ZD2P 5BQOA 4KG7A 1FDSA 3R77A 3EZLA 1L6RA 3HDGA 4CKWB 3ABSB 3DYVA 4ESOA 3BDAA 3FWKA 1Q22A 2JDID 3QHPA 1L5QA 4A92A 1EVEA 1E94E 3H9EO 3GZNB 4BQIA 3KOOA 3TOSA 3DMGA 3UHPA 1L4MA 3OZGA 4IHQA 1MGPA 2YVAA 3V2UA 3GLHB 4JI7B 2GFQA 4JCCA 4LJLA 2QU7A 1DELA 1QCZA 1WF3A 2CMDA 3BE8A 5T64A 4TGLA 5CJJA 5GONF 1SBCA 3CEAA 4MSUA 4C20A 3ESYA 4CDNA 2YJ6A 3RU3A 2XEXA 4Y0AA 3RRFA 1FXUA 3NATA 1PT8A 3H5IA 3K73O 1SCIA 3RRNA 1UZAA 2CL7X 3AQIA 1IBSA 1D1TA 3TE7A 3LP8A 1E6WA 3QKUA 1L4KA 2YWXA 2C5GA 4ME6A 4CKYA 4NZ9A 1PJTA 4QO7A 2Y1CA 3D43A 2FOIA 2HA2A 1U04A 3KDSE 1DAMA 4W1PA 2JI6A 4DDHA 4OBXA 5ARDA 2BFEA 2WKQA 5L3SB 1W4AA 2C3UA 2VTDA 5ESWA 2A1IA 2QU8A 2X77A 1EDEA 2PK3A 3QA9A 4DJAA 5IVHA 4QZVA 2GFIA 2O2SA 3LVRE 3AOEA 1PLKA 1VG0B 2RHBA 4DLBA 1TJ5A 3BORA 1AGXA 5D01A 4P3YA 1ODCA 4BMOB 3ZUPA 3UMBA 4N6OA 4Y2QA 5E7QA 4UBJA 5LLSA 4C06A 4EEXA 3C3WA 5FTJA 4EZBA 1SZCA 1NVWQ 4JIGA 3U3KA 5AQ1A 1T5SA 2H4ZA 3DZFA 4NWIA 5TV2A 2IWRA 5ABPA 2WB2A 4R98A 2A1UB 1NNLA 5K2OA 1I30A 1XZHA 3FVRA 4FYJA 1FFEA 1Z9BA 1CLEA 1MB0A 3EIUA 4RE6A 5TNXA 3WNCA 5KTNA 1AZSC 2R4TA 3WB0A 3C4QA 4WFJA 2J4CA 2VIIA 4R3UC 4QOIA 1Q3KA 4JEIA 1HQDA 2JDIA 4H15A 4NG4A 4AZ0B 1PYOA 2VQSA 4HDSB 4EKDA 1EFPA 3ELUA 5F7JA 3T3EA 5K3BA 2JIDA 3C6BA 3GVIA 3RRXA 4FYPA 5I47A 1PAUA 1BDBA 3QLJA 4O5AA 1SN7A 4Y2PA 5BVGB 2I8CA 3EH2A 3W04A 4RF5A 1I0LA 1S9DA 3DEIA 4LMBA 4JXXA 1Q5PA 4R69A 4BFWA 1VIAA 1P9NA 2P67A 1UBEA 4OFZA 3GDHA 2VHCA 4ARBA 4CTNA 1LEHA 2GBFA 1EA7A 2Q3DA 4OMDA 2YQ4A 1KSHA 2I2FA 4CQMB 4LV5B 4E4YA 1ZG3A 3O8OB 2TMDA 1WHSB 3WBKA 4E13A 2WOJA 4YMVA 1Q77A 3HCAA 4BNNA 1UXOA 1QP4A 1A9TA 3IBFA 3DVLA 1JHRA 1FMCA 3DWEX 4CYMA 2NVBA 4V3CA 1XXLA 1C7ZA 1M2OB 3C7TA 1JBKA 3LY9A 4UXHA 1K63A 1E62A 4BN5A 4EW3A 4TM8A 3I34X 4M3NA 1XCPA 1IWBB 1U5BB 1Q14A 4JLSA 4P38A 3OOSA 3HJAA 1Y6RA 4XD7D 4XGKA 3IBSA 1OBCA 3NDBB 3W6NA 2AZDA 1DKMA 2X0KA 1R9GA 3P4XA 4HKTA 2AF3C 5P8WA 5AI6A 4B3BA 5B64A 1R88A 2P9BA 3LM8A 1H9AA 2QZSA 3ND7A 4PG5A 3RT1A 4F97A 1PNQA 4AKGA 3HV0A 1EUQA 1Q0ZA 3BZWA 2PZMA 1UWVA 5KWJA 5I9IA 1EUDB 2BD0A 1ZM3A 2FPLA 2NM0A 4NH0A 4DM7A 2VSFA 3VYUB 5AHRA 2Q62A 3ROPA 2EL9A 2WJHA 3RC2A 1WDWB 4ZAYA 4O4LA 2V0GA 3PQ7A 4DV6B 2O19A 3P0EA 4IUDS 1WXDA 5ALIA 1DJNA 3QVGB 2OCXA 2ZRJA 2FX3A 1EK2A 4AJ4A 2QZZA 3BA1A 5D1HA 2CJWB 3CI0K 4ETNA 4REOA 1TZCA 4OG2A 1AGPA 1UJ5A 1KJJA 1T10A 3PI6A 4BO0A 3FSJX 2BMDA 4BFLA 4ZMBA 3ZY5A 5JDCC 3SXJA 4ETWA 1OSNA 2GNAA 4TXLA 5BMVF 3F9CA 2AR9A 4A03A 4AZVA 4PG6A 5GV8A 3C3DA 2SHKA 3OZUA 2FPUA 1CUUA 4FB5A 1QNLA 2IZ1A 1A04A 4MW0A 1DTSA 2H63A 2YV4A 3BHNA 3GGPA 2Q0XA 3MC1A 1M0EA 2IXDA 1KO4A 2XQVA 1ETHA 2XUJA 3O4GA 1K0UA 5GVSA 5TLSA 3W3ZB 5BMVB 2GCIA 5I9TA 3HFRA 3UGJA 1IBRA 1T2CA 3GV0A 3TVYA 4UEJA 4YGXB 1ZRSA 3QEMB 4LFBB 2OXTA 2QQ0A 1G5PA 4DUGD 1UQRA 4KYTA 3D6MA 4J75A 1DJQA 2OZKA 2FMFA 4QXMA 3UWPA 4WXEA 2BCJQ 1EB8A 1NIPA 3IAAA 3TNJA 1ZM7A 3CUTA 5DLDA 1TAHA 4LNAA 5EKXA 3U9LA 1POWA 3K15A 4KVFA 3QKSA 4NE7A 1GZ4A 2RDMA 1L7QA 2OCYC 1V6CA 2Y1LA 3OHMA 3QVVA 1HEUA 1JR3E 1LWOA 2GBLC 1FFSA 2MJLA 3OA2A 4GP6A 1N2JA 3UB4A 3ZZ0A 1MQ8B 3DMFA 5IYZA 2YNMD 5JQGF 2W6ZA 1IBKB 2ZK7A 1AIPA 2NIPA 4OTZA 5AW9A 2QTCA 3TLKA 4A73A 1SXPA 3FDZB 3RHFA 4A0RA 3GT3A 2CXUA 1Z5PA 2A56A 3MGCA 4Q34A 3RIEA 2B2NA 2X7XA 1A2OA 1DMRA 1HSZA 1L6IA 3L8FA 3VR5D 2W22A 1NVEA 2VYVA 2ZRKA 3QRWA 1VXOA 2BL4A 4IJKA 3ZV3A 1FLDA 1ZUWA 4EI9A 5KTKA 2JKZA 2ICAA 4NKRA 3WJAA 4O2LA 1LRLA 3CNNA 3UBTA 1SHTX 2NZVG 4YIHA 1RPJA 5E3IA 2A4KA 5FIUA 1ODTC 1T3ZA 2PVCA 3KJZA 4H7DA 4BV8A 4YQZA 1VE7A 3IOCA 2VA9A 3IAS1 3T15A 5LNK6 1A4IA 5L6LB 1VSBA 2HA3A 3HRHA 3DV2A 1DU4A 1ADCA 2VJYA 3DPSA 4H3HB 4DXAA 4KQEA 3V7WA 1KEEA 3Q85A 4PLHA 3WISA 4KX5A 1RWVA 3PD0A 1IQ0A 5T3UA 2LE0A 2LGJA 4URWR 3HQ4O 8ATCA 4WWHA 3JQGB 4J1QA 1HTBA 3CW9A 2I4RA 1OX6A 4B5KA 1GQFA 1J2TA 3RBZA 3ZBQA 1TIPA 3WRYC 1SEPA 2BMAA 3F6RA 5DX0A 1KC1A 2Y93A 3TKAA 3ZJVA 1H22A 1VG8A 3V1UA 1WX1A 4CQNA 4K0RA 3HWX1 5AW0A 3W8FA 4WUVA 1VBFA 3T94A 3WJ7A 1HL3A 4YUVA 4BZZA 4UEQA 4XRRA 4AY3A 2W90A 1FW8A 3F5DA 1QO7A 1WUIS 1PE0A 2X58A 3AXSA 3GJ4A 1PJCA 2FW1A 2Q2NA 1JBQA 5HE9A 4K0KB 1BVUA 3CLKA 2A5DA 3OIWA 2PZEA 4H3KB 1NXOA 2OFOA 4HDQB 2HEGA 3L0YA 1VMKA 4L3VA 4MW1A 3ISJA 4YASA 2GPSA 3GL9A 4JX8A 3G7UA 2A67A 3ZJ5A 5CTAA 1EFLA 3HKCA 3R6LA 1YHZA 5FAKA 5ECGC 5JXHA 1EXNA 5JMWA 3U80A 4F9FA 2DKFA 1A1SA 3ZY4A 3CA8A 4BIMA 4HEQA 4DARA 2JAXA 4ZT3A 3U4HA 1DCKA 2HB6A 3CVUA 3D4LA 1ONPA 1PJRA 3H83A 3F47A 3FUCA 2ADFA 3OMWA 4J7XA 3TX6A 4EUHA 4KXMA 2PJZA 7ABPA 2YOHA 4NXMB 1V2GA 2AKAB 4X7PA 4I1VA 5JS8A 3CUSA 1AKEA 4AG6A 1Q7TA 1Q2XA 5KYTA 2PMEA 2BLLA 4J0JA 1SNYA 4LC1A 2GYUA 1XWIA 2YH2A 1AJEA 2AB0A 3SKYA 1SCJA 1ZONA 2XMRA 4NOKA 2O1EA 1FSPA 1VJGA 3HABA 5DOVA 4B4VA 3T7EA 3QXSA 3K0SA 1OWLA 3ZDFA 5LYJF 2FMHA 3L7JA 3QU7A 1TJPB 4EG4A 1GPNA 3PNVA 3WFJA 5KQRA 4TYPA 1PX2A 2UDPA 4N0MA 2RG7A 2ZYSA 3A2LA 4XDZA 3HBFA 2BH2A 2GETA 3LQ4A 4XA8A 1V6AA 2XMSA 4EGFA 2OECA 4Y7DA 4BEVA 1OFUX 4DGQA 3QEBZ 1OCEA 1B4DA 2BI8A 1I0ZA 4IQ0A 3AERB 3KKKA 2OAQ1 1A69A 1DO8A 3ODPA 4LCJA 3WNBA 6ABPA 2FEXA 4Q01A 5HA5A 3WQHA 4HJRA 1YJBA 1JEAA 1Z5VA 1CQWA 2YWCA 3TRFA 5AUOB 1CBUA 1KQ3A 4EYOA 3B78A 1R0BA 2WJ6A 2OAP1 1WBJB 4KRGA 2YJNA 2OO7A 4FM9A 3H1EA 3RTEA 3PFBA 5I4CA 2W00A 1XIVA 4U9IS 1RZUA 1A8HA 3HJGA 4DCUA 3NHSA 4ITRC 4YBZA 2PT6A 3KLPX 2UZ4A 3G0OA 1U8CB 2OHGA 1DUIA 1IU9A 2QMZA 3JU3A 5FTLA 4D57A 4LRUA 1XBTA 1X19A 5L3ZA 3MFYA 4Z49A 4HGRA 2F9LA 4Y67A 2ZIWB 4INAA 1XD9A 4ZYWA 1JR3A 1P4AA 2KLHA 4R1NA 1N2HA 3DEKA 1C9KA 1HDOA 5CH8A 4Y9RA 1Z2DA 3CX7A 3E23A 3LIIA 3MOGA 1H8ED 4URZR 1YR3A 3C4VA 3E5NA 5AVKA 4CT0A 4D8XA 1OT5A 4B82A 4EJSC 1X8XA 2MCFA 2GN8A 3WK8A 1AKRA 2MR5A 3BFKA 1YAHA 1BSVA 3NHZA 3WICA 4BNKA 2XZTA 2I0FA 3A3PA 3L01A 4BMNA 6CHYA 3SR0A 4GD3Q 3GOQA 5D3ZA 3Q5GA 4IGIA 1ULSA 4TX1A 4E5SA 4L22A 3UJ7A 1P0IA 2JC3A 1K7XB 1HLPA 1UCFA 4BGDA 1NP3A 1E66A 2QD1A 4FYYA 4JROA 1W4CA 4WVLA 2IZ0A 3K0AB 4K86A 5IULC 5JWRA 3L04A 2EBUA 3I72A 4RY0A 4E08A 4NHOA 1JQKA 1U98A 2DSTA 2QRNA 1D1SA 4HRVA 5ANRB 1WRBA 4C89A 3PE3A 2ZRPA 1PJ3A 2C1ZA 4EHKA 3N3BC 4U2CA 5DI3B 4Y2VA 5FFMA 5C5IA 3GP8A 2NTYC 2ZUWA 4P3NA 3TUZC 2F55A 2C1EA 3LX4A 4CM9A 4WE3A 4JLMA 1XCGB 3WK4A 1AKNA 3OI7A 4X00A 2WKPA 5ERGB 2JGDB 2R6ZA 2XQJA 3I01M 4AJLA 4H31A 3PFGA 5AKHA 1EFRD 1LV7A 1RLTA 3GLVA 3W5DA 2FE4A 3AKEA 3TF5A 2IYEA 4NXNB 3IAXA 3CNLA 4U2FA 4WCDA 1A88A 1NUSA 5E9AA 1NW4A 4NABA 3RKUA 1I2AA 5SZIA 3L6DA 1EVIA 2JAUA 5AXCA 3H4MA 3ANTA 2BOVA 5C9ZA 4O29A 4P82A 5ALZA 4C3ZA 1O4VA 1YONA 4LJAA 4B31A 1NW7A 4DLSA 1Y7IA 4YFYA 2JVIA 3E7WA 4X8MA 1II8B 1PZMA 2B78A 2FW9A 9ATCA 3PJGA 2VTVA 3FB1A 4ZO4A 2FG7C 2HQRA 1N34B 1UFKA 4EPVA 1P9OA 1XE3A 4KZPA 1PV2A 1DC8A 1DHTA 2OXIA 4PAGA 4UVHA 2RHCA 2AD5A 1V35A 4MPJA 3STXA 3SF8B 2Q9AA 1V7CA 4GGMX 1YDEA 1NATA 2J6HA 2BGJA 2G3DA 1GNQA 3B9RA 3BWCA 3BPSA 5FPYA 4REMA 5J1TB 1L5LA 2CMGA 1DRUA 1PEDA 4BTEA 3VO2A 3H2SA 3KLBA 2FW6A 4MOWA 1OIXA 3T7RA 3NCHA 3R40A 3G82C 4AVYA 4AIRA 2BW0A 3PQDA 2GW4A 1P1CA 1PGPA 1M2GA 3HN6A 4PG7A 1USWA 3NASA 1I4TD 1SUDA 3F49S 2AX3A 3CN7A 3HBAA 3ITKA 2ONKA 4X6YA 2H1HA 1SVOA 3C85A 4CMCA 3H9QA 4YRJA 4WAUA 1CIPA 2YHAA 3LUJA 4NJMA 2Q4EA 3QTTA 3EOAI 3O0DA 1Z3CA 1XKQA 4PSAA 2JGRA 4J16C 4Q7QA 5JY6A 4QUIA 3THYB 4CM6A 3S81A 1O5OA 3VPDA 1ESZA 1KYTA 2KBFA 1FFXA 2YICA 4P36A 4YAJA 3HU5A 1JHPA 3F5SA 4Y6QA 5HDBB 4QOJA 1Z0ZA 4Q1CA 1EQAA 2J31A 2G5CA 3CM0A 3MXTA 1MMFB 3FCEA 3L0OA 4YHHB 1SK9A 1Y3FE 5CVVA 2R1VA 4UU8A 1RD4A 1N75A 3LWDA 3PUJA 4LUCA 4YH1A 2JLYA 1WDTA 2HJGA 3PC7A 2Q3CA 1L7PA 3ZWPA 2WQ7A 4Y2TA 2IZ7A 5LQSA 3UV3A 3IPLA 5CYFA 5FLYA 5H3LA 5ICMA 3ZK8A 3IE1A 5F3WB 3I6YA 2K87A 2ZSIA 3PQ6A 2R3SA 3OQOA 1PHRA 3PDCA 3IEIA 5A3JA 4LKOA 5BR7A 3I05A 2WMOB 1FUEA 2V7EA 3DXYA 4NU0A 5FOQA 5JROA 2XNDA 5DF1A 2EZ4A 4M7RA 2GAAA 3IURA 3S55A 5CBPB 3WTCA 4GQBA 2BFCA 5JTTA 2W98A 5T41A 2CFCA 3FJ1A 4JQCA 4P22A 3RKRA 3UQZA 4ENQA 4EHDA 3Q6MA 4F2HA 4DIEA 3HXKA 3REOA 2GBPA 2PEZA 3LBFA 2FFQA 5K0BA 5CB8A 1G2QA 5ERYA 4WT7A 2D1QA 4MRMA 3ISVA 4IQ4A 5E0KB 2FQQA 4ZQIA 3ZGLA 3SHFA 5K9ZA 1CV2A 1MJGM 3BWMA 4KQWA 4B6EA 3JYPA 1PJBA 4UFNA 5MFZA 3THYA 3DDOA 3ADPA 4MVJM 5ESRA 4MIYA 4PLTA 3D6UA 3DKRA 4Q3KA 5AVYA 3V9PA 3H86A 1XMXA 2H51A 4UUBA 3NC0C 1SIWA 5E8JA 1JFVA 1YKFA 2BCEA 1JLSA 1BYUA 2WM3A 2Q9UA 3G8AA 2PH5A 4NV3A 3U3RA 1TZKA 2OORC 4WKGA 5BNTA 1VSQA 2P9JA 5EHZA 5F21A 3VNQA 3BAZA 1G98A 3R0JA 2G63A 4QTZA 4H0CA 4FKMA 1Y98A 3K05A 3TDMA 2QM0A 5CLHA 4JUBA 4ZTBA 3UT5B 5EJ5A 1KNXA 1KSFX 2D4AA 2CNNA 3CEMA 4NECA 3TKLA 4MPRA 3WDSA 5AM3A 3RYIB 3VR2D 4I2NA 1K7EB 4M83A 2OA0A 4D4MA 1T26A 4Q4LA 1XTVA 4RLHA 2A92A 2IZOA 4WN3A 3IALA 4G1MB 1YI0A 4EK9A 1DQRA 4KLNA 2FQWA 4TPKA 3D6AA 1FNCA 5JFGA 3T1YB 1CQXA 1DJPA 3GF4A 3W8RA 1UH5A 5JSHA 5I5EA 1E9BA 3QXHA 4EMTA 5MN5A 1DO0A 2XZLA 4OO3A 2IU6A 3IP5A 5H1YA 5CD1A 2QRQA 1I3LA 3BHJA 4OJNA 3G5MA 4FW8A 4UC0A 1RDFA 3W0LB 2FUNB 6GPBA 4B09A 3GQBA 4GX2A 4UCQA 3PUIA 3UPDA 4MV4A 2ZE8A 1E5QA 1ITZA 1A76A 3IXMA 1XMSA 1PR1A 1E1MA 1U3UA 1CUZA 2ZJ0A 3L6CA 3TTTA 4BKPA 4MWZA 2E4UA 1LI7A 1W4BA 3ANXA 3NDJA 4G4IA 1RKVA 4E30A 2MYTA 1IULA 5JSFA 4QYMA 4MH0R 3MLEA 4RA6A 4PEVA 5JI2E 1AZWA 2VHTA 3TXXA 3TB6A 3ZNPA 5FX2A 4D3YA 2ON6A 1HLFA 2OLEA 4HFRA 5JSUA 4JKIA 3ICQB 4I2VA 2Q4OA 3EQ9A 4IV5A 1ULTA 2D8AA 3ZWXA 4TMZA 2R6GA 3OZXA 2XIQA 2YMQA 3EISA 1ZHFA 2NMVA 2EEPA 4CIXA 3E7XA 4N3NA 1ISHA 3DFIA 3KUDA 5HMLA 3ROFA 2Z6AA 2QEQA 2BGUA 3ZIAA 1GU0A 2GARA 3R44A 1Y3CE 3HH8A 4PSKA 1FU8A 2FN7A 4KQ9A 4OHFA 4W7HA 1NT4A 3F5QA 2NO5A 2DTEA 1PZFA 4W5WA 2VYND 4MW6A 1X42A 2V0CA 3OPYB 4GXNA 5EJGA 2VSXA 2C3OA 4DLAA 3OQNA 4JOQA 5ALSA 4F04A 5A9SA 1W96A 3M6WA 3SQXA 3LX5A 3ZVRA 4EA7A 2EVWX 4F5YA 1H6CA 1ECBA 2RGCA 1WLSA 1S3IA 4O4LF 1NUTA 1X1BA 2FFJA 2LDBA 3B1ZA 3RRBA 4AQDA 5CB0A 4JI8B 4V0KA 4AY6A 4YALA 3K1AB 2DFLA 4MI3A 4QYIA 5LWHA 3NDPA 4RFSB 4JBIA 3ZXIA 2I8AA 4PZLA 2HCRA 1JALA 4MTCA 2VBGA 2XNJA 2I2WA 1M1YE 2XMDA 2XUOA 3LC0A 4K87A 2YYYA 4F3YA 3WTBA 3QG5A 1LPPA 2GD2A 5A3SA 1DAKA 1DEKA 1L5VA 1NQWA 3IQIX 1JSCA 1G7TA 1O03A 3I9NA 1GGEA 3L8DA 3OTHA 3QI2A 4LS3A 5DK6A 3WYEA 2XXAB 5I9LA 4L9WA 4QBHA 1T8TA 2ODNA 1IQRA 3LYHA 5EUMA 3WK7A 5JIBA 3D7RA 1JQJC 1G5TA 4QFMA 3KR2A 4B6PA 4YCNA 1W5FA 1PUIA 3CLSC 4GWKA 4ND3A 4MUAA 4NMHA 1NBMD 3A6PC 3PNKA 2VLIA 2RAPA 1XQ1A 5FPPA 1R5NA 3TZQA 4ZXFA 4G5SA 4DG5A 5C8YA 4C0KA 1OWOA 1KU6A 1YJ8A 4DSOA 3B8HA 1A8QA 3EUFA 1OREA 3CU5A 5AVJA 1FJGB 1SFRA 3GD5A 3NIFB 1W76A 1U7WA 3U9SA 3MTAA 1T9GS 4KVAA 2EBFX 3VH1A 4CKCB 1S96A 2VP4A 1Q74A 3CISA 2PUTA 4GMGA 5AUPB 3UAOA 3KOZA 4V0RA 5LP6A 1ZMBA 2BC9A 2C97A 5AXAA 1P4JA 2NPOA 4ROSA 5AO9A 3V7NA 5A9SB 2ZWIA 2RGYA 3KKQA 5AM2A 4Y2UA 4HAIA 2FW8A 1R2QA 1B16A 1CS0A 3GCWA 3GN1A 3LXUX 4X84A 3ZGVA 3ZLTA 5ALRA 1ZRMA 2YVKA 5H81A 3V42A 4JHLA 3Q3VA 3TOZA 3WGMA 3IKVA 3GDOA 4NMWA 4Y7CA 2GKOA 1P3JA 2V7VA 2YV5A 1MB4A 2QOEA 2R87A 3BMXA 1X7HA 2VDLB 4ZP1A 4IEEA 2PHZA 2HU8A 4P4UA 3ND5A 3TNFA 3DL2A 3M83A 3X1DA 4BNDB 3WA6A 2YZKA 1YZKA 4R54A 3SKXA 4Z9BA 4R7ZA 4DUYB 3C1OA 1EJ2A 2JGJA 2O3TA 3OCXA 1AS3A 4GWGA 1D4AA 4NOLA 1GRVA 1MIOB 1M5UA 4UNIA 2E82A 1R9MA 1WDMA 3I04M 4JK3A 3U7IA 4XGQA 1XPUA 2VP3A 1G0OA 2FUG6 5TT1A 3ZEAA 1QDLB 4WERA 1T8SA 4R8SA 5HTKA 1W36C 4RENA 1MDBA 1NMZA 2ZBPA 4X7MA 3I8SA 4GP7A 3RAJA 4HUQB 4CV0A 4FC6A 3PDHA 5H68A 1BYIA 1DOAA 1FDWA 4MR7A 2P2GA 5K09A 1LPMA 2C07A 1BE8A 3FTDA 4C0HA 3CLTC 1JG3A 5DRTA 1RI2A 4JP3A 2G16A 1BHO1 2D6FA 3QTLA 3MBIA 3UO8B 1GR0A 5HIIA 4W5NA 3W8DA 3CJTA 3CVJA 1WZUA 4IMIB 5IAKA 2IS1A 2O1SA 2OB2A 2AW5A 2X86A 3LUGA 3WL8A 4RMHA 2BF4A 3QFSA 4MCJA 3IAM6 2QT9A 3A9CA 4HQFA 2GGSA 3GK3A 5DNDA 2BGNA 2ORWA 2PSEA 1Z16A 2QF7A 1VLMA 5BSFA 2Q07A 5CNMA 5L53A 5IF9A 2AJDA 2IF0A 1GCOA 4AL4A 4DMLA 4JT8A 3IEXA 2GXUA 2Q6VA 5EQJB 5HZGA 2JL1A 3BMNA 3LL7A 4BYGA 4D6YA 5T4HA 1M9NA 5DTJA 1WQ1R 2RI0A 2O50A 2IYPA 4O2AA 2COUA 2QRZA 2A9RA 2UVQA 2IBSA 4AP6A 4BNJA 4P4SA 3TW8A 2CLEB 3QEKA 1QP8A 1R5JA 1KBOA 4OPMA 5J43A 4GIBA 1THGA 1LA2A 4OHUA 4RY2A 5KYUB 2P2CA 1NV9A 4QU5A 5IX8A 1GQRA 3UFXA 5DASA 1ZL0A 5AI9A 1VMEA 5JVDB 3UUFA 1E3WA 5FOTA 2B35A 2EL7A 3WP0A 5BV1A 5AW8A 4DF3A 2QRLA 3ODGA 2MSLA 1JKMA 5F52A 5LZ5A 1WHTB 2Z57A 3GLTA 2GASA 1EG7A 1IJEA 1JIQA 4ZARA 5FUYA 4MR7B 3ZCVA 3STHA 1GWNA 4QDOA 1JEYB 1GNVA 4FYWA 3VNBA 5BPHA 5JZVA 4F6RA 5B2ZA 4PX3A 1VKOA 2AG0A 4JFRA 5ESDA 5BRNA 2ZDQA 4F7WA 1K66A 2ZTHA 2G80A 5FUVA 5KSZA 3BGIA 3IRVA 4CGZA 3FI0A 2XCTB 1D6NA 3GLKA 4RJKA 3AVUA 2VS1A 1I8TA 1X1QA 3A05A 3LW8A 1BX1A 1GRRA 1R00A 4DEVA 3VJKA 2LP4Y 2I03A 3I76A 2IEGA 5LA6A 1XEXA 2Z5FA 1Y7PA 1P5ZB 3KJHA 4G8CA 3IIJA 1VL1A 4P81A 3OESA 5JJIA 1NN1A 3D59A 1WB4A 1BS2A 4KKVA 1WQ3A 4Q9JA 2ET6A 3E18A 5H3CA 1VLJA 3IQXA 1MC4A 1SULA 2YWDA 3HNPA 5A5FA 2R6JA 3VBEA 2ID4A 1JPVA 4DYDA 1TYEB 7REQB 3QWIA 4EUSA 4N9WA 2D1SA 4G85A 3RANA 1P1FA 5HCUA 2CE2X 4HQ0A 2BPOA 5ILQA 3V1LA 2RBKA 1BEZA 1IPFA 4DMFA 1QIDA 1QJ4A 4OSPA 3SNHA 1FPMA 3X2FA 2ZQ5A 2WQ6A 2HXYA 4DMCA 1OB2A 4IDFA 4EI2A 1R6VA 4G24A 2C1XA 4WN9A 1HT1E 2J3QA 4N0PA 4OFXA 4KXNA 2DBRA 1H2YA 2AOXA 3D1VA 2H00A 2AHOA 4AZ0A 2IDJA 1ZXLA 2TMKA 2NO1A 4JGBA 4HVTA 4L0CA 1KP3A 2FOXA 3V8EA 2XDQA 3U62A 4ZHSA 3WRXA 1KPHA 2PMDA 2J5QA 1K6IA 2Z4RA 3IEVA 2HWKA 2ATVA 2XDYA 4Z1MD 3Q3JB 4GL4A 4OL9A 2F67A 2C9MA 2IXAA 1BN6A 1XT6A 2J3IA 4MDEA 1XQVA 2BFAA 1P91A 3AUFA 2CDAA 3MN1A 5EJ6A 1BEEA 2JASA 1L7MA 4M76B 4BE9A 4Q03A 4S2EA 4OHOA 5LKAA 3JQGA 1YZGA 4YECA 1FDIA 2FMXA 3UJ3X 3N28A 5U1PA 5ILOA 2WWIA 1Y34E 2REQB 4ALNA 3KBBA 4QNMA 3QG1A 3H4IA 1KYVA 4AY4A 1XZDA 4RS4A 3AR7A 4IUBS 3WL7A 2AC2A 4U8GA 5LMZA 5J2UA 5I3CA 3BFJA 1R3DA 3CNHA 5BSVA 3VDXA 3KJNA 3SI7A 2Q2WA 3NFYA 4WXHA 1PZHA 3RYHA 2ATCA 4TMWA 1W47A 4IO0A 4Q4JB 4OQLA 2DPXA 5ADVA 3EGDB 1GZUA 2HRQA 2V7BA 4NBRA 1S8NA 1PSWA 3HA5A 3IQWA 3MMPA 4FFMA 4I19A 1VHJA 1SB9A 2B8NA 4FS8A 5E9QA 3EDCA 2Q5HA 5SY9A 3DKKA 3H5OA 2CBZA 1SUPA 4XX1A 1OT3A 1GUDA 3QPCA 4OAQA 1SVLA 4MARA 5CT4A 5BV7A 1FRVA 1RAFA 1KE1A 2VP9A 1MV8A 3OAAD 1L5YA 1Q0TA 5J2TF 1WVIA 1YS4A 4PXAA 2PSSA 2R84A 2ZATA 3C14C 3BJMA 4LG1A 4NENB 2YFKA 2GMWA 4Z3DA 3SJCA 1NYQA 4JUIA 2R8ZA 2BFBA 1J42A 3UENA 5J4LA 4IVNA 1WMFA 5A06A 1O5TA 1YQUA 4F1JA 1OWPA 2ZRQA 3A6ZA 1XFAA 2FF7A 4PC2A 3FYHA 3DPUA 1JA9A 4UAGA 5FHQA 3LQFA 4NCIA 2O5CA 3HCRA 4R1MA 1PT6A 3TYXA 1U94A 4WOBA 1HX7A 1GADO 4FT4A 4MTLA 3ILVA 4TVBA 4WZAB 5BN4A 2KHZA 3EZXA 3U09A 1TEHA 3DKIA 3V1NA 3WIEA 5H8WA 4NEHB 3BDVA 1NBWB 3KFXA 3OQ6A 3EXFB 2YYSA 4E03A 3G5TA 1DXYA 3F96A 2F8SA 4K9OA 4B80A 2CKMA 2OM2A 1VBKA 5CT5A 5MGNA 2QB5A 3OF2A 1MH1A 1EBFA 1SCUA 1J8YF 2R97A 3MTJA 4MROA 1CE8B 1RP1A 4M21A 2IEIA 1Y8QB 3H1FA 3G8CA 3NOXA 5DYNA 4PVCA 5LU8A 4X20A 4H4CA 3USZA 2O0MA 3CZQA 3CVYA 2NYRA 3DO6A 3ZNQA 1NG9A 2SCUB 3RJZA 4LPSA 1P2TA 4EAQA 3KJQA 3PL5A 1Q1AA 2JZCA 4H1UA 1VLLA 3FKSD 5IABA 1QANA 1P74A 1ISFA 1U1GA 2Q8PA 2AG1A 3GP3A 4OGLA 2PBLA 3FHLA 2PLWA 4D9BA 3D4IA 4GC5A 4WCFA 3X43A 3HCEA 3KQMA 1JR2A 3GAFA 2HPZA 1XVAA 4PLWA 3DZ8A 4P4SB 3RC7A 3TW8B 4EB8A 1QGOA 4INPA 2KM1A 4UTVA 3THSA 4D4IA 5PNTA 4D8VA 5ADWA 2ZTVA 1HFWA 3LYLA 4M99A 1P7WA 2PUWA 4Z7OB 3JVVA 3AY3A 3PUXA 1ULAA 2M1ZA 3B9PA 4OJMX 2ZJ3A 4WXRA 4YJ3A 4YWHA 1RWWA 3RUIA 3UGKA 3CKMA 1XHEA 1R74A 1R4NB 1JR4A 2PUJA 2ZWPA 3IAS6 2C9ZA 4G4SO 1OJ7A 4OXRA 3TBFA 2OK7A 3A1SA 2WAOA 1H94A 4DAEA 4X90A 1KK2A 3UK2A 1QVVA 3TTVA 1L7OA 1ZRHA 1VG1A 1X7ZA 1QE3A 1G291 1RBYA 2XSZA 3C8MA 3CRMA 3LUPA 1T13A 3KSBC 2OP0A 4PC7A 1SAYA 4KQFA 1QSGA 4JZKA 3PE4A 4LZWA 3LHFA 3MB8A 4RAQA 5J4HA 3G68A 4R6WA 2WP8J 4CKZA 5LJLA 2GEFA 2PUGA 1LRJA 1TJ3A 2G9RA 2IVFA 4Q02A 1Q15A 4ZOCA 1SXJB 1SZDA 5C7OO 4G5OA 3WSVA 3RS8A 3WLTA 3DB2A 5FWXA 3W06A 3CH4B 5LP1A 3UPUA 1FYWA 2XUKA 4OHRA 3LT0A 4TTTS 5THQA 4DCNA 1QYRA 4A91A 4Z1OA 3L7BA 3K0AA 3QF7A 4IG4A 3V4ZA 4R1SA 2I6TA 3V8PA 2WA1A 3IAHA 3PDJA 5IDYA 1H3FA 1AKYA 1N9GA 1RLOA 3CH5A 1RAEA 2W5UA 5DX1A 2FSHA 4JI4B 1U5AA 3S1LA 4G1UC 3T5BA 4U0KA 3DE4X 3G8BA 3SX2A 3GZJA 5CLFA 1KZGB 5E3JA 4H6PA 4AB1A 1EIWA 3K2EA 4BNYA 3AL0C 4BAZA 1F2TB 1YJAA 2BEUB 4LJ6A 4R9UC 3ZE1B 3PX3A 2OWEA 3DWGA 4QJ4A 5BN1A 1O94D 3TLMA 2V5VA 3AFOA 1JA0A 3LLCA 2VRCD 3AB3A 4F1KA 3IMEA 4EVSA 5LDHA 3ICWA 1VJCA 3QFHA 5BR1A 1LC3A 4YRKA 1HO3A 4HPJB 1RQGA 1XU4A 3A6FA 1XMIA 1E0JA 1MXFA 1U0HC 2DFDA 4HGNA 2P69A 5C52B 5AOAA 4A8TA 3J81k 5BSUA 3PQ2A 2GK6A 3EF3A 1H2XA 4Y2GA 4AJJA 3LBNA 4P93A 1SUCA 3KTAA 3STUA 1N6NA 5BUCA 3FSGA 4YJFA 2NUAA 2AD1A 1X8LA 2JH9A 2PL5A 4FONA 4RCVA 3PFIA 2EYUA 1Y7LA 4A6XA 2I7CA 4U2GA 4IDAA 1E3IA 2I76A 2V7TA 2ZBFA 1L8OA 3B51X 4DCSA 2XDAA 5CAEA 3NHYA 3LCVB 4EKIA 4ZIRA 2BRUA 2MYPA 1X2BA 2K7ZA 2PXCA 3OP1A 4N03A 1RQ7A 4C3OB 1VKZA 2P30A 3EOZA 4ZZ0A 3CR7A 2Y1OA 2ONZA 4IJVA 4A16A 4C4TA 5BV0A 1YA6A 3EFHA 1JPNA 4II3A 1FDTA 2L0XA 3WLKX 4OI0A 1M0TA 4PR0A 4BFYA 1IIRA 2IYQA 3AOEC 3C8ZA 3JYOA 3G9ZA 4W82A 4WY5A 4EBBA 5LOVF 5LVAA 2FQ1A 2BMVA 3HO8A 4HAXA 5AW5A 5EQTA 1YVEI 4FNOA 3RREA 4G0YA 1IHUA 1CDEA 2H1VA 3CF4G 1ODFA 4ZU3A 1DBVO 1W49A 1BFDA 3H16A 2EOAA 3VPFA 4TL8A 3AWIA 4TMKA 1CY2A 1H1DA 1NJ6A 3DVAB 1PQUA 3HMKA 4HC4A 5JASA 2CYCA 5KSYA 2AI3A 4RVDA 5AK4A 1EVYA 2XUFA 4QELA 1LW7A 4N76A 2FSIA 2H2HA 3BIXA 4FCVA 2OCLA 3GOHA 1QPZA 4HGPA 3BB3A 2Q28A 1TC2A 1RT9A 3AIMA 1SBIA 3PU6A 1TQ6A 3TD2A 1FP7A 4JA0A 2JBHA 1RLUA 1UPAA 1P2VA 2WDPA 4BEWA 2BISA 3NBZC 1F8FA 2CUTA 4NATA 5DGXA 2G9UA 2NZ2A 5H7XA 5PGMA 3WLFA 4D96A 2GILA 2W9XA 3I12A 5FHRA 5L45A 2X5XA 4C78A 6REQB 1D5CA 4M0UA 1U9IA 5DFAA 4RD4A 2QR3A 1PHPA 4CDMA 3IIIA 4BLOA 4G5XA 2C7GA 1T8UA 2QT0A 2IITA 1QH8A 3B7WA 3RUHA 3TZLA 5JAMA 2CVZA 2ZI3A 3IQEA 5JYDA 1YZYA 5CLIA 1D03A 1WY5A 3FMGA 4HDCA 3LGSA 5CBKA 1QH1A 5E2AA 3T4EA 1WP4A 1Y9DA 1PBNA 2G4LA 4FN5A 4Q24A 4WDRA 2IRWA 3LCJA 1NBEA 5KOHA 1I9CA 1YB2A 4YMHA 3PHHA 3I3SR 3SBEA 3AKYA 3G59A 4XVCA 2QG9A 1RBZA 4LBZA 4ZV9A 2A88A 1HURA 1HK7A 4DBLC 1YCDA 3L8HA 3SPXA 2IP4A 3C5CA 3A4MA 4IOLA 3VVLA 1W0KD 2JI8A 3H9BA 2BZ1A 1O6GA 3RH0A 3V7YA 2P2LA 2OFPA 4ER5A 1JPUA 1DV1A 3A3YA 4JVMA 3R7DA 5GGXA 5JALA 4HK4A 2JJ8A 4H6WA 1CYDA 1JQ5A 3L02A 4YTEA 2D13A 2ODAA 4MRRA 3HRKA 2D0OB 3KUKA 2X76A 4HNTA 2OAEA 1R0ZA 4P0PB 4NYIQ 4K6OA 4QGHA 5CGZA 3WMRA 3BFPA 1SUAA 3VC1A 4EVQA 4QHYA 1WZCA 4YRRA 2DLNA 1L4BA 1WP9A 5ALHA 3RSQA 3M6UA 1OW3B 5K3OA 3GJ8A 3OJEA 1JVNA 1DCTA 2JZOA 3IT3A 1TT5B 3N8IA 3UMGA 2IH2A 3IJEB 1U2PA 5J4KA 1LNQA 3QTBA 5FBRB 4U63A 4XSHA 2QX6A 4D7AA 1YS6A 5DYIA 1R4NA 4FWTA 2R8PA 5AK3A 2AMLA 3BGDA 3EVGA 3HKDB 3O2QB 3OX2A 5ALUA 4AMBA 4PCVA 1ZPDA 2PL9A 1UBMS 1HOXA 1QZUA 2PSJA 5EFOA 3TWOA 3NHLA 1CR0A 2H1OA 1RABA 1JQAA 1U3VA 4C7VA 1QRDA 5AKZA 4LBWA 4ALMA 4WOJA 2BV3A 4CR8A 2YMMA 2YVQA 2E49A 3WIBA 2UVDA 4AX4A 2A9JA 3PGJA 5JANA 1Z8NA 1T8YA 2EF1A 4O2AF 1L5OA 4PZ9A 5TQJA 1PUJA 3T7TA 2VYQA 3LWBA 1L1QA 3ZZTA 1GAQA 2WYWA 3IT1A 2ZJFA 1ISJA 4FC7A 3V33A 3GRKA 5DCWA 4LSWA 5B7NA 1RRFA 3AEZA 5LMUB 1YR1A 1GAJA 1ZM4A 3CPHA 3ETJA 4BU0A 3FHTA 4HGQA 3OMXA 2V55B 2OBLA 1HRDA 1UJ6A 3L9XA 5JSZB 4OREX 5ENDA 3SLKA 2VHYA 4FZ5A 2YZMA 1Q7CA 3FUXA 2XTZA 2AG5A 1Z5GA 2ZLBA 1G9TA 2X6TA 3DNMA 2VT2A 4OQNA 4C4RA 2XUQA 4IIEA 3FNEA 4DLXA 4DUPA 2NU7A 2YIDA 1U3GA 4KAAA 2QHXA 2IYAA 4B6RA 4BP9A 3KT6A 2WB4A 1UANA 5FA5A 4F8YA 5LQAA 2QRKA 2AFHE 3VSAA 3A3KA 2ZVQX 5M5BA 4LDAA 2QTMA 3H84A 5EESA 3O6VA 4G5RA 4FILA 1F8UA 1XEFA 5JJKA 2P5UA 1WXHA 2I4TA 3CF0A 1QFYA 4ZOAA 1FFWA 4Y6RA 3NGMA 4TWRA 421PA 3PXAA 1W9MA 1G21B 1MAHA 3OD5A 4QU0A 5FL7A 2J3EA 3W79A 3ZG6A 3ZS9A 1A9RA 1WCYA 2IE8A 3LXXA 5E9JA 2RGNA 3EGEA 2AI2A 3BREA 3HVKA 4J7AA 1T2VA 2R7MA 1G8AA 3PR1A 2CUNA 4IVRA 4F85A 2HHAA 4RD3A 1UP7A 1O3YA 3IB6A 4QOHA 4DM4A 1SBHA 2Q6IA 4YT5A 3ANLA 5CFRA 3Q3EA 3UG6A 2ADMA 2DPMA 2H1IA 3PGA1 1QJCA 1P2UA 3HXTA 5ED0A 1USKA 4O2RA 2PH7A 3AMVA 5EJ7A 3EA5A 3U7JA 3UJDA 4V1CI 3VDNB 2J0UA 2PUFA 1ZD9A 1CEQA 2VPWA 3M82A 3H5LA 4CMKA 4E11A 4RQAA 4YRAA 2XCQA 3A3OA 5LC1A 3VQTA 5D8DA 2BH9A 3LA8A 1I7DA 2ZSHA 5DYWA 2GYVA 1SXJE 1N6IA 2BDTA 2Z9BA 4RPGA 2Q3JA 1E7YA 2ZANA 4DJEC 2JD1A 1IQPA 1ILWA 1IAQA 1Y8RA 3GJXC 3UT0A 3VZRA 4A6DA 4ZYUA 1R9NA 1UP4A 3BL5A 2HJSA 1YE3A 4HNHA 3Q72A 4RTLA 3DUFA 3W6UA 1CFJA 5FKJA 2RGRA 1L7AA 2ZS9A 3BUSA 2G4VA 3I45A 2B30A 4K2HA 5FYDA 1X86B 2Z1DA 4IWYA 3ZXYA 2O8EB 1HFKA 2Q5JA 1OU4A 2YUIA 4PAQA 3C5EA 3DZGA 3GFSA 3KP1A 1Q1NA 3VU3A 1D1PA 5K0JA 5HF5A 2DXIA 1L8LA 4S1TA 1VI2A 3MLAA 5IS2A 5A62A 5EC8A 2OQIA 1N0UA 1TZ2A 2EQBA 4GKAA 4ZAGA 1EWVA 1OLXA 1FFYA 1OTYA 1ZJ5A 1OJLA 5DGCA 2H4XA 3PLRA 3FTFA 5GM2A 3EG9A 3QYFA 2E21A 3VHQA 2C82A 2A35A 3Q2IA 3I1FA 3V1YA 5I8ZA 2CLSA 4US0R 4WNCA 3VZPA 4BMZA 4HTFB 3ZQ6A 5EFZA 4OA8A 2ZIXB 2R65A 4JB8A 4UQOA 4CKBA 3NVKI 1BD4A 3OKFA 1IVYA 1W5EA 4G4GA 3WHPA 4C7BA 3VTFA 1LSUA 1JDPA 2OSBA 1EESA 3KVRA 3ME5A 3UK1A 1ARZA 1G41A 1KRWA 2W6IA 5HQ3B 2V45A 1XKLA 4M0FA 2VP5A 1N2IA 4OM8A 5GOTA 4TTQA 3T3DA 1PJSA 1KR2A 4Q1DA 3QU5A 3LUDA 4AMVA 1G3MA 1KAOA 5T3YA 2CSUA 4BE7B 4BO3A 1Z0AA 1OD6A 1OVGA 3ZCPA 2XF2A 3KJXA 2B9EA 3GVCA 1YGYA 3PJEA 3E8SA 1AZTA 2MMGA 4QGFA 5DO9A 3QUTA 3TIFA 1JIXA 4U7JA 2I2XB 5DM4A 5L6MB 1T9GR 2ZRCA 3BB1A 1U0EA 2D06A 2RHRA 3BTOA 3N2IA 1MIHA 1L5WA 4QSMA 3RSHA 3P2IA 3T4XA 2HYDA 1XQWA 4DIBA 4H27A 3KZKA 3HVIA 3K16A 2MSKA 3ED1A 3OF3A 3S2UA 4ZZ1A 3ADDA 1WSAA 1GGMA 1FNNA 4FMPA 3SF0A 1L7RA 1T9KA 4FXOA 3AR6A 2GTPA 4OAOA 1Q0RA 4YNBA 5T6MA 1DT3A 1RRKA 1U0RA 1W4LA 1QU2A 2X8LA 4OYRA 4QPZA 5HYVA 3PQ3A 4XIGS 3HY6A 4JT4A 2Y1FA 4ZC1A 4HDMA 5EJAA 2RGNC 4L72A 3D7NA 2O52A 3NXSA 4MJXA 4IMJB 2VP6A 5F3DA 5FV7A 4ZVLA 4B4KA 4CG1A 1U0BB 3RYCB 1PL8A 1RWQA 1SK8A 1EGHA 3E1SA 2HTEA 3KPWA 2NQ8A 3FCSB 4CEIB 1U1IA 3SLGA 4TXNA 3Q0TA 4WA8A 5K01A 3IHTA 4DTIA 1RZRD 2QPTA 4GF5A 4JBGA 5AHKA 1ZX1A 3S1SA 3LS2A 2P5SA 4EF6A 2DT8A 3HSKA 3OC6A 1ZGAA 1N0IA 4CUKA 3K6SA 1DXQA 3FETA 5ILGA 3UXHA 1U2DA 3LDAA 3OZIA 4OQFA 3SS8A 4EZEA 1SKMA 3ZGYA 2XZPA 4QFCA 3SVTA 4MRPA 5K4GA 4LMPA 4MKFA 3VOAA 1GRNA 1GYQA 3UW1A 2NYVA 1LFAA 1MEJA 2V3VA 2YWHA 3COSA 3AIIA 3D4BA 5IEBA 4XGNA 3ROXA 4FMCB 3VJRA 2HV9A 5AW3A 3GVXA 3VX3A 3DONA 3HEAA 5KYVA 3EASA 2XMPA 2CL6X 5JWHA 2D5LA 4PYLA 2R4QA 4QTUB 5HF8A 4RGVA 5P21A 3MOIA 1UJ4A 4AUKA 3AHIA 1C3OA 3PNQA 2PO7A 4ZVNA 2W43A 2O6LA 1VDZA 1WUKS 3I2FA 2B69A 2OD7A 2W58A 4MGYR 4BX8A 2QX4A 2EHJA 5IK2D 1O89A 2CNWA 1QGZA 2H08A 5IF3A 2X5KO 5FUWA 4HDMB 2MDTA 1L4EA 1QK3A 1MHTA 1P33A 4K6CA 5CM2Z 1LBSA 5CCDA 5SY4A 3ROEA 5I51A 3OU7A 1IEXA 2K2WA 2P4HX 3R3SA 2GNOA 4FGSA 4FK8A 2PZFA 1SCQA 1WW3A 3UMRA 2J3HA 5KOIA 2HL6A 1YOVA 3OCJA 3WLLA 4G8BA 1F1BA 3QF4A 4WD3A 2WSIA 4DJJA 4NK5A 3TAUA 1R0WA 5DMHA 1JSZA 3T8YA 3PITA 2O7RA 4B6OA 1RJ9B 4GBGA 3TCNA 7REQA 3DBHA 1PLLA 1SKYE 2DE0X 4NQRA 4NC9A 3Q7TA 1HDCA 4AX8A 1GTSA 1IBMB 1XSEA 3CLUD 1E0SA 3D5QA 2QVGA 4PXSA 4QQ8A 5BV2P 4KTVE 2QVCA 2HN9A 3RT9A 1GAXA 1RZ3A 4PPYA 1JWLA 1K88A 4QNNA 1K8XB 1Y1QA 2XXJA 5CD9A 3QWHA 1I2CA 4REQB 3EMOA 3G13A 5HIKA 4LGMA 3SOPA 1N6KA 1N33B 4FJ1A 1I7NA 1X38A 2B61A 4MVJA 1B0ZA 4OF4A 5ALYA 2D5CA 2FSGA 4N5NA 2IX9A 2AMYA 1VL6A 2G1AA 2GA8A 5A3VA 3MTIA 2O5VA 3UA4A 3B85A 2H07A 3HRIA 4RTJA 3L8CA 4QDKA 4Z53A 3FGPA 4E5UA 4FD3A 3ECAA 1PSDA 1IHDA 4RTMA 4GXQA 3IS3A 3IPAA 2YV2A 1C3EA 1EXMA 2I4LA 1HZZC 2FSSA 2LV8A 5EY5B 5LL6P 1Z6YA 4N4AA 3IPYA 1F1JA 1VJ0A 4QNRA 4BZXA 2IU3A 2AOWA 3G1UA 4C4SA 2GM5A 1IBCA 1NU8A 2WWRA 3OEEA 1EZ4A 2HNBA 1F3OA 2A9FA 2HMUA 4PLGA 4WMLA 4XWOA 5DHRA 5T57A 3ZCTA 1XTKA 2ZSEA 3DUFB 1RRMA 1E79D 2DMRA 2Z8YA 4G5YA 5K8VA 3P9QA 2FJPA 4JWKA 3ZCUA 5LWQA 2GXQA 3FUUA 3BWYA 4KODA 5KKCA 1VYHA 4EGCB 4IOJA 2P0AA 3PT9A 2IY8A 1AQNA 2WFZA 2J09A 3D8HA 2XY4A 4NCJA 3AEYA 3GFGA 3SFVA 3MWEB 3WQSB 4ESHA 1U80A 3H2BA 3NHMA 4G36A 4BO2A 1OLXB 4KO3S 2CFTA 4HG2A 3TG8A 3RADC 1Y4ZA 1EQUA 2H29A 2J7PA 5AW2A 1RZVA 1JB9A 2VHEA 4ZEXA 3UEOA 2DECA 3D7MA 5K6RA 5CM9C 1D0IA 2ZB8A 1FBNA 3EJ6A 2FCAA 3PG5A 4G01B 1SH7A 4I9NA 3P97A 2GCEA 4JDUA 1NONA 3R20A 1Z39A 4QASA 3WB1A 5C4MA 2G67A 3Q98A 3KSAC 3MHPA 5CP8A 2EJCA 3SKVA 3GNQA 2KX7A 3B1FA 4BFCA 4YP1A 4F5EA 2BEUA 1PK7A 3NYQA 1NWCA 4XX0A 3R4CA 5K0GA 3W2FA 4C0LA 3E8MA 1QB7A 1O96A 4BECA 1YKSA 3UICA 5CHYA 1IM2A 1NAHA 5AJTA 1GKUB 2O8FB 4QBIA 4DQUA 2NVWA 3I37X 3SFZA 4RX1A 4J0DA 4KO2S 1TF2A 4QTYA 1D6JA 4F4CA 2CW5A 2Y66A 1UDXA 1BGWA 3AJDA 4JYCA 3TEJA 1PS0A 1YC5A 2A9VA 4UD2A 4MQEA 2Y68A 3WWOA 2LW7A 5GADl 4YRQA 2VRCA 2IU4A 2W6NA 2OHOA 4X7RA 2FETA 5A02A 1FUKA 4TMVA 1XVVA 3F8TA 3RK4A 4F46A 4PHTA 1TW3A 4JJZA 4J1TA 4UBNA 4WEOA 2LWIA 1E3JA 5E4FA 5IVIA 4C7OA 3PENA 4MVJP 5FCDA 4W5RA 3TIGA 5C1DA 1EFAA 3VR3A 4N8SA 4D8YA 1H3NA 3UHOA 2ODWA 1UBLS 2ZRLA 4JLVA 2XIJA 4BEJA 5JD6A 5DNWA 1RP7A 2HU7A 4JD5A 4MW4A 2PTGA 2VOJA 2YZGA 1UMCA 4IVPA 1W85B 2WF5A 4RZXA 1AN9A 4XUCA 2DY1A 2X7HA 2R1ZA 1XDZA 3B1WA 1O77A 9MHTA 2WWXA 4W1RA 4K9RA 3B7GA 3K3PA 1EBBA 2QRHA 2QJTA 3MNFA 5FBVB 2Z6QA 2OGUA 3MW8A 3N6XA 4NESA 3CRQA 1KYXA 4MMXB 5DE3A 5H82A 4ZI5A 4DWJA 2XD9A 5A6VA 3QFRA 3GPDG 4FQ5A 1VFPA 4XB1A 2X0EA 1WPRA 1Y63A 4FPXA 5ES3A 2I34A 3K4HA 5G0UA 2AV6A 2NZXA 5BQ3A 1AD2A 1RWXA 4RANA 4HB3A 3ZGZA 4OSOA 4RF4A 5EG5A 3WDMA 2O8FA 4KNYA 1N3BA 1YJCA 2QUIA 2HR1A 1T6ZA 3KPJA 4G8JA 3CFAL 1Z8HA 4I9UA 2O8BB 1K08A 3V4VB 3M9LA 1A96A 4WLNA 1KVTA 5CA1B 1Z26A 1NSYA 1LDEA 1SQGA 4YP5A 1CEYA 4P3XA 1JDTA 2YY7A 1DLIA 3PPIA 5CVJA 3WYAA 4W63A 4BJ6A 2F7SA 2VRWA 1QLWA 3ZD7A 2OZPA 2H48A 3E0QA 2E4YA 3TLYA 3LIPA 4HQKA 3N0VA 4JBYA 4QUJA 3W77A 3O8QA 4NYJQ 3HDTA 5EYPA 1WDKA 5KOJA 1S7GA 2BGTA 1L7NA 2P7HA 3KK0A 3LCRA 5K8CA 3FKSA 1SHJA 2CBXA 1O5IA 1CNMA 2QIOA 4WTOA 5EWMA 4TYWA 1D2NA 1BA2A 1Z8DA 4WEQA 5E1OA 1H69A 4DVGA 3SF8A 1UM9A 3RYIA 4LQDA 3B82A 2QNIA 3HM9A 4FFVA 3N59A 4CLXA 4TT3D 4CLOB 1I5OA 3EZYA 2ZKIA 4RS3A 5EPUA 1QK4A 5JYCA 3H3FA 3OOEA 1P61B 3VU1A 4H3VA 1EWKA 4C4YA 1PEYA 4F3CA 1PZEA 1G5HA 4BFXA 1VE9A 1QZXA 1JP7A 4PHCA 2HHHB 2COEA 3A7DA 1RJ9A 2W4MA 4QRIA 2NZJA 5BR4A 3TOVA 2XUIA 1P2BA 1X8JA 3DL4A 1MC5A 5AKKA 4CVNA 4AUEA 2GYYA 3WLAA 4E32A 1E6EA 1NPYA 1DIHA 1G60A 1PR2A 1WUHS 1JAHA 2E4WA 4PHHA 1YZHA 2R11A 4JR0A 4FCWA 2A33A 2JLBA 1R27A 4P7JA 4CKEA 1QCYA 3VVBA 5JNSA 4HVAA 5L3VA 3BIWA 3LLUA 5I9BA 2GAJA 1DX4A 2XNDD 1DQYA 2Y8EA 1FZTA 1CUJA 3X1XA 5DNCA 1SD2A 2I4MA 5G3YA 1CQIB 2BUCA 2GFHA 1R6AA 4WFIA 3BXGA 2A9PA 2RG1A 4DG9A 4WOKA 5ITZA 3LY5A 4J0QA 4M86A 1E1RD 3BE4A 4X61A 5JI3E 4KPYA 4J1NA 3MJ4A 1C50A 3BQ9A 3PXEA 3QPAA 4KDRA 4LMAA 4MYTA 4HZGA 3HP1A 2ZW9A 5D3QA 3OHPA 3ESQA 3N2NA 3TLZA 3OOHA 1N7GA 2BFMA 2X1VA 3DC7A 3TJRA 2WNIA 4FYVA 3ISTA 2GD1O 5JS2A 2CYBA 4FZVA 3L1UA 4AICA 3NYWA 2UZ1A 3JPWA 4J7CA 2OOSA 2NNLD 5A0VA 2GR8A 4CQMD 2RKWA 1BFUA 4WDQA 2RJOA 5D3KA 2BELA 1Z37A 3K71B 5DN6D 4DS3A 2HXSA 1O4WA 2QL5A 3IQDB 2IXGA 5AW7A 2O59A 2CEAA 1PV1A 3D2LA 2XI4A 2OVFA 3I9LA 1I4DD 5ALOA 3X1JA 2VPXA 3TLXA 4V2UA 3DE1X 4ZJUA 1MORA 1OFUA 1OZGA 2HIHA 2ZYVX 4FGJA 1KQNA 3IQHX 4RH1A 1EEXB 4H17A 2A5LA 2ZSKA 1LLFA 4B0PA 2WZDA 5KDOA 4X6XA 2ZAGA 3U19A 3I4LA 1IMJA 4MK4A 1F12A 3E81A 4BIIA 4P3KA 5AHWA 3RVQA 3CEPB 3BXOA 3P94A 4D0GA 2Q7DA 3FTNA 4IS2A 3RSFA 2IPMA 2VEOA 3TSOA 3ETLA 3EBPA 4N7JA 1AA6A 3SC2B 4UUMA 3AF1A 4FUQA 1BU8A 3RLIA 1RI4A 3P2EA 4XQCA 4OIFA 3P9CA 5B1YA 1QRUA 3GFFA 4F9EA 3PWSA 4QYTA 3WLPA 4W7IA 3DHVA 3G2OA 4DCVA 4L5CA 3VKFA 2B37A 3SCZA 1M83A 2YHBA 3FDXA 1LBEA 1P77A 3AYZB 4S1OA 4ZYTA 1BH6A 2C57A 3I1YA 5C51B 1DWOA 2Q3LA 4YJ3B 3D0RA 5LBUA 4P98A 3PNMA 2HRBA 4LV6A 4AG5A 5IEJA 4M8IA 4LTNA 1Y3IA 1XPRA 2AF4C 4QWWA 4EEKA 1QP7A 3BH6A 4URYR 3LKZA 5FAXA 3PRHA 2NXWA 2O7SA 1ZS9A 4QL3A 4YLGA 2X8JA 3KKLA 1II8A 4Z2AA 3AEQA 3KXKA 5FI0B 2BJHA 2CL0X 1EGMB 4OMUA 2GJSA 2IOFK 3QE0A 4J1SA 4QDXA 4FMDB 1MO5A 5CDSA 3X1KA 5A4DA 2O05A 2POCA 3HWSA 4JXKA 2DP4E 1A7KA 4TV8B 4AAYA 4L5AA 3ZHSA 3GBVA 4BNIA 1E2HA 1IATA 1FLNA 1IJKA 3RHTA 4PWYA 1UBJS 4X1KB 2X0DA 3WNVA 1KZ4A 4OOFA 1I4WA 3TN7A 2HK8A 2IPOA 2ZT8A 4MHSA 4BVGA 1A9SA 1EVKA 4S04A 1RQRA 1XCJA 1NXTA 1TJNA 1QFJA 2BMJA 3GEBA 4QG7A 4HNSA 3SR4A 4TTAA 4FB4A 5K3EA 4E14A 1DDIA 3ZQJA 5IM4F 4R3NA 5E1BA 4ZAFA 2XWSA 4LC9A 4N8EA 2WUWE 1EVLA 5EIWA 3KKNA 1E7SA 3RIHA 1YR6A 3K0HA 3S40A 2DEUA 2QX9A 2V7QA 2ATXA 3JAMA 1HDRA 3YASA 2XWJI 4B2YA 2HJRA 1SXJD 3QKTA 3S0JA 1XRQA 2FG6C 4Y9SA 2OESA 2A30A 3Q3CA 4J4BA 3WQQA 3AEXA 5LYJA 3AFIA 4QUEA 4BDSA 2HO4A 2O2YA 1JDUA 3JYNA 1CQZA 1WPGA 4ZT7A 1M2VA 1ULHA 2UZ3A 4B8WA 3IE2A 3C3XA 2VT3A 4BKUA 1W87A 2QLTA 2IS4A 1EWTA 1T3SA 3IBYA 4TQGA 4HEHA 3G0CA 2H9YA 3KLMX 3ZIDA 5A2QA 2YJ4A 2IUYA 5L7YA 2QTTA 1T36A 3I2JA 1OUMA 4OLFA 1Z5ZA 5DM0A 1J06A 1ZI9A 2O0KA 2O3JA 5ARCA 4KMMA 3HYLA 5JQGA 5L3SA 3PTAA 4Z86A 1T3GA 1KR5A 1UOOA 4HDSA 2GQ0A 4DA0A 1OZFA 1KORA 2X3FA 1E7QA 2ZYHA 2QN8A 4TV9B 4XM2A 3SHWA 5LJIA 3CVVA 1L4NA 1EWYA 1Z82A 2ZB4A 4RFSA 3K9FC 1XF1A 3O4FA 4FYMA 3TCXB 3NKLA 1PDOA 4HNRA 4W5HA 5AIAA 1S1CA 1WCXA 4N3CA 1Y5IA 3T38A 4JLUA 2G17A 4JJEA 5F1PA 1UK7A 2ZXEA 2DR2A 2FEOA 1NBOA 2P9FA 3O2SB 2E6UX 3BD9A 2B25A 1R4MB 1YZFA 2PT5A 2QZ9A 2Z2ZA 1QR6A 4FYKA 4OHZA 2LPMA 1U8AA 1N3IA 1NLZA 1Z0SA 3EDYA 4XDYA 1GD1O 1SPBS 2RBEA 5ETJA 1VPTA 3O0TA 5IAOA 2XADA 1WHTA 4GW3A 4F4DA 5C7LO 3OQHA 4PQYA 5IC6A 3T9EA 4QGAA 4AP5A 3ACCA 2ORYA 3AETA 4TSKA 4ENVA 1SWVA 3TLAA 1KEVA 1GNLA 4CL2A 1TQ4A 4OHMA 4OV6B 5HWSA 1KMIY 4XJVA 2WIGA 3WGHA 4EB6B 1UAYA 3D9QX 3EQ7A 1ECGA 3PJRA 5LYJB 1QHYA 1WIWA 3AU8A 6AT1A 3LUBA 5AOBA 4DV3B 2A3NA 3RRMA 4NOMA 4EA8A 1MTZA 1IXKA 4PINA 1X7XB 4C14A 1XTUA 4FWIB 3JSAA 3NP7A 5B3LA 4CM8A 1T5BA 4UQPA 3RYCA 4FEGA 1SXQA 4Y9TA 4M7PA 1OLSB 3GUUA 4RABA 1XRSB 3HCCA 4WLEA 3ZLVA 5LP6B 1DKUA 1SCBA 5CEJA 2HUPA 4ER6A 1PJQA 3ZDXB 2Q9BA 3A70A 4KFTA 3WKEA 1AE1A 1TM1E 1R0KA 2CXSA 3L7NA 4B35A 3COWA 1UEJA 3EEOA 4N82A 1R37A 2GCNA 2FYTA 3FGOA 3WDKA 4R83A 2ZJ2A 4HATA 1FNDA 1KP2A 1SBNE 2XQGA 4O1MA 2YBDA 5HKKA 3USES 2R1UA 1GCIA 1WCIB 2H18A 4ND8B 2J0UB 3VR5A 1JSXA 3DHWC 2G2SA 1JE0A 2D1TA 1BWPA 1NVAA 4HYTA 3PHLA 1W2GA 1QQAA 2YWJA 1AC5A 1KETA 1MZVA 2Q2QA <