2A84A

Crystal structure of a pantothenate synthetase complexed with atp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
287
structure length
277
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Pantothenate Synthetase from Mycobacterium tuberculosis, Snapshots of the Enzyme in Action.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantoate--beta-alanine ligase
total genus 88
structure length 277
sequence length 287
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2005-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 2a84A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2a84A01
4ND6A 4ZT4A 4DLPA 1NUTA 3HL4A 1SURA 2YY5A 3SP1A 4WSOA 3HMQA 3SEQA 4EG8A 4PY2A 4XFDA 1X6VA 3RJZA 2AZXA 2Z3VA 1EUQA 1GN8A 3A4IA 3CVYA 1J1ZA 3P52A 4HJRA 3CR8A 1YIDA 2AG6A 2IJGX 2DPLA 1QJCA 3IUBA 1R6UA 3FY4A 3LCJA 4F3RA 1LI5A 2X1LA 1KP2A 3FIUA 4HK4A 2VTBB 2CSXA 2A88A 2QTMA 3CLUC 3K32A 1NZJA 1T9GR 3COZA 1VBNA 4EGAA 1KAQA 4KPUB 4CDMA 1GZUA 3FI0A 1U7XA 4ZT2A 1M8JA 2A1TR 1QU2A 3PNVA 4BWVA 1M1ZA 2QUHA 3A05A 2PZAA 5LFAA 4ZT5A 3A2KA 1N2EA 3IUEA 2A1TS 4G5FA 1IFXA 2TS1A 1H3EA 1N2GA 1XNJA 2CYBA 2QJOA 1PG0A 1EFPA 4OJMX 1O95D 4MW4A 1OWOA 1EE1A 3Q10A 4EG5A 4JXXA 1G59A 4MUJA 4ZCRA 3I05A 3AG6A 4MVWA 3FNRA 3TQOA 3ZIUA 4NAHA 4G5YA 1WOYA 1TEZA 1GLNA 5TEWA 1H1TA 3GUZA 3VGJA 2IELA 4X0EA 3FHJA 3AFHA 4FZJA 1TYDE 4MVCA 3LE8A 1GTSA 2ZUEA 2E21A 1H3NA 2Z08A 4NAUA 1ILEA 3MLAA 1GPMA 3K9WA 3N8HA 1Y42X 3NV7A 4DE5A 1OWMA 3MLBA 1NSYA 2X1MA 2A7XA 3H9BA 3P0HA 1GAXA 3FETA 1MC1A 1ZH0A 1K97A 2EL7A 2D13A 4J76A 1F9AA 1J21A 4ZCTA 4EG1A 1WXIA 5TGTA 1KQOA 2V0GA 1WXGA 1QRSA 1MB2A 4R2LA 3UC5A 4CQNA 2G36A 1TYAE 5FO1A 1I6LA 4U7JA 1COZA 3A04A 3MUEA 1XJQA 1NYLA 3ELBA 5DEOA 4MWDA 4ZCPA 3RK1A 3ND7A 4H3SA 4HPWA 1I2DA 2X3FA 1EUYA 3Q4GA 4NX2A 4YP5A 3VU8A 2A4MA 4ARIA 3IMGA 3UOWA 1G8FA 1R6XA 4KPUA 4YP6A 3L92A 5KCMA 2J07A 4MWBA 5IHXA 3KT3A 2CV0A 4JFAA 5EKDA 1XNGA 3CLSC 1X8XA 3INNA 2GM3A 1ZH6A 5F23A 1MOPA 3UK2A 2E18A 4YBRA 1KKUA 1KAMA 1V47A 3G5AA 5AHWA 4EG6A 4PBSA 4U63A 4NATA 1QRUA 3CVVA 3IMCA 3TS1A 3ND6A 3SZGA 1EJ2A 2QUJA 1GTRA 1IH8A 4KR9A 4UZFA 1OD6A 4MUFA 3AKZA 1JZSA 1QQTA 3CLTC 4K0RA 4QBTA 2B7LA 1MAUA 2VXOA 1N2IA 2NZ2A 4AS1A 5DK4A 1N77A 3M5WA 4DNXA 3PNBA 4L2IA 1RQGA 4ZCSA 4RPIA 4EG7A 2O8VA 4R2MA 2QUIA 3AIIA 4GRIA 1O97C 5HUJA 2DUMA 3PXUA 3SDBA 1YULA 3TNJA 1M8KA 2DERA 4OUDA 1OBCA 3ZJUA 5IJXA 3OTWA 2PXHA 4L2IB 3G59A 3IVXA 3MXTA 4DDMA 4CT0A 1QTQA 3IH5A 5JBNA 2WSIA 4Q16A 4MUIA 2CUZA 2DEUA 3IODA 2YWCA 1JIJA 4CDNA 1LW7A 3SZ3A 4YP7A 3ZXIA 4EG4A 3PRHA 3P0JA 3RFFA 1N2BA 2PFSA 1KH2A 3OP1A 2DXIA 1A8HA 3PNYA 5H7XA 1JEDA 1PFYA 1T6XA 3KT6A 4MW9A 3H05A 3X1JA 4DJAA 1JECA 4AQ7A 2WQ6A 2QUKA 4PBTA 1VLHA 1FFYA 1O97D 2EJCA 3FOCA 1K4KA 5KHAA 1U3CA 1F7VA 2H2AA 3ND5A 3P0IA 1WXEA 4EF6A 3CVWA 4XFJA 2BYTA 1LI7A 2E0IA 1VBMA 1KH1A 3NBKA 3D6VA 1MBZA 3RK0A 2D5BA 5HG0A 1T9GS 3C8ZA 3ILVA 4NZPA 4Q93A 3HV0A 1YI8A 3GMIA 2HZ7A 4J75A 2YWBA 3ZJTA 2Z09A 4U8HA 1D2RA 2DR2A 1IQRA 4UZEA 1N1DA 4DDHA 3CLRC 2WB2A 5J58A 3IOCA 4XSVA 1JGTA 1KQPA 2PG3A 3H99A 3CLSD 1VL2A 3D6UA 4MW1A 1N2JA 2DETA 1JZQA 1TQ8A 1IQUA 4EFKA 1KH3A 5K0TA 3ZJVA 1Q11A 1JIIA 2AKEA 2OV4A 3FDXA 1O96B 1PG2A 1WXHA 3MMXA 1PFUA 4F4HA 1K92A 4ZCQA 1NURA 3QTTA 2QTNA 3DV2A 2OQ2A 2J08A 2GOYA 3HZRA 1EFVA 1WJGA 3TQIA 2PIDA 1Q15A 4KKVA 1V8FA 1O5TA 2J09A 1U0BB 4MWEA 2CFOA 4I6EA 3CLRD 3COYA 3H9CA 2JA2A 1K4MA 4QREA 5TEVA 3X1MA 3H97A 4JZYA 2GKSA 3QE4A 2V0CA 4MWCA 1N2HA 2A86A 1N75A 3ZXSA 2CYAA 4MW5A 4JXZA 1YUNA 1JIKA 1S4MA 1YIAA 3COVA 1QNFA 1XNHA 4GU5A 1KORA 2QJTA 3HFJA 4MVXA 4S1OA 4ZT3A 4OUDB 2CT8A 2O5RA 3CVXA 3SYTA 2X0KA 4MW6A 4MULA 1TFUA 3GLVA 2E89A 2BTEA 1IRXA 3IDFA 3L93A 1J09A 3AL0C 2A1UB 3N9IA 1ZUNA 5FNZA 1MRZA 1NP7A 2XRZA 4ND7A 3VRHA 3ZGZA 1IVSA 1WZ2A 4ZT6A 5KWVA 2R5WA 2VTBA 3FWKA 3F3MA 1EFVB 2JAXA 1TYBE 1N78A 3KT8A 1JHDA 3CLUD 2PZBA 4MVYA 1WQ3A 1KP3A 1MAWA 4MUNA 1Q19A 1WY5A 4YMIA 4ZT7A 1MJHA 3ZUGA 1O95C 3BL5A 4MLPA 1J1UA 4RUKA 1KR2A 1MB9A 4MUGA 1PFWA 1DNPA 1I6MA 3CLTD 4HJXA 1QRTA 1B6TA 1JILA 3IOEA 2HMAA 1M8FA 3DO8A 1U3DA 4WNYA 3CVUA 4MW2A 1T6ZA 4P2BA 4I6JA 4R0NA 4MQ6A 1FYDA 5J59A 5TS2A 4MAFA 1M83A 3TZEA 1O94D 1F4LA 5DASA 3CA8A 4MUHA 2PZ8A 3X1KA 1H3FA 4DDKA 3LOQA 2ZP1A 1N3LA 3UMVA 1M8GA 4G6ZA 4KR7A 3KFLA 5BNZA 4NDAA 2J4DA 3KT0A 3N2YA 5DB4A 1O6BA 3COWA 1NI5A 2NSYA 2HGZA 4I6GA 3G6KA 2C5SA 3E27A 2CV2A 2A84A 5K0SA 3ISJA 2H29A 2I1LA 1OBHA 3RHSA 2XRYA 1JEEA 3N05A 1YUMA 1BS2A 3FH0A 2QJFA 1OWPA 4ARCA 2ZUFA 1M8PA 1O96A 3RBAA 5HUHA 1NUUA 3IVCA 2RD2A 3UY4A 1P7PA 2QTRA 2A1UA 4TS1A 2JANA 1WXFA 2WQ7A 1ULHA 3DLAA 4QRDA 4MW7A 4KR6A 1J20A 1TYCA 4PBRA 3JXEA 3S3TA 3QTBA 4MUEA 1IHOA 1VBKA 3HGMA 1J70A 5J5AA 4E1AA 1U7DA 1NUSA 1O0BA 1EFPB 1O94C 1Q77A 4JYZA 1QU3A 4MW0A 1IQ0A 1EXDA 1ZJWA 1G8GA 4A91A 1JMVA 1G8HA 2YXNA 1KQNA 5FO0A 1I6KA 1PFVA 1WKBA 2D54A 3FG9A 3SEZA 1N2OA 1HYBA 1R6TA 1T6YA 3IOBA 3IVGA 3IMEA 4MUKA 1WQ4A 5LLTA 3NBAA 3TZLA 4K03A 3U1VA 1UFVA 1NUQA 2CV1A 3Q12A 5H16A 1OWLA 1CT9A 3DPIA 1F7UA 2IP1A 2DLCX 2J5BA 2RE8A 2CYCA 1OWNA 3AG5A 1O0CA 1NUPA 5LM3A 4EG3A
chains in the Genus database with same CATH superfamily
4ND6A 4B3SB 1SUWA 3G0IA 4KZKA 3IP7A 2AFHA 5JI2E 1LPAB 1A2BA 3OCCA 1L7PA 4D6XA 2PR7A 3BRWD 3D6NB 3OBIA 4JAVC 4D9IA 2JCXA 2PQ2A 1Q0SA 3L79A 1XFDA 4IIHA 1SUCA 2WYOA 4N18A 4P36A 4HVLA 5C46F 1T5SA 4RFSB 5IAGA 3N6RA 2GAFA 4YRNA 1CCWA 4ESHA 1LLFA 3N2GA 1Z5OA 4WY5A 4D96A 1NMXA 1TMKA 1LQ2A 3HYRA 4CKCA 4WCFB 5AM3A 1W7AA 4WNIA 2KYRA 4RZSA 3TIFA 2QTHA 2OA0A 1NL3A 5EHIA 4C2TA 4CFSA 4OATA 3FZEA 2FYTA 3HB1A 4EUFA 2B34A 5HJ2A 3JZAA 4PG6A 1X19A 4RTQA 4C14A 1QP7A 2PV7A 5BV1A 3UUFA 4YK7A 2MYNA 3E9QA 5CCXA 1Z73A 3RR2A 5A7FA 3R9XA 4C20A 1C9JA 4L0MA 4FOSA 5EJ6A 3ZXUB 4B82A 3DM9B 3T3GA 4QXOA 4R81A 3PPYA 2W9XA 2JLVA 4BJHB 1N0WA 1WMDA 2QUHA 5EP1A 3A05A 2GLXA 3OPYI 4MA4A 5ALNA 5HEKA 3PEYA 2YVUA 1FNBA 2PRJA 2FSSA 1I0IA 3NHJA 1LPBB 4GPD1 4IH1A 5CA1F 3OX2A 3L2OB 3O8QA 5CDHA 4HAUA 2W2VA 1F8GA 4KB5A 1FFHA 1PG0A 1M6EX 2NTJA 5T41A 3NC0C 4MW4A 3SYRA 1RE1A 2BOVA 1PVDA 2Z83A 5DGXA 4BMOB 1B0PA 2XDAA 4QICA 4EPVA 3TQOA 5CAEB 1Y3FE 4WIAA 1MOSA 2JFHA 3WP0A 1R8QA 3EAFA 1P74A 3GGSA 2NU9B 2O5VA 3HEMA 2C95A 3S68A 2HF8A 2G9RA 5DI3B 3P1JA 2GQ0A 3LX8A 5SICE 3B78A 4D0GA 4F1KA 2E55A 4G5HA 3Q8WA 5IUKC 3EXHA 4H18A 1JR3E 4OXYA 3CWZA 1E96A 1A96A 1GU0A 1VDMA 2I80A 3KKQA 1F2VA 1FUEA 3DF7A 1H3NA 3JAWB 4U7FA 2Q4TA 3BF7A 2ZFUA 5AXBA 1YS1X 3CKMA 3I34X 4EB0A 1GQOA 1URPA 2PIAA 3ESQA 1MX1A 5I7EA 1GVNB 3I1FA 3EZGA 3DQPA 1OBVA 2XTNA 4JX8A 3M9LA 4G0XA 1NIPA 2W42A 2C2GA 4BOYA 4XIIA 1QOPB 1ZH0A 5LB2A 3ILSA 5KTKA 2BF4A 1LK0A 4DJFC 2WYVA 3WIUA 1IG3A 4QUEA 1YBAA 4QUHA 2OXTA 2IGBA 1GR0A 2F4NA 1N0UA 2ZJ1A 2QV7A 3EVFA 1MW9X 2XEXA 4EG1A 5K3OA 2Q0HA 2ZVDA 1MQ8B 4C06A 1ORVA 2JIOA 3PEWA 5HOEA 1P2SA 2V0GA 1BE1A 1JAZA 1OC2A 1W0KA 3KYBA 2PAFA 2BMEA 5KVCA 4AFNA 3ZIDA 3PIDA 5E2AA 2DLDA 5DNWA 5G1OA 3LUBA 1P8JA 3F6SA 1IBMB 3RHZA 1VE3A 1O0SA 2VK1A 3RK1A 4G0ZA 4ZCPA 1DO2A 3ZE8A 3G13A 1V3UA 2H8KA 2PH7A 2F59A 2NO4A 2W48A 2Z8YA 4EY3A 1J99A 1YO6A 4HWTA 3KKEA 2ZCJA 3V7NA 1L5YA 4AY3A 5F9MA 4Y9RA 2XUGA 5K8TA 4C04A 5E1OA 2I2AA 1DKRA 2IV7A 2BM1A 2Y27A 3ZWAA 4RGVA 2I67A 3Q8KA 3C1AA 3EPRA 1AGRA 4WZBB 1VSBA 2JJMA 3HR4A 2V7XA 2H1OA 3F7OA 3A2MA 2WUGA 3KJEA 2GEVA 1Q50A 3EFEA 3G9XA 4LMBA 3KR1A 4IDEA 3OE5A 2B4QA 2HLDD 2FSVA 3TPFA 5D51S 1RQ7A 5U9CA 3U09A 4HXFB 1TADA 3DXXA 2JLZA 4IIBA 3BXEA 4ALKA 4CVNA 3Q3EA 4PPQA 4Q24A 5FWNA 3WAJA 1G8KA 3DKVA 3TS1A 1YWGO 3QW2A 1SCJA 1MEJA 1MT0A 2PD6A 3VHXA 5IZCC 3ANSA 3OZRA 1QLWA 4W5HA 3UJ7A 1K8RA 4FK8A 1XKXA 3AM4A 4IZIA 4RYLA 4U2KA 4K0RA 4RKFA 3W5IA 5FOWA 1JEJA 2ZT5A 5T67A 3MWDA 4JKOA 3SS9X 1NC3A 1SC1A 1Q14A 1VHTA 2HRBA 2O8FA 3NPAA 4CTJA 4Q4JB 4ZCIA 3AOGA 4ZJUA 5JFTA 1NFQA 3TCNA 1T9AA 5JPIA 1GL3A 1CUWA 1P0FA 3ASVA 4CKBA 2OQVA 5JH7A 4ZYYA 3VR1A 2GVNA 2SBTA 3ZU2A 2PZKA 3O74A 3KLMX 4GZ6A 5TR9A 2JLWA 1YS7A 2I7XA 2IHVA 2QW1A 5DCLA 5EG5A 4CM4A 2OHJA 2ZJ4A 5KNCH 2XH8A 1PJ3A 4HDCA 5A1JA 1RNLA 2FG6C 3KUUA 1ZK4A 3MUFA 4AU1A 1NLYA 2M6LA 4AN0A 4R7TA 3N7TA 1L7OA 1NIJA 1PEYA 1QNLA 5JHHB 1QO7A 1LBQA 3L1KA 2F9MA 3DE7X 2QL7A 4NFLA 4NZNA 3RIYA 2VYVA 4R98A 5INTA 3O3OB 2E6KA 5CRIA 1W8DA 2B1GA 1US8A 3EPPA 3HVIA 2AQHA 2R8XA 4CDNA 4E70A 1SG0A 1YZQA 2PGOA 5BSHA 4NR0A 4BUZA 5KBYA 4NXNB 4PZUA 1QKIA 4Z1OA 1M1YB 3UMFA 9ABPA 1VIYA 4UOZA 3H2GA 1RXEA 1NW4A 1RYHA 2A9JA 3DE3X 4LWPA 4EA9A 5KDOA 3RM3A 2X41A 3VC1A 3LP6A 3WNQA 4BO1A 4IWNA 2C31A 3ZE1B 2PJDA 1OLXA 2ATXA 1KDRA 4HZIA 3M82A 3ABOB 4IIUA 4EF6A 1V95A 5AO9A 3ID6C 4BO2A 5JZ9A 1ESEA 5DCWA 4EGFA 5U1PA 1GL6A 3ITEA 4CMKA 1KH1A 2XUJA 4MMXB 4X63A 1MBZA 4KN6A 5TB5A 1OI3A 4NE9A 2W2LA 1T0HB 2VQ6A 4KTVE 2HV8A 3EZLA 4QFMA 4BVKA 3REOA 5JZOA 5KYXB 3BREA 1SCNE 2GB4A 3GEPA 2XADA 4CL3A 1V5IA 3OPVA 4EOGA 3FLEA 4HC4A 1LWOA 4YMTA 1IM5A 3I5AA 5KYUA 3LV8A 3PITA 4R05A 2MJLA 2Z9BA 1ISIA 1GUYA 4ZVMA 4F6RB 1AK2A 3F96A 3HO1A 3DOOA 1QZUA 4QBIA 1L8OA 5AKZA 3WA7A 4DDUA 2QTFA 1TJ3A 1N7HA 1C1HA 1RPTA 4NV0A 5DX8A 3WWDA 5HXAA 1RAHA 2VPWA 3GXBA 4UZEA 4P81A 3CLRC 4KEAA 1OV4A 3WGGA 5JDIC 4E08A 3KG2A 1HL7A 3R4VA 1HOTA 3C3KA 5GMOA 3PXBA 4PLFA 4Q0MA 3ZGZA 3G79A 1U7UA 1ZMXA 4GXQA 2X8JA 2QPOA 4HDAA 4DIKA 2OHHA 2V1UA 2A5JA 2I2BA 3ICEA 1UUFA 4YCSA 3F98A 1S1MA 1NVEA 4CM4B 4WESA 5DIZA 1ZONA 2YJ5A 4NEGA 4CUZA 1NQUA 4NYMQ 2RBEA 2BKVA 4KK3A 3WV5A 4D9KA 3DBLA 1LPNA 4L0QA 1R0ZA 3AINA 4M9UA 3R20A 3THSA 2X0DA 4WXEA 1GUDA 3VSCA 4BJ3A 2OHOA 3BWMA 3DXYA 1JDSA 1XU7A 2WJJA 1EI9A 5LC1A 2FFQA 3I3SR 2P9BA 2EZTA 1WZUA 4BRUA 4BP8A 1UADA 4R7ZA 4FJ1A 1A5ZA 3CEAA 1RI2A 3ZGNA 1V1RB 1EFRA 3BSWA 1N2XA 2EATA 5JHGB 4PAOA 3MTDA 3QW4B 1UAYA 1F2DA 2WHQA 2IQ5A 4YCCA 5EE3A 2YZNA 4KI0A 4XTRA 1KI1A 1KHHA 4MA0A 4MWEA 4LCJA 4KACA 4BGUA 2P7IA 3FMOB 1OLSB 3X1MA 5TEVA 2QTAA 1KKMA 1NJ1A 2GKSA 2Y2UA 1G9SA 2XVXA 3ZV4A 2A86A 4IV8A 1E9RA 2CYAA 3MJVA 3PIIA 5CDFE 2GTIA 4QUAA 1WVMA 4P3OA 1JWLA 5HWSA 3HRHA 3P9ZA 3HA3A 1Y34E 3JD2A 3QG1A 3STVA 1ZI8A 5ERGB 1OTXA 5A3RA 2IOYA 2Q1TA 4FHDA 3V8RA 1H9CA 3THYA 1FTQA 3L07A 3MWFA 4Q9AA 2NV2B 3E6AA 4S1OA 3TFOA 4DRZA 3LZ6A 4ZTUB 4MRPA 3FFXA 4C3OB 1A8QA 5JD6A 1IM2A 1TM7E 5A0TA 1VL0A 1BDIA 1TFUA 3I62A 1D0VA 4TSRA 1RXIA 5KYGA 2XWJI 4QXMA 3NXKA 1MTOA 4RORA 5DN6D 2BTEA 1D4ZA 3F8WA 3VKHA 1VA5A 3QLVA 3T9BA 1OVGA 3FDZB 3ZQ6A 1ULSA 5KNCA 1SVKA 2P5SA 2QRPA 1OYWA 4YVFA 3KEFA 2J32A 1SJ9A 1F8XA 4U0JA 5AVQA 2ACVA 2W58A 3KPJA 4WFJA 1X80A 3C6BA 4KIUA 4PQFA 4NZMA 2LNDA 4MP8A 4PQRA 1ZOOA 1V1RA 2OCBA 4TKLA 1HH4A 1VI5A 5HJEA 3RABA 3M5PA 4F5ZA 3WMWA 3RYFB 1QZXA 2W0SA 1M54A 4JBXA 2N75A 3TB6A 3WKBA 1KP3A 2RI1A 2Y1EA 3N2KA 2HHLA 3BGIA 2BGTA 3V7UA 3ZK9A 5J1SB 2Z2XA 3BL5A 2HA3A 4OXKA 4MQ4A 1EBUA 3ZYCA 5B1EA 3K0FB 2H1CA 1VHWA 4C07A 3NGLA 2GK7A 5F78A 4TM8A 1CZOA 3CZ5A 2VTDA 5JQGB 4HNSA 4DLWA 4N40A 3DT9A 1NVWQ 4Z4IA 3ERCA 4XB2A 2O57A 1QHNA 1A82A 1S96A 3DTTA 4RVDA 1P1BA 4IJ5A 5D5HA 1HE3A 4WNYA 3S1LA 3B70A 4CPDA 4B8YA 1PV4A 2HDWA 1U0EA 4R0NA 4FC7A 4FT2A 5AWFC 3OUTA 4ZXFA 2OK7A 4J49A 4E21A 4F4UA 5TS2A 4MAFA 1EFDN 1U99A 1YASA 1AX9A 3F1KA 4V1CA 4JODA 4CLHA 2NZJA 4RL6A 3HCDA 1SC3A 4U3JA 1ONOA 4RAQA 5E7IA 1N7GA 3G1TA 3U4MA 2J0EA 2C9OA 5AHXA 4XYBA 4MKRA 3WRYA 3IIJA 1T2CA 4C87A 4DV3B 4TLLB 2VPXA 3ASYA 1VL5A 4RS4A 1ZZEA 5GONB 2HGZA 2JB9A 4UBIA 3U9TA 2PKEA 4AP6A 3GEBA 4BMVA 2I87A 2DKNA 2CNLA 1J9GA 1EP9A 2QQEA 2VSXA 4JUAA 1J2TA 1X9GA 1PS8A 2IYPA 5K0SA 5JJIA 3HGQA 2GO7A 2ZRKA 3KKPA 4BZPA 1VG8A 2ILVA 2RGBA 3HO8A 3DMDA 4LPKA 5DSTA 3FZGA 4K87A 2A4KA 2CD9A 2EQ5A 5SY6A 2IEGA 3REQA 1J39A 3T5AA 3THYB 1UDXA 3MFQA 1N32B 4M98A 4LUCA 4N0PA 4LC0A 4MGKR 1AKRA 3SYLA 3DNFA 5ALPA 1XTRA 2IHJA 2P35A 3WLJA 1M8PA 2CK3D 4HEQA 3UMMA 4HGPA 3RBAA 3QKSA 4FFBB 4UDXX 1SHKA 3LGXA 1PT9A 1NF2A 3PPVA 1TU4A 1H8EA 4B35A 1YBMA 2C7BA 2PWYA 3UY4A 1L5QA 3W2HA 3ZW8A 1NV8A 4DLZA 4ZDWA 2VLIA 4OX9B 2P0EA 2YYAA 3UO8B 2WQ7A 4KRYA 2PBZA 2W93A 1DO8A 4B3IA 5CB6A 1T24A 4A8JA 4A23A 1AHIA 4QLBA 3BH7A 1EA7A 4NDNE 3DUWA 1GKUB 2GXUA 2YWRA 3NGXA 1NXOA 2L42A 2W2NA 3BGOS 3HGMA 3KQVA 3QF4A 2GWRA 2P4SA 1AKTA 4WXRA 5J5AA 4EVRA 4LVUA 4QEDA 1UFRA 4JS0A 4HAYA 4WGGA 4AKEA 4F3YA 3V4SA 3EHDA 3DZGA 4IDFA 2PUDA 4QM6A 1WZCA 3H65A 1J5PA 2ZKLA 1NBMA 3EVDA 3ZHYA 4ZI7A 2CNOA 1AC5A 1G8GA 1ZXXA 4P92A 4HB2A 4A8HA 1V16A 3NVDA 4HEA6 3U7IA 1G8HA 3FBGA 3O8OA 1UPXA 5ALXA 1DIHA 2WFLB 3LMKA 1DB3A 2X2FA 3CE6A 2GFIA 3QEBZ 1V43A 2J9XB 4L8WB 3S2SA 3AM1A 1S3IA 4GI7A 1VE5A 3D4OA 3Q3GE 3L0BA 4O2LA 5F7OA 5HM8A 3B20A 1HYBA 1JDPA 3O3CA 4J0QA 5HF8A 3WLRA 1UXGA 2W0MA 2HT6A 3URKA 4BQOA 2Y2VA 4PLCA 3TN7A 1OC4A 2C3PA 5LLTA 1NY5A 5BXQC 4EP1A 3MXOA 3QKSB 1DRVA 4G1FA 4GDMA 2P1DA 2EV9A 3EEOA 2YN4A 5DNYB 3BGVA 3MBOA 1S2LA 5LB4A 1MB4A 4PZEA 3E3LA 3BZUA 1HG0A 2VRBA 4TQGA 1S01A 4IH4A 2D8MA 2IDMA 3D3KA 4JQSA 5EXSA 1A5BB 4M0LA 4EG3A 3TG2A 1O08A 1JYEA 1KDTA 2BT4A 2NU6B 3GV0A 3KQOA 5JJ5A 1NUTA 3MSXA 1HMPA 4CM8A 4YREA 4OX9Y 1R3UA 1TD9A 2R66A 1Y8RA 3FOBA 4LXYA 5BQ3A 2JLRA 2H63A 2B1RA 5JARA 3ZQ4A 3PUYA 3EPHA 5L45A 3O8DA 2D4AA 5DCYA 3UT0A 2A9PA 4I19A 4UDYX 3ZZMA 3CVYA 3ZGYA 2VP9A 2WWIA 3LA6A 2F2TA 1EG2A 1M1XB 1BHQ1 4ZV7A 5CPBA 5KOHA 4YJHB 3GPLA 2QORA 2ZRGA 1CE8A 2H4WA 1LI5A 4LXUA 3VI3B 3X43A 3ZCUA 5BWCA 5ALWA 2ZS7A 1V4BA 2P9HA 2QTMA 2CHUA 3CLUC 3GWGA 1PTKA 5HMLA 4BFXA 2CD7A 1HE4A 1JX6A 5A04A 4YHHB 4JI4B 1Q6ZA 4ED9A 3IAXA 1MHPA 1CUHA 3O92A 1Y4DE 2PHZA 1OYYA 2TECE 2H6EA 4MB2A 5EQFA 4KNWA 1VE6A 4ZT2A 3RKRA 4ZHQA 1WIWA 2ZUVA 2YTZA 3CSSA 3LWDA 2VP2A 3D0QA 3GK3A 2CXNA 1OQAA 2PKRA 1VYUA 1DELA 4U7PB 3PWZA 2JPDA 4M60A 4ZT5A 4LF8B 1KI8A 4C0WA 1NI3A 1SD5A 1D6SA 4TTJA 3AHCA 1RVDA 3Q2IA 5I45A 2YNMA 1RWNA 4XJSA 2GO1A 4MQMA 2HYIC 5K6RA 3AUSA 4RLSA 4E5KA 3UW1A 3I05A 4AJOA 5JAHA 5JROA 3O73A 3BDAA 2Y68A 1GL9B 1GA1A 1PUXA 1T5LA 3WLKX 1GQQA 1L1FA 3GRRA 3FZYA 4F56A 2IZ6A 4CEIB 1HDCA 1TK9A 5C8YF 3PGA1 2A9FA 2P6NA 3SJ7A 4EJSA 3VYRB 1ZZGA 5AW1A 3FHJA 1DQYA 2HF7A 2P9YA 4IM7A 2I6FA 3LIPA 1B8VA 6LDHA 5CDYA 1CG6A 2RONA 4Z3OA 3HY3A 4JT9A 1GTSA 1KGSA 3GDWA 3NFYA 2GR8A 3H2KA 1I7PA 3OZGA 3RC2A 2VT6A 1PSZA 1ZNXA 2BGRA 4HBGA 4A0FA 5B7GA 1T0PA 2VHCA 1K98A 3K0SA 3PGLA 3N8HA 5LQSA 2DHEA 3E35A 5DSZA 1K7SN 1I9GA 3M34A 4M0PA 2PJUA 3A4NA 3SLGA 3OT5A 1XRLA 1CS0B 2KSQA 4TVOA 5JPCA 3R74A 2OD9A 2CXHA 3G7SA 3H9BA 3GJ3A 3JAKA 1Q91A 4G01B 1PL8A 1GKYA 1H9BA 1R4ZA 1NPTO 1WLYA 2X5JO 4M0CA 2D7DA 1J21A 1CQIA 2XHEA 3ANMA 5K3BA 3WLAA 1MPXA 4A8JC 4ZCTA 4ZYZA 4IWXA 4M1EA 4RD6A 4BNWA 1NBMD 1PR4A 3GHYA 3HCBA 1X94A 2CF5A 5TQ0B 3DWIA 4QTYA 1SWWA 4BB6A 2I65A 4JUBA 3I64A 4S1WA 4EW1A 4R6WA 1NF8A 3NALA 5ALKA 4KN8A 4MRMA 5FO1A 4CR6A 3HCAA 1YDHA 1AF4A 1EJ6A 4B81A 2EX0A 4OK5A 3A04A 3KWLA 2VZEA 5J2TF 1GKLA 4X6LA 4RK7A 2NV6A 2ZYSA 2X0JA 2BGIA 4C6TA 3CT4A 4QEKA 4AJHA 3UHOA 3THRA 2H57A 3AONB 3B85A 4DMRA 1XD8A 5LIPA 3QVSA 5AHKA 2A54A 5TVKA 5DNVA 1NJ6A 4DAOA 1U9YA 4FNGA 4CV3A 2A33A 4D3DA 5CDGA 1EDDA 2HJVA 4NYJQ 5FUXA 3ROXA 5TX7A 2ZRJA 3QHQA 4KQ9A 3EG9B 1YDMA 4O2BA 1JHUA 4CM5A 2SKDA 4CF4A 2GM3A 3LTEA 1MOPA 1JHQA 2HJWA 3PXCX 2VJPA 1RJDA 5JNWA 3BMOB 4G0WA 1INLA 1BROA 2CLEB 2OO5C 3H4MA 1Y9AA 4JHXA 3LC0A 5AHWA 2HNKA 4FHEA 1OU0A 1CV2A 2H4HA 4CQMA 1KI9A 4Y9UA 4MPDA 4AG3A 4LMRA 1BJTA 1EJ2A 2GUWA 2PMCA 4C5BA 1GTRA 5LA6B 4CEIA 3SYMA 3R23A 5HE9A 1THZA 1L5HA 5IBRA 1SBIA 1F4PA 2AWNA 2OY0A 3ZHZA 5LZ5A 3SKXA 4CBVA 2CWWA 3AF0A 1C2YA 2BZ1A 2FKNA 1PR5A 5IWAB 3D4PA 1GQRA 3JQ8B 4JLUA 4PZ0A 2V3VA 1UPTA 4Q9HA 1XDWA 1X1QA 3PNBA 4D8TA 1FJXA 3EX7C 2AXNA 2G71A 3R3SA 1FOEB 2O2SA 2BEVA 3L4SO 3K9GA 1KP9A 1YB4A 4HDNB 5MDHA 3O4HA 4R2MA 1OIVA 2R7LA 1L4GA 1U2GA 2O0LA 1VG9B 4GRIA 1CJUC 1CNMA 2O0HA 2WIJA 3DFZA 3EVCA 3LQ1A 4BTLA 1YR8A 3JVIA 2HF2A 1NQTA 2Q46A 2EGUA 5JCJA 4B71A 3IBGA 5J3JA 1OX6A 3GJ6A 1VKJA 4DR5B 2ID8A 4O4LB 4TT8A 2OT3B 3QU7A 4HVAA 3AK4A 3CKKA 2PKQO 5CFZA 2VDOB 4IMJB 3U6BA 2OFWA 4KUEA 4TTVA 2PY6A 1M0EA 5JQWA 1YZGA 1GFZA 1L4LA 2JHFA 4GD3Q 2J3IA 3N76A 3RUCA 3TLBA 2HMTA 4GWLA 2G0AA 2XCIA 2YWCA 4JBLA 2BN4A 4QPZA 2Y0CA 1PX2A 4B6JA 3LSTA 1AO0A 2HBRA 1SPXA 4KRFA 1N2BA 3GUYA 3PQFA 5F7ZA 3IDOA 3KQPA 3PGJA 1F2UA 2YZ7A 4QUKA 2FHSA 4B7AA 2B94A 3SVTA 1T6XA 3C3BA 3R0JA 5AM4A 3V9AA 3X1JA 4D4HA 3BFVA 3ECSA 2JJYA 2WHEA 4O2AF 1JWBB 1SG9A 3MCZA 4PBTA 5CHYA 5BR7A 5HZHA 3R24A 1O97D 5FNVF 2EJCA 5KSOA 2PUAA 2JAPA 2AD5A 2DQYA 1XQVA 3OD5A 1RWOA 3KLNA 4P3KA 5KTOA 3VMFA 1YR7A 1E8MA 2OCDA 3CKLA 1YVUA 1WNFA 1DSSG 1LDGA 1N5DA 1XRPA 4ZKEA 4IIEA 2ZI4A 2PT9A 1NQXA 1P9LA 5JXGA 1SRRA 3AZQA 4WOKA 1T9ZA 1ISPA 5AI0A 4ACBA 1U2GC 1DUSA 3ZE9A 4KODA 3K8QA 2QMUA 2Q1XA 2MDTA 1ZD3A 2ISCA 3RANA 1RADA 2ZIAA 3C8ZA 4OL0A 2FQQA 4GQAA 2P68A 3ILVA 3CJQA 1EKXA 3GA7A 2FMUA 3AXTA 3T0GA 3VKFA 3CZ9A 3HV0A 1J0EA 1FTYA 2W2OA 3KD3A 1F0YA 4LCBA 4ASUA 5K0LA 2Y1GA 1CZUA 4TLMB 4K9KA 1EX1A 4U8HA 3ZVKA 1X38A 1N3BA 2DR2A 1N0HA 2YHIA 1GSHA 4PSVA 3CH6A 1ACMA 3UG7A 1J07A 4ABTA 2NVUA 2WABA 4B34A 3TFWA 3SQDA 4C29A 3MGCA 4QEZA 4IHAA 5BR1A 2B2CA 3LBHA 1UQUA 1Q0UA 1R27A 4IMRA 2R6ZA 1NBOA 3LHFA 1OXBB 1CUUA 1F2UB 1T35A 1TCCA 4YXWA 4MV3A 2XZLA 3IEMA 4JOSA 2VVTA 3E7PA 4XGKA 1N2JA 3QVMA 2E4VA 2OAEA 5B37A 3WDKA 4ZYVA 2YIDA 1QONA 1RWMA 1WDMA 4NHOA 3ICOA 5F7XA 2L19A 1GTG1 5KYWA 3WX0A 3FJOA 2XB2A 2YQZA 1CZHA 3CT6A 1XCBA 3LL4A 3B7PA 3TK1A 3TCKA 4RK4A 5IVKA 3V4FA 5JU6A 5AVKA 2R6R1 2VXCA 1YQUA 1VXOA 3MF4A 1Y8QA 4PV7A 4YC7A 1O6GA 4UXJA 4DVJA 2GOYA 4FCVA 3Q5EA 4YRGA 3P8ZA 2CLDX 2QVZX 2I4TA 5D87A 4KKVA 3T9DA 4KE7A 2QD1A 4CQMD 3PQDA 5BSFA 1WXQA 2MWMA 3O95A 3HHPA 2BW0A 4MV9A 1JI0A 4TLAA 1O9BA 4WH0A 2FEKA 5A4JA 4L28A 5L8VA 1KJ8A 1XJ5A 1ZSNA 3FBTA 5GQSA 3GP8A 3CU5A 1RXYA 2GHRA 1F60A 2BWJA 4JLJA 4K81B 2H07A 4YAOA 3RNOA 5K6TA 2V6FA 5EIWA 4GS5A 4YA6A 1JNXX 1MU0A 2XE8A 4XJVA 4F4FA 4PG5A 5HA5A 4JXZA 4UVIA 1V9CA 3GEMA 1NKSA 3D6FA 4ZAZA 4BB9A 5ICMA 2O48X 2NPIA 2MIIA 3I9MA 4L3OA 3LW8A 4TYQA 3KEQA 4IDNA 2HRQA 1Y3CE 2OCXA 2ODQA 4AM8A 2G1PA 3UPDA 3JY6A 1DLIA 4Q5IA 2IE8A 5A03A 4IVQA 4MYSA 4YX9A 3MWDB 3B60A 1YB6A 2JDID 5TVGA 1WNTA 4QJ4A 5DLQC 3WIVA 1IRXA 4O8ZA 2WFAA 2X0FA 4ESVA 1HQKA 3KQQA 3GLSA 3B9RA 4EENA 3N2IA 1JALA 2QD4A 3LDUA 3EVGA 1NP7A 1VRCA 3GQVA 4BFUA 3D1JA 2YS6A 3LNCA 4QZVA 2R5WA 4ZQIA 1QVAA 4YWJA 1R9MA 5GADl 3PPWA 1CVRA 3F3MA 5GVRA 2V7GA 2ZW9A 3C6QA 3OEYA 1IRIA 5ADHA 1DG3A 1NJGA 1JU4A 3NTXA 2OCYC 3MMSA 4J9UE 1N2CB 1DC3A 3OM0A 3R3JA 3AVWA 1TZKA 1G1AA 2G1AA 3WLIA 5CB4A 3ZY2A 3WRWA 1Q83A 1MJHA 1AV7A 4HRAA 4KBGA 4QTTB 3ZUGA 3FTEA 4G0YA 3ZQUA 4I50B 3G8AA 1MEOA 5HJ5A 3UWKA 4HRXA 4BCDA 2VSYA 4D82A 2WF6A 3LXXA 1LNQA 4H31A 1PFWA 1NUAA 4FHGA 4QDOA 3GVXA 4R1OA 1JT2A 3IPCA 2E6UX 4KQHA 1OA0A 4NMLA 3W8EA 3HXPA 1JB9A 2AUNA 1E92A 3I8SA 3WGYA 3RPEA 3HKDB 5KYWB 4ESEA 3R2JA 1SVWA 2YY6A 4UD2A 4NCHA 4UU1A 5FBQB 4NARA 3FSRA 3ZJ5A 3CVUA 3HLKA 1QVRA 3I73A 3KWMA 1ZO8A 3NEPX 3QE0A 1XWWA 4MW2A 1VPDA 4Y67A 1C0IA 2VUSA 3GFRA 1PAUA 5BVGA 1CUVA 4ER5A 3UGKA 1GITA 3C5WP 4O25A 4KJZA 1JIXA 1WS6A 2E87A 2LP4Y 2X58A 2ASVA 1XMXA 1XL1A 2R6CA 2I7CA 2VT3A 2EHDA 3AETA 3KUCA 3EODA 3TLJA 3CZ4A 4UDNA 4YGYA 1ZK0A 4OB8A 5AI9A 5ALRA 2Q4BA 4IKEA 2QQGA 1M8GA 1PJ4A 1ABEA 3I2YX 3RJMA 3T5DA 2BONA 2OP1A 4OF4A 3N2YA 1MC8A 2O0MA 2OK8A 4QDTA 4EI7A 3COWA 1N5IA 3M4XA 5EMLA 2BEWB 2A5LA 4LZNA 5CDSA 2UYQA 2GJ9A 1NXQA 3CISA 3W5JA 2OFXA 5IF9A 2CUKA 2AFIA 3BH0A 4KE9A 5FR2A 5CVEA 3ROGA 2Q1SA 3K0AA 2NO7A 1XZKA 2VT2A 1ES9A 1IN6A 1ECPA 2P2CA 1NE2A 3E9DA 3EASA 4U3JB 2YYZA 5FFFA 2BTOA 1XP5A 4XWKA 1LRLA 5I7UA 2FDCA 2QM3A 5BO5A 5IXYA 5C1OA 4F96A 3BXFA 5C7YA 2BUCA 2VCHA 3VZCA 4WASA 4B7ZA 1QIIA 4Z3DA 5L53A 1TFRA 1PDOA 4I9NA 2BHTA 2Z2KA 3CJTA 1EBFA 5TMPA 1PRYA 1EP1B 2DWOA 3TRIA 3HKDA 2YUIA 3DMRA 5GGYA 5TJHA 1RPJA 5JS6A 2Z98A 3OETA 4NG5A 2OD2A 3I4FA 1XGKA 4BLRA 5C52B 3FCCA 1Z4OA 1UT6A 3K9FC 1LVHA 3ONVA 2QD3A 4ZQFA 3NTVA 2G88A 1D2EA 5CG1A 4FSDA 1MXHA 3U7QA 2P1ZA 2NO6A 2V45A 4Z2AA 5HQTA 1NUSA 2ZBQA 5JO0A 3A4TA 5DVZA 3VBCA 1EIWA 2XE7A 1OI7A 1P4AA 2F8MA 2I7TA 2NM0A 2XECA 2F3TA 3RF7A 2IYEA 1DV2A 4F7DA 1CD5A 4YUXA 1J25A 1T9HA 3AJDA 4CL2A 2UUBB 1F20A 3I8OA 5TQVA 5KQGA 3F6BX 5K0JA 4H1UA 3UB2A 2HSEA 5T57A 1RMQA 3ST7A 4ETNA 5BV7A 1RTKA 3CURA 1MX3A 1UBRS 2FN4A 2D54A 2XQJA 3MAJA 4UM8B 4D6YA 3N6XA 4P35A 1J8FA 4D02A 5CA1B 1MT3A 3FI9A 4IFEA 2EFYA 3PVZA 4LHZA 3IOBA 1IPFA 3FNGA 2O8CB 3D8SA 3OM1A 2I1WA 2C2BA 2HWKA 4D26A 4DDTA 3A6HA 3TKAA 4S12A 5CH5A 3TNFA 2B9EA 4NOMA 4K2HA 4XIGS 1WPRA 1UFVA 2FPIA 2UZAA 3JRWA 1EFAA 2YFQA 1ILEA 3GEDA 1F1BA 2B61A 1XG5A 4P98A 4E4YA 3ESXA 1SFRA 3HKBB 1EX6A 1NDHA 1PZEA 2WJPA 1USUA 3DPIA 3FHLA 2W2QA 4FHFA 2OGSA 5HIKA 5I3ZA 1QWSA 2RAVA 3ISVA 3RLIA 3ESYA 1U8TA 2JFGA 4LW8A 4JCOA 1QCYA 2BEWA 4DRXB 1GPDG 2A8YA 2SKCA 4AJ4A 4FS3A 1Y8CA 4J0IA 4E07A 3OCVA 4O0MA 1HFWA 3G0DA 2XVAA 3TUZC 2JARA 5CA1A 2AZXA 3O8LA 1PWEA 4ZTBA 3HTXA 3SKVA 1BHO1 3ZZ0A 3VKUA 3FOWA 4H77A 2HU5A 3UJ8A 2YCBA 3K1YA 3RG2A 1A5TA 1N25A 4DIOA 1QO0D 4N47A 3T61A 1YRAA 3IQZA 3KLPX 4RVNA 2AHOA 2IYXA 4TSKA 1DAFA 3AWDA 4ZQCB 3B6KA 5DTEA 4L4YA 4KUHA 5JMPA 3ACCA 1JJFA 1VYVA 3H7AA 4GF5A 3DUFB 1AGPA 4MS4A 3WYFA 3CPEA 2QTVA 3PWKA 3F7NA 4IL5A 3WO0A 5HF5A 4DT1A 4JYAB 5H83A 3AKEA 4EPWA 2VNAA 2AZDA 2VUTA 1YBFA 4FNOA 3PDJA 3H04A 4FQ8A 4IHQA 4QOJA 2VA9A 3DLCA 2CXXA 2W2KA 1UINA 3E2IA 4DLRA 1NG9A 4CDMA 1EEHA 2CLHB 1E2BA 1FFXA 4CW7A 3ODGA 3QVGB 5LQDA 3N2GB 3QBEA 5KYVA 3AEXA 4KQCA 4U9HS 3R7BA 2KWIA 1IFXA 1XMOB 4HLUC 4PN3A 4C0SA 3ZU5A 1PE0A 3VYVA 4HLCA 3OIFA 1XNJA 3P2IA 3ZTTA 4QOIA 3B6IA 4UHKA 3T5MA 2ON6A 4QQNA 4UPVA 3V9PA 3MD9A 1G5IA 3L40A 4IEIA 4MPJA 1L7EA 4IDGA 1XTUA 3MOGA 4JB3A 1CB0A 1QRDA 3FM9A 4XPIB 4BFYA 2GPAA 3HCRA 3LYLA 4WEQA 4E14A 4EUEA 1YI1A 3OQ6A 3OFNA 1A71A 2OBNA 4EMTA 5IHPA 3PYMA 3DZKA 1DHTA 3KSMA 2WLTA 3AR2A 4BX9A 5TPWA 4C05A 1WZEA 5HS6A 3ROKA 3EDOA 2ZZKA 1VMEA 1UDRA 4I1UA 4PSUA 2FFAA 1SC9A 4X54A 3QV2A 5IBPA 3T1OA 5CFRA 5KZMB 2NUAA 2R96A 2OBLA 4QBKA 4E33A 3K7EA 4KVAA 2ISQA 3EZ6A 3TH5A 3MELA 2BFPA 1N6OA 4BMDA 1GZ6A 3LE8A 1MX9A 3UQZA 4G9EA 4L8GA 4UAJA 4HV4A 3GIDA 3WMGA 2G5ZA 3WQRA 3L6OO 1KVUA 4X64B 3BSYA 5F4ZA 4FMPA 4KR3A 2P77A 2ZTSA 4EVIA 3WGTA 3VJRA 2VZLA 1Y98A 3KDPA 4TVKA 1Y5IA 3GGJA 2X1MA 4KXWA 1Z28A 5KDLA 4F6CA 2XD9A 2X76A 4YCJA 3L06A 3S81A 3ITNA 1K97A 5J4HA 5EGSA 3NVMB 3ZDQA 1CY2A 1ESZA 1F9AA 1MZVA 1T3LA 1Z56C 4KQIA 1QR2A 3T5TA 1G6HA 1BEEA 1UPAA 4GM0A 4M0KA 2OYSA 1H4QA 2B4TO 4US0R 4B9EA 3JD3A 1PU2A 1CQWA 2G9ZA 2VDNB 4BGVA 3W6NA 3FR8A 3O5AA 3UC5A 4DR1B 2G36A 4GOJA 4QOHA 2B4KA 1YZFA 3CNLA 3OX4A 4QXRA 3TW0A 4JVOA 4LOHA 1LW6E 3HUDA 2F8SA 3JAKB 1N6LA 3EZNA 2VWQA 4JJKA 2B9VA 1OV6A 3QNMA 5DEOA 1LLUA 1SXHA 1XRQA 1SCUB 4ZMRA 4QJ3A 3BE5A 2R47A 1KAEA 1I2DA 2NXCA 3MJTA 4XSGA 3U7FB 3MAAC 3Q8MA 5EIBD 2RKBA 3P71T 2HRZA 2IEZA 1ITZA 2WMOB 4ZVNA 3AGPA 5EXPA 2J07A 4Z4QA 2BBWA 2YQ5A 4RA9A 1P7CA 4XEUA 3KL2A 2HQ1A 3IEVA 1YJXA 3P9NA 4TMFA 4M36A 1GSIA 2KX7A 2VRWA 2A56A 5CHEA 4OV6B 5A3VA 4Z4HA 3PZRA 2YXEA 4PRLA 3SM9A 4X8OA 4XYMA 4AZ3A 4IOKA 4TZ0A 3GFPA 3E15A 1WHSA 4PO9A 4EA7A 3ZVRA 4KE6A 4UUBA 5KCZA 1G20A 1DDOA 1DADA 1JI3A 1DXQA 4TRRA 1UZAA 1VRVA 1YJ5A 1EJBA 2XPCA 3ELYA 1KQ3A 5AVUA 4BAUA 1WD5A 2RHMA 3HADA 4RF5A 1JV2B 1K8YB 4DLXA 3GMTA 1RM5A 2Q41A 3ZHXA 1NYRA 2JLUA 3MJCA 4FLMA 2O2ZA 4K9SA 5FOUA 3Q85A 1JZSA 3GAMA 2X7HA 4TRNA 5I4CA 2HRRA 1ANKA 1ZP6A 1GZ4A 1XV5A 3H5TA 3FWZA 1IY2A 2F48A 5E8RA 5T3YA 2BAGA 5KNBD 4EDFA 1QB8A 2OFPA 1RWXA 4JB0A 5LQJA 3W05A 1U3UA 2R8ZA 3E4CA 4XQ0A 5B6PA 4BWYA 4A36A 1Z68A 2XMPA 1T0IA 4OO3A 1CY0A 1CY7A 1ZGHA 5JTUA 3PX7A 3F73A 1PR2A 5J5VA 5GV7A 4WZAE 1RRFA 3B51X 1B93A 5KS2A 1KWGA 2CLKB 3BTUA 3H8JA 5ULLA 2ZJBA 5EKUA 1M7HA 4KV9A 1VQ1A 1HMYA 3QV1A 4UVHA 3PI6A 3OZWA 1CWUA 2PD4A 2DJIA 2X9VA 2A53A 1Y5NA 2I8CA 4UCWA 3T7CA 4EJ0A 4MVJG 5C2JB 3MXTA 2BEVB 1RW4A 2PSFA 3P5BA 2C82A 3QA9A 2VP3A 4TTSA 4EAAA 3GFVA 2FUEA 3BEDA 3QVWA 2ZBDA 3DKRA 2OO5A 5GP1A 2FW9A 1PEDA 1YQGA 2CGEA 2G1KA 2YVLA 3BFKA 4ZRNA 1ICIA 3QENA 2BM9A 5TS3A 1RLMA 1HXHA 1VKRA 3NTLA 1XTTA 5C1BA 1ZR2A 5G3YA 1GADO 4YP7A 3ZDRA 5FLYA 2N1BA 1SCUA 1YB2A 3KOXA 5FORA 4W9NC 3ZXIA 2E4ZA 4EG4A 4FWTA 2PPVA 2GZHA 2N46A 3FSGD 2GGSA 3HYCA 4PGMA 1A8HA 1Q57A 2C54A 7ABPA 4NE2A 2F9LA 4EABA 3CV3A 2HCTA 2N42A 3FUVA 5ES4B 4DJAA 2JI7A 4HNTA 2Q2OA 1O9GA 1QCCA 4GPTA 4EYGA 1C80A 1IZ9A 3HVUA 4N6NA 2CSUA 1XHEA 2OL4A 2P3LA 3MS7A 4EGQA 5A06A 5EERA 3L7JA 5LDGA 2NGRA 3DBHA 4UU8A 4BX2A 4URXR 1IYZA 3A28A 4NV3A 4W8OA 5DHAA 4YI3A 3FTQA 3JQ7B 3ZI7A 1QAMA 1XTPA 4E1VA 1JHRA 3AZOA 3EQZA 3MJHA 4TUYB 4RVGA 5FL3A 3EDQA 3H75A 3GFTA 3GMSA 2NSLA 3E7FA 2ZIZA 4XWWA 2QTTA 3RQIA 3O8RA 3U3ZA 1F51E 1UC8A 4IX1A 2A1IA 1MJ5A 3CF2A 4I7EA 4X44A 2HO5A 4HN9A 3NNDA 4MYUA 4PPFA 4CLOB 5A3JA 5JWOA 3VNVA 2GBPA 2P3OA 3GA5A 2D1RA 2P9JA 1XTIA 1ZY2A 3P7MA 3TTUA 5IU6A 5ELXA 1YTUA 4P82A 4BMPB 4JU8A 1JU3A 2GPSA 1N5KA 3F6CA 1K68A 4FX5A 5JVDB 3TSWA 3UAYA 5CIQA 4R1UA 5JALA 1TAHA 4YR7A 5A4FS 4Y2SA 4M1QA 1M10A 1FDIA 1G3MA 1JPUA 3L7KA 2H5IA 5BPHA 2X2EA 4LC1A 3KOOA 4YJ2A 1N1DA 1T5DX 4Z1MA 1Z8FA 3ADPA 2Z0MA 1VKNA 4EQ6A 3H1BA 1RIFA 4GOLD 4J1TA 3ETGA 1MIHA 1DKPA 3BJZA 3WLPA 3K5PA 2DBYA 2W2LD 1DCKA 1W36C 2JVJA 4EEZA 1G4HA 3G9TA 4YFVA 3N8DA 4ZALA 4A10A 1HT1E 4N76A 1NG1A 2ZITA 2OG1A 2QU7A 3P2EA 1EK0A 1ZHFA 5DYIA 3WYBA 4IDBA 2BSAA 3U3OA 1C7ZA 1JVSA 3BMQA 1JPJA 4TUYA 3WV4A 2ANBA 2PH5A 1M0TA 2ZRCA 3DHWC 3EY9A 4FGSA 2PMEA 3IXMA 3FUWA 2C1XA 1ZHOA 2E4WA 1RTTA 3PL1A 2Q5LA 4LRWA 1E7RA 1IWBB 1V8FA 1OGJA 1Q92A 2Q5FA 2YOFA 2YW2A 1CF9A 3AVOA 3DFFA 4FW9A 4X7PA 4I55B 4OFWA 3W5HA 1A8SA 2MYPA 4UQOA 1K6JA 4GP7A 4RULA 1J8MF 5B36A 1PGPA 2M6RA 2NZWA 3TM5A 2XMCA 4OHOA 3Q72A 1OT5A 3SD7A 1V8OA 1X7ZB 3B2NA 5CX4A 4HQ0A 4LJKA 3GROA 4OGFA 1Y3HA 1ZCZA 3GRCA 4XM2A 3KKMA 3GFFA 4XQGA 1N2HA 1EVEA 3DFUA 4G1BA 4X1YA 3MCWA 3FXAA 1XEAA 2ECKA 3Q3HA 4CMHA 1YUNA 4EMBA 4DCJA 3DBHB 2HBYA 1DLJA 3I1JA 1ZQ9A 3FVWA 3SG0A 1K8QA 1QX3A 1E0JA 1NI4B 5ITZB 3DE0X 5LKAA 2C4TA 4OB7A 2CT8A 2JIPA 2AE2A 4JUCA 1Z5WA 5T4FA 5FULA 1KI6B 1VCOA 1SXJA 4JDUA 2F55A 2AJTA 4G9BA 4RGBA 1QG2A 1JDTA 3IESA 4U9IS 1Q0TA 4X20B 2ZS8A 1JSRA 3IPAA 4LOJA 4HO1X 4X8LA 3HBFA 4JLMA 4N3NA 2B8JA 4DSZA 2AF3C 3VR4D 1RQNA 2YJ6A 4HDRA 1YMUA 4ER7A 4ZIRB 2VUHB 1KRWA 1LSOA 1K63A 1DJQA 1GT91 1F6WA 4LZLA 5DU2A 4OHYA 3OMWA 3DS8A 2O50A 2FSFA 2JCSA 1DRUA 1KK0A 2PRSA 5TIIA 1V11B 3GN1A 4I81A 4PQEA 2E5LB 3L8EA 4I8XA 4N54A 4C7BA 2VJKA 3SE7A 4DY6A 2IY9A 3I3OA 4I4TA 2Q4DA 1RM4A 3VAZA 4C22A 3RUAA 1SD2A 1NPDA 2LGJA 3E5RA 4TRJA 3C1TA 4HJXA 4TXJA 5EIAA 4AS2A 1L8QA 5CXXA 3PD7A 4JUFA 4M37A 2ZTUA 4U9UA 1EVKA 1TJNA 4CMJA 4FOTA 4ZVSA 3EB9A 4OMUA 3ENVA 2IUTA 2GYVA 3WGVA 1D1SA 2OGUA 3JRNA 4M87A 1T6ZA 3WWOA 1DQRA 4V3CA 1FRQA 3H3FA 3W06A 1M5TA 5J2TA 4BEJA 2CJYA 3TLAA 2Q50A 3IB3A 2IYQA 4N7RA 1BVUA 1KMQA 1GARA 2IF2A 3WBBA 3AV3A 4C0HA 3NEYA 1Z9BA 3HWRA 3O4FA 1R8YA 2GPJA 1H0HA 3PVCA 4FINA 4QX6A 4B32A 2D5CA 3H2BA 4RCYA 4M6WB 3T7DA 5BNWA 1QFJA 3HYTA 3ZHTA 4DV7B 2RI6A 4O4IF 3CONA 1VZ3A 5BNZA 2INGX 2QN7A 3QX9A 3IE2A 4M9RA 1ZA2A 1AGXA 3NHMA 3DAHA 1RYEA 4EI8A 1LKZA 4EM6A 1FW8A 1EM6A 1YB7A 5C53B 3K15A 2NW6A 1X39A 3G6KA 4JI6B 2FJUA 4L74A 2CV2A 4RXUA 3OJ0A 3UJNA 3MINA 4P5DA 3GL9A 2QXYA 3D7KA 2FU5C 4HFMA 2IP4A 3HFGA 4S1TA 3A3PA 2RC6A 1N9GB 5CCEA 2AYZA 3O3NB 2WJGA 5BR4A 2DHDA 2JZNA 2YNMC 3B5IA 5G02A 3UMJA 1Z36A 4J7CA 2GBCA 3TD2A 1REQB 1DT5A 1XEXA 1U0GA 2K87A 1XDDA 4EHFA 3I12A 1E2PA 5EEGA 4AP9A 5TT1A 2RG7A 4O8CA 4JJZA 1OFGA 2XMBA 3B1YA 3JSAA 3GBVA 2JH9A 2O07A 3TSAA 2XNDA 1T36B 3LPNA 5ECGC 1FFCA 1PJLA 3QXSA 3J7TA 2OUIA 2R7MA 2X8LA 5AJUA 3RRYA 3GVHA 2W5UA 3MJFA 4HTAA 4MYTA 3RBXA 1TM5E 4JR1A 3WGLA 3LGAA 3L46A 4OHMA 3GUCA 3RSLA 3IKLA 4W5TA 1VLVA 1XVTA 1Z16A 2FLWA 4FR2A 3MC1A 2G5CA 4JDPA 3S1AB 3SC2A 5F2OA 2C5FA 5F51A 3BB1A 1J0CA 1E4VA 1O0BA 3SOPA 1SZCA 1XZEA 3BF8A 2VHZA 3X2SA 1HQCA 4JYZA 3RC3A 1HT0A 3SXUB 1A4IA 1ZN2A 3BPSA 1L5VA 1NR7A 5FI0B 1P4RA 1GG8A 3LBAA 2QGNA 3B1FA 4RKWA 4XUEA 3CKYA 1BQEA 3RRFA 1E3TA 5LDDC 1K6MA 3KYDA 1C50A 2W2MA 2RHJA 4E5DA 4UFNA 1T9CA 2AOXA 3FB1A 3OIYA 4OXRA 1L4MA 2VATA 3RS3A 3TVYA 1G8AA 4LHYA 1H2FA 4EBFA 4PTLA 2IY7A 3Q88A 2D2IA 2H7CA 3ZC3A 2JK0A 4DUPA 1E5QA 4A15A 4COKA 5KB3A 1P2UA 1BG6A 5JMTA 3H0KA 5JRZA 3PHJA 2CV1A 2QVLA 1Y4AE 3ESZA 1VIVA 1YQQA 2DKFA 3AEKB 1GG2A 1Y48E 5PNTA 3T7AA 4BO4A 4DWWA 1KIMA 1PJRA 1E3IA 3KNZA 4KMSA 1OWNA 5CFNA 1YVRA 4MRRA 4TQUS 3M6AA 2XCRB 4RA6B 3WK4A 3FYDA 2G76A 3NETA 2VQEB 2DPMA 1GV0A 4XCXA 4UUOA 1MZPA 1NONA 3WJ2A 3H2IA 1DC4A 1XXLA 3HEBA 1KSJA 4OJQA 4YO8A 3GY0A 2M1XA 3HMQA 2FXVA 2KBFA 3PQ2A 4EG8A 4YS6A 5I9NA 3P9QA 2DHQA 2XXJA 4R0VA 5EWLB 3KZNA 3BL8A 4K6FA 1OIWA 2GPBA 3N70A 5G53C 1R6DA 2I6XA 1T1IA 5EJFA 2GLTA 2IUFA 4L5IA 1Q3HA 5IK2D 2C8JA 6YASA 3V2UA 1XAGA 2AI1A 4ER0A 2P3QA 3HZZA 4F3RA 5LZ9A 3H6GA 2JJ2A 2VPIA 1JHAA 2HRCA 4X7MA 2A88A 5IXJA 1C9EA 2Q9BA 1D0IA 4R9UC 1AS3A 3K32A 1EZ1A 4DBLC 3ICWA 4MS1B 4IGFA 4EGAA 5FTLA 2ZZNA 1BMFA 1XF1A 4RGQA 4G0NA 3MQ4A 3FTDA 4PPYA 3CTMA 4QU8A 4B83A 1Y1PA 2MSWA 5BQXA 1WO8A 1Z7YA 5EPUA 1YGYA 2GS9A 1P1CA 4QUGA 1W2GA 4JVLA 1Q12A 4FUQA 4JJAA 5AQ1A 2JC3A 1N2EA 4XASA 3A2KA 4KSBA 3D8BA 3LPAA 4YRSA 1D6JA 2GD2A 2K5UA 2FSPA 2TS1A 4LX0A 5FOXA 3V4RA 1IIBA 3U3MA 2O23A 4PHCA 4B46A 1LX7A 1HT3A 1USVA 2GAIA 1SVIA 3ANYB 2FMFA 3L7DA 4FT4A 3ONNA 3C5EA 1KPHA 1J2YA 2WTMA 4RIEA 5DTQA 1Q7GA 2H2WA 5FXMA 4R68A 2AJDA 4I1IA 4C5AA 4JJ4A 5AW4A 3F5DA 3LAWA 1SUSA 2NQ2C 4W8HA 4PS0A 4G5YA 1G6OA 1E9AA 2I4MA 4PYIA 1TEZA 3QUBA 4MV5A 5G3ZA 3VGJA 4PLGA 1PLKA 2UDPA 3N8KA 1WU8A 4FB4A 5KKNB 1QQBA 3G8CA 5FUQA 1K4YA 5CT9A 1I4DD 3PR2B 4HG2A 2YXDA 3G1WA 3PFWO 2O8DB 4QRHA 4KVGA 3DULA 5ICEA 1PZXA 1ZM4A 2WAXA 3N28A 3VGPA 5JAOA 3TI9A 2AW5A 1FXUA 1P6QA 2CL7X 3BGWA 4L3WA 4ZZ2A 3IP5A 4B3DA 2ZIXB 5GJCA 3EIXA 2PMFA 3K9WA 2FSUA 1LS6A 4MJLA 5FBRB 3RYHB 3OJOA 4D3ZA 5LD2C 1UBMS 2WDPA 3ROMA 4H7IA 1YS6A 3UC9A 2KBEA 2OGTA 4FCWA 4ARUA 3G0CA 3THWA 2JGMA 3WKAA 1Q0RA 4G36A 3VU0A 3TRKA 1M2OA 1P4SA 4JP5A 1U5BA 1BWPA 3I0ZA 1MC1A 2PVSA 2VPZA 2ZAMA 1JXQA 2X40A 3LK7A 3RVNA 2PU7A 5DE3A 3ENZA 2NU8B 3TJRA 1XZAA 4Y1EA 1OB2A 1XBTA 3FNBA 3OM8A 4Q3KA 5E3HA 4MCAA 4DCOA 1F5NA 1IXSB 3QH4A 4CGZA 3AF2A 2HWWA 3CG4A 2ADFA 1A4RA 1XF9A 1CHNA 3GD5A 1SH7A 1NVBA 1DP4A 4RETA 1F38A 1QTNA 2ATVA 3PPIA 1P19A 5LP6C 3G82C 4K28A 4OQDA 3WGMA 2JEOA 2PX6A 2R7NA 4BVAA 2MMGA 1J5EB 3GJZA 2MSCB 1G8MA 1J7KA 5B5SA 4EUNA 4MI9A 4PR3A 4ZC1A 1M5UA 1Z6AA 3S4YA 1G8FA 1YTLA 3QMVA 1OUMA 3UKOA 5C51B 3WS7A 2CFTA 2G5GX 3K4HA 1HNZB 3N5CA 5TQ0A 1K3TA 3K0EA 3L01A 4YAJA 5J5CA 3SX4A 4NCXA 1NW6A 2EBFX 5IT4A 1O9HA 3FPKA 1XNGA 5LYJA 1JFVA 3T9CA 1FXWA 3VR0A 3MWLA 1E2DA 3VZBA 2BFEB 4IHJF 4IIGA 4YMGA 5AXAA 1IDN1 1PZFA 3DBVO 4KQFA 4QXAA 2QYSA 3WGNA 3SBOA 1FSSA 1P4HA 2CHQA 4HXEB 4QDZA 4RACA 4U0KA 3VU9A 3W6UA 3R09A 5EP4A 1UC4B 4Z4CA 1QRUA 3IMCA 3UJCA 4GNRA 1W1WA 3BIWA 4PAGA 1J2EA 2Z9CA 3GLRA 4RQTA 4UMFA 5I8PA 5JSFA 1GFSA 1D4AA 1U2QA 1ZL2A 1NBHA 1BXRB 4H6VA 4JEIA 1D3AA 2OXEA 3BE8A 3L49A 4ZVUA 5JNLA 1NXVA 1OJ7A 1ZD4A 3QITA 3I30X 1RXCA 1EBBA 2PM8A 5DXFA 3QBTA 2IU4A 2VSOA 4MA5A 5BW8A 5CVTA 3ANLA 5CVJA 5LQNA 1SD1A 3AP3A 5LU8A 5LA6A 1GRCA 1OZGA 2OZKA 3HKEA 4LBVA 4O3MA 1S3FA 4YP1A 2IPMA 3H8VA 4KQEA 3DLHA 2R85A 1Q21A 2IKSA 1Q7BA 2ZB2A 2QQ5A 3HFSA 5LNK1 2C2OA 3L6RA 1CJMA 3U44B 2Y1WA 3BHJA 4M1YA 1V1JA 4RV4A 2V4MA 2AJCA 2A30A 4ZKDA 4KYUA 1QOZA 1V8PA 1T43A 3IVXA 4UHFA 3Q3IA 1OIXA 2KLBA 4FGKA 3AUUA 3EVEA 3TL2A 4D99A 1TCBA 4Y2UA 3VXKA 2OSVA 3ZU4A 4F06A 3QOXA 1QPGA 4PRZA 1GV1A 1OXUA 3I72A 1NYTA 2YV1A 3OZDA 2VQSA 3F6PA 2WUWE 3A4MA 5FLXA 3GLHB 2AC7A 3OE7D 4OM7A 2PLNA 4JT8A 3KQNA 3RFFA 1Y7LA 1LVUA 2KLHA 1E9FA 2CBZA 2PX8A 1E3WB 4F12A 4OK3A 2VPQA 3H05A 5AIBA 3IXLA 4YCNA 1Q7RA 2IEYA 3IR5A 2C58A 4OBWA 3SQMA 2JJ1A 4ENPA 1M75A 5JZVA 2CVHA 4FP9A 2O8EA 1D0SA 3EXHC 3I4CA 3F5QA 3HPRA 2V65A 2CEKA 1HDZA 4R1SA 3GWZA 4UCFA 1DEHA 421PA 5C8YB 2E0IA 3ADOA 3NH9A 3PFIA 3ROTA 1UZUA 3Q1KA 4J4BA 1ZH2A 2OCIA 1A7AA 1JIVA 3R7DA 1N92A 4AJEA 5JDIA 1KMCA 2B36A 3R8CA 1FUUA 1JYFA 3KUXA 3B3AA 1JR4A 2F43B 3Q9NA 3WMFA 4JLDA 1X70A 2QS9A 4UQPA 1U2DA 1AQJA 1TE2A 1ZDMA 3CRW1 3P2OA 5HKKA 1M34A 3D6AA 3L6UA 1UMCA 5K3FA 2VPPA 3BAZA 1T3GA 5KKAA 4E0BA 5LIRA 1QZTA 1JNYA 4DREA 1I7LA 4RL4A 3NDBB 1WKCA 3R76A 5T3UA 2DT8A 3AHDA 3Q7QA 1LQTA 1NATA 1UBTS 3LHDA 3K3PA 3V32A 2JBHA 3NQ41 1L4UA 4JLKA 2XKJE 1IQRA 3NOVA 3VNQA 4AG6A 1M6WA 4ZO7A 1BU8A 4RDXA 1AN0A 1NQ5A 5BXYA 1MC5A 2I6UA 4Z4GA 2DKOA 2AA3A 2EYQA 1NKTA 1YB5A 4MK4A 2IYSA 3D59A 2AIRA 4C03A 5KYTA 4CMIA 3GPCA 4R8MA 3VR6D 4W9MC 1HFKA 2I6GA 2OD7A 3D0RA 4ND1A 1YRBA 5EPEA 4ZDIA 3GH1A 1D09A 2ZANA 2BISA 3NO4A 3C3XA 3R9IA 3U2QA 3PNMA 1Z29A 3CRVA 1IJKA 1U8YA 1Y7PA 2IK8A 3M9WA 3OLYA 4CI0B 4Z4FA 4LXHA 2WHPA 5DM4A 2HIAA 2PGJA 1RFLA 4FXOA 1U9IA 3DB2A 1CVLA 4HEJA 1RBYA 3KUDA 4LFBB 1KYVA 4V0QA 3PJGA 3PF8A 1QZZA 1T2UA 4F4HA 1YRHA 4PN7A 2EG9A 1O2DA 3PEUA 3QLUA 3RBZA 3OWXA 4OCZA 3TR5A 5BSEA 3H11A 1LNZA 3HUEA 3MMNA 3INGA 2OECA 1JG1A 2EFHB 2R65A 3DVSX 4IP0A 1TZJA 3H86A 1T0JB 1PQYA 2YJZA 1U9JA 2FEWB 3Q7IA 2N1MA 4OHKA 2CFOA 5B64A 4TKUA 2IUUA 4GGMX 1RAAA 1BNCA 1DT3A 1UMCB 3EEQA 2ISSD 4N03A 4QREA 1X42A 2JGIA 1IONA 2I5PO 2WF7A 1I10A 1I7NA 1XZ8A 3H97A 4EW6A 5IZCA 3KU4A 4F91B 3R41A 5HS4A 1ZMTA 4I4IA 4YJDA 5D3MA 3TLMA 5LUAA 1U7HA 1TL7C 2FPGB 4OQ4A 2JIZD 2UVPB 3MFYA 2QIPA 3MJRA 4AY6A 4CQLA 5AKIA 4GZLA 1IL0A 2R6FA 2YYYA 1YJBA 2EARA 1MJNA 1GNLA 2IPOA 3I2HA 4LXXA 1FSPA 3CQ9A 1UQTA 3QWBA 4PLTA 5IKOA 5C8YA 3O2NA 1JG2A 1L3IA 2LMEA 1PK9A 1HOXA 1SOWA 2VF7A 3GGCA 1ILWA 3HNRA 3N0TA 2VYNA 1JHMA 3W4JA 4WJZA 3FLAA 1KMMA 2V9CA 1FL9A 5FBZA 3DPSA 4DIUA 4MW6A 5KQMA 1WVGA 1VLZA 5CLHA 1EQUA 4X24A 4XLZA 1PGJA 1VKOA 1XDSA 5LXTB 2LVBA 3IDFA 3BULA 2V6BA 1JPNA 3IKTA 1XVUA 1RPZA 3D54D 3D6MA 2HA7A 4YYZA 5FNZA 3JWGA 1IK4A 2BMAA 3B13B 3IUQA 4RSMA 4KFRA 5KWVA 1NI4A 5ITZA 1TDJA 2XTAA 4JX9A 3BJMA 3BMXA 1KJYA 1DJNA 2H4YA 4DA8A 3GDGA 4A4DA 4AY2A 3K9LA 1TZ2A 4MUNA 2ZVQX 3CO5A 1BD4A 3I58A 4U2BA 2OO3A 5B1IA 3WGOA 3CLKA 1FXWF 2UZIR 4LF6B 2YN2A 4WHMA 3G0HA 3TTVA 2ZU0C 1R8SA 4AJKA 3EBPA 4D46A 4MUGA 1M66A 2AN5A 2QJWA 3KIPA 1B8OA 3NYWA 5BW0B 3R0XA 2IHBA 3OUZA 4JQZA 5D3MB 5EINA 4B80A 1HYEA 1SQFA 2ADOA 3H17A 4OP3A 5K0GA 1P1JA 2AQ8A 5K3SA 4PCVA 4NIMA 2BGKA 5H1YA 3PFHA 2FQWA 3PC6A 1F0PA 2J9FA 1Z2CA 3G85A 4FKZA 1N36B 1KARA 1QHIA 3G2JA 4PQGA 4Z3KA 1Y1KE 1BJKA 1K9VF 2IT1A 1QIFA 2L82A 3DVAB 3OLWA 4ND5A 5DYWA 4A16A 2BZ0A 4AICA 3W8FA 2TMDA 1L5OA 4UBLA 3AF5A 1X74A 3CC8A 4GUDA 3CNNA 4LJRA 2OO7A 2PKXA 1FP2A 3TNLA 4F6RA 2X6TA 3GNTA 1M7GA 3RUEA 1JKMA 3VUFA 1SHUX 1CJKC 1D8AA 3D6TB 3FW1A 5KEIA 4KU4A 4Q12A 3TD9A 4IIDA 4U7GA 5DB4A 3TCXB 3W3ZB 3WO1A 5B30A 4CV1A 4QRIA 1KEEB 3IAHA 3QBVA 3AEUB 1EQ2A 3HJTA 1L7BA 2NZ8A 4BNZA 3A6KA 3AHIA 3GRUA 1ICEA 1UR5A 4D43A 5J47A 3HA2A 1GAQA 2EYUA 3ULKA 3BFXA 3ESRA 3KS9A 2DF8A 3EN0A 2MINA 2X8JB 5LYJF 3KHSA 5FWYB 4PZDA 1M67A 4EGCB 5HGXA 2IYYA 3KUKA 3KBBA 2ECPA 2HHCA 3OC6A 3DR5A 1IY1A 5HKLA 3EWIA 2VTKA 3FKSA 1BVRA 4B40A 1ZJ6A 1OJLA 4FYWA 4ARCA 4F84A 3IKVA 4LV5B 2PX3A 4DGQA 5BUQA 5KX5A 3K4PA 3LSYA 5BN5B 1L2TA 1UKCA 4RJIA 5JVDA 2PK3A 2VEDA 2XBUA 5DLEA 3TRFA 2ZYDA 5JZMA 2FLVA 3LC2O 4RO0A 1Y1LA 3JYLA 1JDZA 4LQ4A 4JMLA 4OUKX 3WLFA 2A1UA 2VN8A 1RAGA 3IUMA 1K5HA 3O93A 3FUTA 5FEMA 2YOHA 3V33A 2WZCA 2AFIB 1CC1S 1IXZA 3DLAA 1OAAA 4KUGA 3UTDA 3SSOA 3ASZA 4HWKA 1LK5A 1OROA 3R6DA 4P5PA 5H4GA 5M04A 3I5XA 5IEBA 2QLNA 3FDZA 3L1VA 3PI7A 1EWTA 4ZEWA 3GT4A 4BQPA 1AKVA 3LVBA 2CB9A 1WMBA 3B1JA 1KA9H 1NJ2A 3ZDYB 4DLKA 3IAUA 1GGMA 3JQAB 4FOOA 2WIAA 1KU0A 4BL5A 3TQHA 1TK3A 3JVDA 1GPJA 4KO3S 5BSVA 1ZJWA 1S2OA 2HQBA 4YRMA 3KSUA 3GYBA 3SHQA 4F8JA 5IJ0B 3OPYB 5K4AA 1RSZA 2C61A 3L7MA 1NXXA 2HW8A 1Z35A 2WFZA 4CTNA 4P33A 2C5HA 3FUXA 4NENB 3HVJA 4LSZA 3N8GA 5DWQA 4DZRA 3GARA 3W5CA 4U5XA 4EG0A 3F9RA 4LF4B 5SY4A 3CFAL 5TPZA 2QXTA 5JQGA 1D7AA 1FF9A 3EOBI 5AMXA 5IBCA 4E12A 1DAIA 3QELA 3O91A 3IVGA 5HR5A 2GERA 3PC8C 3V4OA 5KPJA 1QP0A 1QSGA 1R16A 5C8XA 2QRUA 2PKYX 4I1RA 3KZ1E 2ZBPA 1VI2A 3KYJB 1C7EA 1OI2A 2IXGA 4JI0B 4HCJA 1CRLA 5ECYA 4FBMA 1SA0A 3RLFA 3SXJA 1W88B 4XR9A 1PG5A 3QTLA 5T4HA 3A9VA 1X8JA 1QYXA 3E81A 2RE8A 1T1EA 1TU3A 3AJRA 1W73A 4QFDA 3KC2A 4WE3A 5DP2A 1PNRA 4TL6A 3SKYA 1HRDA 2VHQA 3BQNB 2FQYA 2FLKA 1EZZA 1Z34A 4IG9A 4FEYA 3P9KA 3SMQA 4DY4A 2QTWB 2XQFA 4ZVQA 3TLCA 2X9LA 3RVPA 2YY5A 4O3FA 1QBGA 2XNHA 2TMGA 3R3XA 3X2EA 2C3YA 2A0WA 2CBXA 1Q1ZA 3H8SA 1E89A 4RDIA 4IJUA 2C9ZA 3WI7A 4MIYA 1WCIB 1ZI6A 4GOKA 2QQ0A 4YRTA 1ZBDA 3HKBA 1JFLA 1U3GA 3JQPA 4HJRA 1G0OA 2JCVA 1UPBA 1X7WA 4YEDA 3EFBA 5BQ5A 4XWGA 2JIBA 2XYVA 3UA4A 3LWNA 4LWQA 1DI0A 1QMPA 3SFZA 3CINA 1EMDA 3FY4A 4L78A 3LC7O 3RARA 2W6QA 1J90A 2R00C 2XKKA 2CHEA 4TV8B 1QF7A 4OU4A 2KHZA 2IH2A 2QYOA 1Q3TA 1UXIA 3UAOA 4J8PA 2RAPA 2HD4A 4X85A 1HQYE 2BMVA 2G5PA 3GLUA 4G85A 1LSSA 3ZGLA 1S1CA 4BATA 4YMUA 2JNWA 2QRKA 2K7ZA 2LCQA 3AI2A 5DM1A 1U7XA 1FX1A 2OENG 5EEHA 2O59A 1MAVA 4JVMA 2PUHA 2DE0X 4XWOA 1MVNA 1SXIA 5CMLA 3EGCA 2VIIA 4Q9DA 1UPCA 4DYHA 4YJFB 3RVLA 3DTNA 2QY9A 4MS4B 4MWZA 4HYQA 1OE0A 2HK6A 3NUQA 4CQJA 1KOJA 4IF6A 1S8FA 5DGIA 4J1NA 1YRQA 2GRJA 4XCVA 5J2TB 5AKGA 5BORA 1JXAA 2D4HA 3O4JA 4BAGA 4HWRA 5FI3A 5F73A 3WP1B 1GFWA 3RAPR 2YFHA 1H1LB 3A9CA 3D2CA 3AUKA 4FE7A 2II6A 4NFYA 4TPKA 4BDTA 3NVKI 2GDJA 3U4QB 3O8OB 2X4DA 3K5IA 2X5KO 3KCNA 3PT5A 2VL7A 2WR8A 5DHPA 1N6PA 4C0JA 4KGZA 1CY4A 4M49A 1DWPA 3PD0A 4MI6A 1SIBE 2Q1UA 2QEQA 2VHUA 4MH0R 2CXTA 4UU7A 4Z4EA 4TV8A 4G4JA 2QA5A 4O2RA 4GX2A 4B47A 2FPWA 1CEXA 2W90A 4WK2B 2BBOA 3MINB 5IT5A 3WBJA 3LT5A 4I9HA 4WKOA 4GXNA 3UBMA 5I3CA 3H8WA 4HDMA 1EVLA 3CCFA 3OO0A 4FR0A 4U2DA 1Z4QA 1GILA 2QDXA 3TL6A 1LH0A 3HXTA 5IH3A 3U3JA 2GCOB 1JKIA 4MGYR 2QN8A 3E7WA 4QC2A 4JI5B 3VR3A 3ZGOA 5BYAA 3TECE 1UH5A 1IY0A 2A7XA 1P4GA 1GCOA 1B6RA 1QUFA 3OJXA 1T8YA 1Y7IA 4ETWA 1GAXA 1V16B 4PO1A 4NBWA 2DLNA 2NU6A 1P6XA 1WU7A 2MR6A 2MCFA 1E2UA 4HRYA 4A5OA 5F5LA 1WXIA 5G41A 4ZXPA 3DOCA 2ZIXA 3NWOA 3RYHA 1AZWA 1E1RA 2R5FA 1KJJA 1KQOA 1Z6XA 2QOEA 2VDLB 1P9NA 3UH1A 1JDBB 3O31A 2OYRA 3NRBA 2WMYA 4YJGA 4YRLA 4EL0A 1M6VA 4GI2A 4OQLA 3T4EA 2A6PA 3WK8A 4BHRA 2R3SA 1YV9A 2BHLA 4DQDA 5AVWA 1NVMB 3B36A 2R8EA 4UASA 1WHTA 1UBHS 4ZV4A 3RKUA 3A4YA 3HU3A 5HILA 1NU6A 2Q4EA 3RK4A 4AROA 1IN5A 1GL7A 4KPUA 2H17A 1EESA 1TB4A 3QEJA 3HZHA 4MQLA 2B1JA 3IV7A 2IHYA 1IEQA 5G2OA 3Q3VA 3VHQA 1UAGA 3HU1A 1Z2OX 2A94A 2WWHA 4LRSB 4BLVA 4CLRB 1FRFS 4YP0A 1K7YA 2J3DA 4A0GA 1NU8A 3DHVA 2H1WA 4N7JA 1SBZA 5BW5A 1QXSA 5T4BA 4I3HA 4G0VA 3OSUA 4PTYA 4EJ6A 4J7AA 1SB8A 1EUDB 4RMIA 4BU1A 1KFEB 4U7HA 2OZVA 3GT7A 3UATA 4BKUA 1OAOC 4U00A 3TBHA 1QYWA 4U63A 3QUCA 1XYVA 5DOZA 5GM1A 1K3UB 3V1LA 4K86A 1N6HA 3NM6B 3WBKA 2IU6A 4D79A 3SS7X 3D0KA 3A1CA 4RQUA 1EUCA 4J94A 2AVNA 1XLWA 2YMPA 4AG5A 5DBHX 4OP2A 1HZZC 1AKEA 3BBPA 1R9JA 1PVVA 1U1CA 3IJ5A 4BP1A 2PYZA 2ARKA 2P1RA 2IX3A 5IM5A 1A72A 1M6VB 1RQXA 1RYMA 2NZ2A 1IY9A 3C7DB 4IY1A 4EMSA 1TM3E 1N77A 1I32A 2XBLA 1W30A 4U5QA 2JGEA 3RUHA 1PEAA 4TXLA 3GC6A 3B38A 2O6HA 3VKVA 1J8QA 4C0QC 2LDXA 2ZM5A 4NICA 4G07A 4EI2A 3B6JA 1UDCA 3NXSA 1JAXA 3O9MA 1NJ5A 3SLKA 2DSTA 3NHSA 4YRRA 5FPYA 2WTEA 1R66A 2WU8A 1ISSA 3WAKA 1T2AA 1O97C 1QRRA 2EKQA 2JGDB 1Y4SA 3V2HA 5ICCA 5JECA 2XF8A 1UMKA 1X1EA 5K3EA 2B4YA 3EIQA 3GNSA 3IPRA 4FE4A 3T38A 2VAMA 3EGXB 3PQ8A 2ENWA 2OVBA 3H2SA 1H4SA 3KJXA 3FN4A 5JNSA 2NN3C 2QRJA 3WYGA 1IVYA 1D2CA 2ECQA 3TSYA 3U48A 5BSWA 4Q47A 1YD7A 1FUYB 2HWUA 3VNAA 4QASA 4MITA 3NDPA 2GCGA 1RWBA 2DWQA 1RHKA 4RWZA 2LR0A 3MWEB 2RCNA 4BV8A 1B73A 2CUZA 5T5QA 1YE3A 4B4UA 5BN5A 4P4UA 4DUYB 3D4IA 2B69A 4X93A 1EDOA 3BHMA 1B2RA 1ZQ1A 5AM0A 1V8DA 2FPLA 2PQ6A 3VPFA 4JBGA 1W8IA 2Z2IA 2EG5A 3WFJA 1KH2A 1NA5A 1SVUA 2WKRA 2P2NA 3MTIA 1RMTA 1UF9A 1XVVA 2B1IA 2GESA 4IZHA 4D9NA 3FFAA 1DARA 3K96A 1L7XA 2FN7A 4U39A 4C6TB 1GLVA 2A0YA 2RK3A 5ABPA 4X90A 5I8WA 4C4XA 4G4SO 4K3VA 2EKBA 2ZVPX 2OOSA 4H7FA 3FOCA 3DF9A 4QU0A 2R1VB 3NHFA 3QMMA 1XPOA 1X0XA 2A5GA 3PHBE 1XDUA 1E6LA 1QO0A 5BN4A 4N5IX 3W5BA 4M38A 4PX3A 2YW9A 2BYTA 1YONA 2RBGA 1VBMA 1XZDA 2FOIA 3NR2A 1VDZA 3CUWA 4PCLA 4B17A 1JMKC 2IW1A 1DBIA 4Q03A 1KQGA 2PXAA 3EXFA 1WBDA 2D59A 1SQSA 1P62B 4KQKA 2YIJA 3EGXA 4L0CA 4F4DA 2XHZA 2G6TA 2FEMA 1MAHA 1QYRA 2FVYA 3DV9A 2AOUA 3IPYA 4Q02A 5ENDA 2GZMA 2CDRA 5EI5A 4EY4A 2YZMA 2IH5A 4BO6A 4AJNA 1GZSA 1K2WA 3HY6A 1N6IA 3A70A 4RD1A 7AT1A 2D2FA 4UDOA 1KRXA 3OCWA 3GFQA 3ZJTA 5IKMA 1GZ5A 2I8LA 3EGEA 4LISA 1A04A 5J4KA 1UKVY 5D6NA 2ZKIA 2Q3HA 2D1SA 4G9GA 3Q0EA 1L6RA 4IDDA 1SVSA 2VNKA 2VNSA 2PUVA 1G7CA 1Z6GA 2IIQA 5G2FA 2IUSA 3GRPA 4PSAA 4GR9A 3WQHA 3QJ5A 5BV0A 4F45A 1CVIA 1QKKA 1UK6A 2C83A 2WSMA 3UXYA 4ZYXA 5DM0A 5A4DA 3GPDG 5CAEA 1YL7A 1LI4A 4ARBA 4MTCA 1JDVA 1AV6A 1EINA 1V8ZA 1YQXA 4JNCA 4PR0A 1N5LA 2X0RA 3KOMA 5EMHA 3WVNA 4TT3A 4UTVA 4DV0B 1DWUA 2GZAA 4ZYLA 2NMVA 4CQMB 4JL5A 1VJ5A 2DB3A 2FPPB 3ZW9A 1C8KA 1PTJA 4BIIA 3L0IB 1N5RA 1RIIA 4FD3A 3A58B 4JELA 4EITA 2ID4A 4INOA 5DBIA 4WXPA 2IITA 5COAA 4Z1MD 3TPZA 1L7AA 1YI0A 2HHAA 3WGUA 5EL0A 2R8OA 4Q00A 5HUQA 1EFCA 3A1TA 1OLUB 3OQMA 2X5XA 2WHPB 5JFGA 1XA4A 1P39A 2AN4A 3UB4A 1UAAA 1EG7A 2C78A 3A2NA 2IYVA 5I4IA 4P4SA 4KREA 1Q0QA 2JLAA 3GRKA 3IRUA 5CT6A 1N75A 1BKDR 5ISMA 3FCUB 1P3DA 4CR8A 2Z4TA 1L9XA 4B33A 1SIOA 1Z6QA 4LQCA 5BSTA 4UATA 3UF0A 4BVBA 1EAMA 3HCWA 2D6FA 2PGLA 3CLVA 1MR3F 3RS9A 1ZESA 1TT5A 1LC3A 1QAOA 3SBXA 5JFOA 4L6IA 2J87A 1YGPA 1H93A 5I7HA 3BVPA 1FYEA 1Y0BA 4MULA 2JAOA 4QBHA 3ZWDA 1HNNA 4PFKA 1FYFA 1J09A 2GK4A 2QRNA 4H08A 3BD6A 4RK1A 1TQ4A 5DW3A 1AXRA 4OHPA 5KYYA 1SUAA 3LWZA 4HQFA 4HLQB 2EBHX 3ISTA 3O6VA 2FKAA 3R0ZA 5JR3A 4UOEA <