3UK2A

The structure of pantothenate synthetase from burkholderia thailandensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
280
structure length
280
Chain Sequence
b'SMKVISSIQELRDQLRGQNRTAFVPTMGNLHEGHLSLMRLARQHGDPVVASIFVNRLQFGPNEDFDKYPRTLQEDIEKLQKENVYVLFAPTERDMYPEPQEYRVQPPHDLGDILEGEFRPGFFTGVCTVVTKLMACVQPRVAVFGKKDYQQLMIVRRMCQQLALPVEIVAAETVRDADGLALSSRNRYLSEAERAEAPELAKTLARVRDAVLDGERDLAAIERRAVAHLSARGWQPDYVSIRRRENLVAPSAAQIEAGDPLVVLTAAKLGATRLIDNLEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Ligase
total genus 88
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3uk2A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3uk2A01
5J58A 1VBNA 3RJZA 3DO8A 3IVCA 3H9CA 3ZJVA 1NI5A 3AFHA 3UOWA 1WJGA 5HUHA 4P2BA 3KT6A 3P0HA 1R6XA 1CT9A 2D5BA 5EKDA 3ZGZA 4DDMA 2X1LA 3IOCA 1U3DA 1YIAA 5H7XA 1RQGA 3KT0A 4ND7A 1WXFA 1N75A 4R2LA 2J07A 4HJRA 1K97A 1PFYA 2EL7A 3ZXSA 1OBCA 1F9AA 3UC5A 3H99A 1MC1A 1IQRA 2GOYA 3PNBA 1TYBE 1YIDA 3FETA 1U7XA 1ULHA 3E27A 5LLTA 5JBNA 3CLRD 4ZCSA 4MUFA 4XFDA 4CT0A 1WXIA 2CYCA 3FWKA 1H3FA 1QNFA 4MUHA 4NZPA 3VGJA 2BYTA 2QUJA 3CVUA 1NUUA 4JZYA 3KT8A 1VLHA 4MW4A 2CT8A 4GU5A 3IUBA 1WOYA 1T6YA 4MVCA 1V8FA 3IDFA 3H05A 2A1TR 1JIJA 3PNYA 5J5AA 3INNA 1IQ0A 4MWCA 1N2BA 3GUZA 3SP1A 1FYDA 2PFSA 1NP7A 3FY4A 4K0RA 2XRYA 3K32A 2CUZA 1XNJA 2QTNA 3N9IA 3ZXIA 2D54A 2D13A 3LOQA 5FO1A 1IVSA 3CLSD 3AL0C 4H3SA 2A86A 3P0JA 4U7JA 1J09A 4EG1A 1J21A 1R6TA 1XNHA 1F7UA 1GN8A 2CFOA 1KKUA 1M8KA 2XRZA 2H2AA 3NV7A 2Z3VA 3N05A 1N2EA 4L2IB 3UK2A 1ILEA 2A84A 1J20A 3A05A 4NDAA 1O94D 2QUIA 3IOBA 3IMEA 3SEQA 4EG8A 2E0IA 2RE8A 1I6LA 1LI5A 1QQTA 2GKSA 2QJFA 4CDMA 4KPUA 2C5SA 3NBAA 3A2KA 4EG3A 4MUIA 2PZAA 1NUTA 2AG6A 3H97A 4EG7A 3CLUD 1KH2A 1M83A 2A1UA 3U1VA 3IODA 3C8ZA 3AKZA 3JXEA 1F7VA 4NATA 1WXHA 1X8XA 1N77A 1IQUA 1GZUA 5LFAA 3UY4A 1GTRA 5HG0A 3COYA 1JZQA 3FI0A 3RK0A 3SDBA 2WQ7A 3CVWA 1JZSA 1M8GA 4FZJA 1PFUA 4DDKA 1EFPB 3QTTA 1O96B 5FNZA 4UZEA 4DJAA 3IMCA 3SYTA 3VRHA 1N2GA 3IH5A 3COZA 4G5FA 3IVGA 1O95D 3IMGA 1QU2A 2JAXA 3ZJUA 4TS1A 4WNYA 4ZT2A 1JEDA 2DETA 1KAQA 4YMIA 1H3NA 3CLRC 3MLAA 3L92A 3X1JA 1N2JA 3ND7A 2YXNA 3ISJA 3ZIUA 1EUYA 1TYAE 4ZCPA 4F4HA 3MMXA 4QREA 2ZUEA 3D6UA 2V0CA 1MAWA 1NURA 5AHWA 3ND6A 1QRUA 2CSXA 2QUKA 5HUJA 4JXXA 1N2HA 2WB2A 3QTBA 1U3CA 1ZUNA 1JEEA 4EFKA 1KQPA 2QTRA 4YP5A 5TEVA 4JYZA 3PNVA 4JFAA 2NSYA 2Z09A 1J1UA 1O97D 1KP3A 2PZ8A 4XFJA 3ELBA 2J5BA 1QRSA 2OV4A 4BWVA 2I1LA 3PXUA 1ZJWA 1EUQA 2CV0A 1WY5A 1M8JA 1KH3A 4RPIA 3CVVA 2CV2A 2X1MA 4OJMX 2PXHA 3FIUA 5H16A 1T9GS 3LE8A 4MW7A 1KR2A 1Q19A 4EG5A 3TZEA 3CLSC 1NUQA 4ND6A 4A91A 1K4MA 2H29A 4PBSA 1OBHA 1TYDE 4QRDA 3COWA 1JGTA 4Q16A 2X3FA 1N2IA 2J4DA 2QUHA 4MW5A 1EFVB 4MULA 3KT3A 1O94C 1Q15A 1G8FA 3K9WA 3NBKA 2O5RA 1UFVA 1T6ZA 3HMQA 5KCMA 4R0NA 4I6JA 5IJXA 4MAFA 4MVXA 2HMAA 1LW7A 1PG2A 1U7DA 4MWEA 1F4LA 3AIIA 3RFFA 3CLUC 4ZT6A 4YP7A 1OWNA 3FOCA 4OUDB 2Z08A 1P7PA 4L2IA 1PG0A 3TZLA 1G59A 2DR2A 3M5WA 2O8VA 3COVA 3TQOA 2B7LA 1OWLA 1YUMA 4J75A 4WSOA 4U8HA 2VTBB 3F3MA 2IP1A 5DEOA 1G8HA 3HGMA 4AQ7A 2IELA 2OQ2A 1O6BA 1LI7A 4PY2A 4DLPA 1NYLA 2DPLA 1YI8A 3TNJA 3N8HA 3AG6A 1O95C 2JA2A 2CV1A 2DUMA 5DB4A 4CDNA 4RUKA 1KORA 1G8GA 3PRHA 4ZT7A 4MWDA 2WQ6A 1MJHA 4R2MA 5F23A 1PFVA 4DDHA 5IHXA 3FNRA 1EFPA 2YWCA 1O96A 1I2DA 1OWMA 4G6ZA 5BNZA 2VXOA 4MVYA 3MLBA 5TEWA 1KQNA 1OWOA 1XJQA 2AZXA 3FHJA 1PFWA 2RD2A 1Q11A 2BTEA 3X1KA 3FH0A 2R5WA 1DNPA 1N2OA 1JMVA 4QBTA 2HZ7A 4ARCA 2G36A 3Q10A 3CVYA 2NZ2A 1TYCA 1N1DA 4PBRA 1R6UA 1O97C 4E1AA 3AG5A 1H3EA 1D2RA 1VBKA 1QTQA 1IFXA 4KR7A 1NUPA 4Q93A 2A4MA 3CLTD 4XSVA 1K4KA 2DEUA 3SEZA 1S4MA 4MUEA 2J09A 1GPMA 3D6VA 1WQ3A 4MUGA 1V47A 3Q4GA 3ZUGA 4MUJA 1EE1A 4ZT3A 2EJCA 1ZH0A 3G6KA 2E89A 3RHSA 1A8HA 4HPWA 3TS1A 3SZGA 3Q12A 3HL4A 1M1ZA 4S1OA 1I6MA 2ZP1A 1IRXA 3FG9A 2AKEA 1KP2A 1O0BA 4KR6A 2GM3A 1VL2A 3P0IA 2E18A 1WKBA 4PBTA 1BS2A 1MBZA 1NSYA 1TQ8A 4MVWA 2PIDA 1GAXA 1Q77A 2WSIA 5KHAA 3LCJA 3G59A 5FO0A 2DLCX 5TS2A 3OTWA 3UMVA 5DK4A 2CYAA 4NAUA 4HJXA 2YY5A 4YP6A 2DERA 3A4IA 1OD6A 3VU8A 1EFVA 2A88A 3ILVA 4HK4A 4ZT5A 1T9GR 5TGTA 1JECA 4MUNA 3CVXA 4EGAA 3OP1A 3ZJTA 1M8FA 3ND5A 4MQ6A 4K03A 1MB2A 1TFUA 1WQ4A 3QE4A 2DXIA 4KR9A 1HYBA 3HV0A 2TS1A 1JIKA 4MW2A 2QJTA 2A1TS 1N78A 3N2YA 4OUDA 1VBMA 2J08A 3CA8A 3BL5A 5J59A 3DV2A 3H9BA 4DNXA 2VTBA 3DPIA 4MUKA 1IHOA 1GTSA 4EF6A 1WXGA 1WZ2A 1TEZA 1GLNA 1NUSA 4I6EA 4MW9A 4UZFA 3MXTA 1K92A 3S3TA 1J70A 1QRTA 1O5TA 3HZRA 2IJGX 3CR8A 4KKVA 1MAUA 3KFLA 4MLPA 2E21A 1T6XA 2A7XA 4I6GA 4ZT4A 1QJCA 4MW0A 3G5AA 1J1ZA 4DE5A 3IUEA 1Y42X 1H1TA 1WXEA 4X0EA 1IH8A 1I6KA 1U0BB 4G5YA 1KQOA 1JILA 5LM3A 1EJ2A 3I05A 5K0TA 3CLTC 1JIIA 1XNGA 1YUNA 1NZJA 2PZBA 2CYBA 4EG4A 3IVXA 4GRIA 4ZCTA 1MB9A 3GLVA 4MWBA 1MRZA 3DLAA 4MW1A 4NX2A 3RBAA 2QTMA 2V0GA 2QJOA 4EG6A 4ARIA 1QU3A 4KPUB 5KWVA 3TQIA 2PG3A 2JANA 3HFJA 4ZCQA 4U63A 1MOPA 3X1MA 1EXDA 1KAMA 4NAHA 5K0SA 4J76A 1JHDA 4YBRA 4F3RA 3SZ3A 2A1UB 3L93A 4MW6A 1YULA 2X0KA 3IOEA 3MUEA 3FDXA 4ZCRA 5DASA 3RK1A 1N3LA 2HGZA 3GMIA 3A04A 1COZA 1FFYA 1B6TA 1X6VA 1O0CA 4CQNA 1ZH6A 4JXZA 4AS1A 1KH1A 1OWPA 2YWBA 2ZUFA 1M8PA 1SURA 3P52A
chains in the Genus database with same CATH superfamily
5AW4A 2WSSD 3BGDA 1OROA 3ZCVA 1WXXA 3L4BA 2YVLA 2WYOA 3PUZA 3C7CB 4K9NA 3MGGA 3UIEA 3ER8A 2Q6LA 3SXUB 1JAZA 3ZJVA 5KNCA 6ABPA 1MJFA 2HK6A 2WMOB 2QL5A 3G79A 1EJ6A 3UOWA 4ESEA 1Q1GA 5CA0F 2WEKA 4LBYA 4M6WA 3GMTA 3DGFC 3QPWA 4QDOA 2Q1TA 4Q02A 3L4BC 4URHA 5I51A 4JLMA 2DP4E 5BO5A 4EL5A 1CFZA 1R0SA 4RKEA 3URKA 1GTVA 1BX0A 3MILA 3IO3A 2O3UA 4CCYA 3JASA 2XTAA 3DUFB 1GN9A 1E2PA 3B38A 1J9EA 3RUCA 4ZVRA 5A1TA 3NRJA 3PHGA 4ERXA 2XVXA 2HJWA 4PS1A 2GOYA 1BMFD 3LF2A 3EK2A 4MWGA 2D74A 5IDWA 1KFCB 4B7CA 1QONA 1GU0A 2B36A 2OEPA 3ZWNA 3O8NA 4PLFA 1EM8A 5F73A 9LDBA 2BFCA 2V7EA 2VPPA 3BAFA 3PPWA 1B93A 1TW3A 2QSJA 1Y4AE 4DLTA 5BXQC 3PXCX 4IIXA 4TKUB 1N3YA 2PKEA 4C4ZA 4RTMA 1U3WA 1VHTA 1ITZA 4JI8B 1T3LA 3A4VA 3ZWDA 4U7TB 3PICA 3D9QX 4IILA 4B3IA 1X0VA 3FNEA 2QUJA 4HHEA 1EHYA 4G07A 4J43A 1RZUA 1E92A 2YWJA 4M2LA 3I61A 4DR7B 3MC1A 3DVAA 3D2BA 1VLHA 4C0QC 5A4MS 1TKBA 1M1YE 2EFGA 5ED4A 3F74A 3K6SA 2XTMA 3R3VA 1ZKMA 1PNRA 2O0LA 3B5IA 4H4EA 4MVCA 1H8HD 1HORA 5DSTA 1FSZA 1L5HB 3BE5A 3PB3A 4G0VA 3L6EA 4TUYB 4PONA 3BIJA 3G8DA 4M9QA 1IXYA 3A9TA 3AR3A 2QJWA 4J1SA 4BZZA 5LQUA 3EN0A 4P6VF 1LZKA 1NF3A 2QTNA 3UVEA 2F1OA 5HKBA 2X40A 4R5HA 2R8EA 1NVBA 2VQ6A 1RYBA 3NGLA 4CM3A 2YHSA 4D6YA 1UMDA 3TB6A 1RAAA 1X3SA 3BIWA 2WF7A 1I7LA 2VKTA 4ESHA 2JEZA 3RVSA 1G21A 3DE5X 1D1TA 2A0YA 2R8RA 4XW2A 4YFVA 1TUBB 1F7UA 1T5TA 2FEXA 1XEWY 4XVHA 3PC6A 4DA9A 3P8ZA 2VT3A 2PGNA 2Y05A 4B6EA 2VHZA 4RJTA 1S1MA 4IY1A 2DTXA 2DFPA 2EJVA 3DW3X 5AT1A 3H42B 3WHLA 4B46A 3ZHRA 3SVTA 1BA3A 1KETA 1GCGA 2H52A 2P6OA 2E55A 4KQKA 4PLHA 4NDAA 4XGQA 3T3PB 1YR8A 3IMEA 3SEQA 4WOKA 4GL4A 3O8QA 3IE2A 1Z83A 1E3QA 4DM7A 4RGYA 5B58T 2GESA 1UPAA 1V9CA 3PHCA 3N2KB 2QP3A 5E3IA 5IBQA 4BFUA 3GV0A 4EG7A 5CUQA 4E1VA 2XDQB 1HE8B 1N2CE 4EY3A 1NOKA 1XKXA 3NU1A 3ZU3A 1VPDA 3FTQA 3PR1A 4G3XA 4GOND 3ZE8A 2JI8A 3C8ZA 4AUMA 4CMHA 2WJ3A 3PQ2A 4OO3A 1PFGA 3W3ZB 2FPGA 4DR3B 4DIEA 1U0SY 2V7VA 2UXBB 4LY6A 5CFPA 1TMOA 4HP8A 4AZVA 1ZI6A 4GMKA 4R7ZA 1BJTA 3WV5A 2PWPA 3VUFA 1JKIA 3O7WA 3ESYA 3KJEA 3B6EA 4PAMA 4QD3A 3ORHA 1LDNA 5FEUA 1RJ9B 4KZPA 3DT6A 4LRXA 4PGFA 4NOJA 4JBHA 5FOWA 3WMWA 1A77A 4UUOA 1JZSA 1A9ZA 2F4NA 3GLUA 5JDCC 1JLLA 1ULBA 3H5LA 4NDNE 1FXUA 1NVUQ 2RGUA 3KD2A 3LRPA 5KYWB 1YS9A 2EC5A 4NVRA 3FOAA 4DGSA 4E14A 1ZUD1 1N0IA 1PJ8A 1GCAA 2R1UA 3LDAA 4TXLA 2VS1A 3WLNA 1NVAA 4FR2A 3ZEAA 4ZYUA 3PLNA 1ZNQO 2PL3A 3UKJA 4G5FA 3FGZA 3IMGA 5ECWA 2V6GA 4BLQA 1H5QA 1ZJ5A 4PAWA 4PHGA 4QJ4A 4GAEA 3B8HA 1I36A 1PX2A 1J4AA 5C8YA 5IC5A 1Y6FA 2XBLA 4QUIA 4EGSA 2J32A 1Y82A 3SBDA 2Q6KA 3ZX5A 2NP6A 5BV7A 1DBRA 1DRKA 3X1JA 4MRMA 1DOAA 2ZJZA 2C2YA 4JL5A 3EMDA 2OFFA 2WMDA 2CMDA 1UWLA 4WKGA 1KERA 3D6AA 2ZCJA 4CIWA 3O47A 4EFDA 1AQ6A 4URYR 2Q3EA 1M2EA 3TCNA 1TL7C 4IXWA 1XOIA 4JP5A 4BFCA 4L16A 4D45A 1ENZA 4ED9A 4ZIRB 2X3UA 3OC0A 1CQWA 4P92A 5C5CA 1L8LA 1CJBA 4OG2A 4Q3EA 2YJNA 2AQIA 4L4RA 4O2AA 2GEUA 4QQNA 1QOZA 2QYHA 3QKTA 4XPIB 2EDAA 1U3CA 1X86B 2HSZA 3DNPA 1KQPA 1KVQA 3FTPA 1Z2DA 4FN4A 4NYMQ 4TV9B 5TEVA 3V7NA 3KV3O 4K7JA 3KXPA 3S2FA 3QEMB 3QFHA 3G8BA 1YRHA 1FZQA 4PN3A 5TF0A 4Z8YA 3RAFC 4ZDIA 4DUZB 2P6RA 3W8RA 1D6MA 4YRGA 4CT5A 2QRGA 3DA8A 4LZNA 3I2IA 4EHKA 4D25A 1CEYA 2JGFA 2OFOA 5SY4A 3OOSA 4JCCA 2BFOA 1GG9A 4F6RA 1USIA 4AICA 1HE5A 4MI6A 3UWSA 1PKEA 1ZXXA 2E2WA 4I50F 2DU8A 4NCKA 4UHCA 1P2BA 4ZOAA 4BMNA 3O74A 4YQFA 3GPCA 4DMUB 2RHCA 1Q0SA 3E5HA 3NDRA 1SVOA 1D04A 1DEOA 4X92A 3TTWA 2KI5A 4E2XA 5KJFA 3ZI7A 4IV0A 4XUEA 2I8CA 2FLVA 4WOJA 5LQNA 5CJJA 1J8VA 1PNTA 4KUGA 4QRDA 3SHQA 2OXEA 1R74A 5KMGA 5LQDA 2AK3A 5F12A 4BP8A 2H1HA 4H7EA 1A9PA 3U39A 3L46A 1ATZA 4XH9B 4M36A 3QYFA 5LVAA 2CHGA 2Q5EA 2DHRA 2N46A 2V6BA 2ZYIA 1JYFA 4QFMA 1M3SA 3UBTA 1BIFA 3GX1A 4EBBA 1W5EA 3LFHA 4K9RA 4NJEB 2DFDA 2H5IA 2RB5A 3CX4A 2O07A 1YDWA 4DLKA 2V55B 3CN9A 1Z2CA 4QYMA 2JJMA 4X20A 4CQLB 4Z1MD 5A4IS 1M7GA 1XVIA 3F4BA 5IFKA 5A7FA 1SOMA 2J0UA 1WU8A 5JE8A 2GZDA 3NBXX 4DA4A 4AROA 2A30A 1O1YA 1UZUA 4JNCA 2G80A 4DUGD 1XQYA 1RRKA 2R1TA 4M55A 2DCUA 1J99A 4P4LA 1I7SB 4UMDA 1G20E 2B5VA 3DFFA 4NZYA 3GUYA 4BQIA 4F9GA 2C2GA 4FE3A 2WD8A 3GWZA 3AVPA 1NONA 3TAUA 3TFWA 4E33A 5HZHA 5BN4A 2GWRA 4H7KA 2XYHA 4J7CA 1RS0A 2XX3A 4HQOA 1L7MA 4ACAA 1FZTA 2EQ5A 5G53C 4AWBA 4PG4A 1GZHB 2OHFA 2J48A 2PPVA 2EP8A 2H1LA 3RYHA 3PWKA 1Q6ZA 2FK8A 1JIQA 3O4HA 4NQZA 4DADA 2COKA 3B6JA 2MR5A 3CUUA 3KEOA 3R9XB 4KPGA 1V9SA 1TKCA 5LC1A 2B4TO 3JQAB 4UASA 5B64A 1OKKA 1UC8A 4L5AA 4HTFA 1OB5A 4LMRA 3KZVA 1VHJA 4HGOA 4F2DA 3KK0A 3T0GA 2ACKA 2WQ6A 3ECCA 1SKUA 1B3BA 4I55F 3N0RA 2SKEA 3DHYA 3KBBA 3R6DA 4RF4A 3NHRA 5DRYA 3JQGB 4N6GA 5J2UB 3ZU5A 2XXAB 2VDVE 1Q2UA 4MQ4A 2WNHA 1IOVA 2ZSUA 2RGAA 2AZXA 4N7MA 3B5JA 3KVYA 4N3AA 3ECAA 4OMFG 2WF5A 4ZTUB 1L3CA 4ARCA 4IFBA 1QV7A 3G9QA 4EYOA 2R7KA 1GM5A 3ONFA 3OQ1A 2H51A 3NHSA 4Q3CA 5DWQA 1C3VA 1QDUA 1LK5A 3HB1A 4PXSA 5EIWA 4A10A 5BN3B 5KCZA 1O54A 3MTAA 3OOYA 5CJ2A 1K86A 4QNNA 3VMMA 1CUWA 1MQ9A 3S1AA 4IEFB 3MG9A 2C7PA 4EKNB 1XZLA 4BVBA 4L5IA 1HNZB 1QF7A 1ONSA 2ZTUA 5HM6A 3B51X 3DEKA 4GR9A 5IAEA 3TLXA 3UYKA 4MUEA 2IE0A 3A27A 1K27A 4RA6B 4AUEA 5CJPA 3RS3A 1ADFA 1EXVA 4DZRA 1RLUA 2M1ZA 3FHOA 3IE1A 2Q5OA 2QZPA 4DBLE 1X74A 3GVHA 3QBDA 4RKYA 4TYPA 5GV8A 3T7KA 2A50A 2KSQA 4ZKDA 1VGRA 3F96A 3LX6A 4MDFA 2I2WA 3H8JA 4IQFA 1FCJA 3CEHA 2VAVA 4HX5A 4KE8A 5G1NA 3TS1A 4O6VA 2QN6A 4Z4HA 1NBWB 4KO1S 3SHTA 4MIYA 3TRHA 5L3ZA 3V5NA 2NUPB 1KO1A 3K70D 1EWQA 1T8PA 1RU3A 5FPQA 3DGEC 4GOJA 2B3DA 3PEUA 3GZNB 4HUQB 4U9IS 5BYJA 3WLIA 2O0MA 1CUHA 3LQ4A 2D4AA 2FX2A 4OD0A 1QZZA 3KZNA 3OQPA 2B78A 3RIMA 4BQSA 3TRFA 4CT4B 4DOMA 1S3IA 4NYMR 3UTDA 3VM6A 5EOVA 4BMVA 3C6ZA 1A96A 4MR8A 4OB6A 3S8MA 2GXSA 3DG9A 3Q7QA 2HWWA 4CF6A 3NC1C 3C3PA 3NP9A 3H2JA 4XGIA 3HRHA 2C3PA 2P30A 4EJ2A 4INJA 3T4EA 3TRDA 3QU7A 3QVUA 1ZW1A 2PQ6A 4GP6A 1CE8A 3BRQA 1JI3A 3F6PA 3VU8A 3OESA 3CNNA 4JFRA 2IRWA 3IKLA 1GNLA 1QP0A 1M75A 4RLQA 4TZKA 4FCCA 2YIMA 3GCWA 3GOQA 3BKWA 4PPGA 3V7UA 3KJGA 1Z0SA 4MWOA 1MO4A 3G0OA 1FP2A 5FPYA 5HS6A 2P2YA 1EX9A 4B6GA 4HN9A 1X0XA 3A4NA 5JNTA 4RU1A 3U7QB 3UZUA 1FNDA 3EIOA 2C00A 2OQIA 2PSSA 4YYEA 4IXMA 2OUIA 4XARA 1CIVA 5TQ0A 3CPJB 4ZDWA 1S01A 3MM4A 1WUJS 3MGKA 3QM1A 3U2QA 2JLYA 2OTCA 3WSTA 1S1CA 1VBMA 3ZE6A 4ATNA 5DHUA 4RGVA 4MQEB 4YT8A 5JZMA 2H4HA 2XUKA 4X1YB 1HDZA 1M1UA 1ZOIA 2VAPA 1F14A 3DMNA 3GFQA 3OEYA 3B5EA 4QOFA 4LC1A 3C98A 5DM0A 4PZCA 2ZJ2A 1YR3A 3KPYA 4D9JA 3AOEA 2YKGA 1BXRB 3JALA 5BW6B 1Z7WA 2BMDA 4UARA 3WICA 1OSNA 1P0IA 3V1YA 1PQ4A 1E5QA 2CFIA 3GJ0A 4MW9A 1NQTA 4R01A 1K92A 1FUIA 1Q6YA 1QH9A 2G9ZA 4BNYA 4C4PA 1BEUB 3FPSA 2VHQA 2PLAA 3KFLA 5IK2A 3AOEC 3AI1A 1LJ8A 3TW6A 1FNMA 1ISPA 3ELDA 4E2YA 2LXNA 1QBGA 2BP7B 4TXMA 4X8LA 1C1XB 1PW5A 1DEKA 3DZKA 3OF3A 4Q3KA 3FCEA 5B1IA 4ONEA 4Y1GA 3GJ6A 3ZTYA 4ZYWA 1TUGA 2XHZA 3IUEA 4N65A 4A8HA 3H1PA 1P1JA 5FADA 4M9UA 1M6VB 2JFYA 4A2QA 1A9OA 5E9JA 3R7BA 4HYEA 1PDVA 1PFKA 1YB7A 1H2HA 2D06A 4UEWA 4G5YA 3EULA 4TKMA 3V4VB 2ORVA 2XUHA 4CV3A 1I1NA 3OIYA 1DMSA 5FWNA 3TUJC 2PKCA 4NNPA 4NS4A 1N0UA 3DBRA 2H1RA 4PCUA 1T1EA 4KYVA 4CETA 1KHTA 2GVDC 4AD8A 4ZRMA 3MPUA 2DMRA 4ZQGA 1QZUA 2VNJA 3DLAA 2XT6A 4LXHA 4NX2A 5E7IA 3ITNA 2FLKA 5TSDA 4KPEC 4JLNA 3W4IA 2REQA 3H11B 4I1SA 3AEZA 3STVA 4DA0A 1E1CA 1CCWA 1FU7A 5I4CA 1E2UA 2VPXA 1JB9A 3O0DA 3C0KA 5K0SA 3VZQA 1XDUA 3KQVA 4BYGA 4J76A 4U1RA 3HO1A 4H2DA 4LJ5A 2CD9A 1U0JA 4L8YA 4IDFA 1U4SA 5U4QA 1NBMD 4NULA 4ZZ3A 2ZCVA 1TEHA 5BOVA 5I7SA 4N5LA 3EQ2A 5G41A 5I7UA 3USZA 5DNWA 1B8VA 1TVKB 3PVSA 2M2IA 1B6TA 3ERCA 1S3GA 4H7FA 4I9FA 1N5LA 1W9MA 2CXOA 5AJHA 1QK4A 3TLGB 3NNDA 5I9MA 1I8TA 2FKNA 3L5OA 5IWAB 3G8CA 4HS4A 4XLZA 2PKWA 4GKAA 4P0TA 4Q9JA 3WA6A 4WW0A 4YLEA 2FWAA 1YQTA 3D81A 4S35A 1TUEA 3ZBPA 1A1SA 4C0HA 4PX9A 1Q0HA 4BJHB 1UPUA 4JYCA 1NI5A 1W29A 5J1TB 5BRAA 1LVHA 3AB8A 4BNMA 2AWOA 2W4IA 3EZ2A 1RI3A 3L7CA 4P83A 4WN9A 5BW5A 2H4XA 4KFTA 2ZDGA 2SCUA 1FA9A 1NQVA 4PG7A 3R20A 1T9CA 3L8CA 2IUSA 4QYXA 4DG5A 4E5DA 5BV8A 4FJ1A 2J7KA 5HNKA 4W5JA 5D7BA 4EYKA 2C88A 3F73A 5AI9A 1WV1A 1DQNA 2HF8A 2XF8A 1G41A 3B89A 4ZO8A 4CIDA 4BLUA 4ALJA 3H99A 2G1PA 3RVNA 4RVOA 3VYSB 4BLSA 1ST3A 2IU3A 2OGWA 4TUYF 5E1MA 2GSWA 2JJ2A 1BW9A 5LBIA 4IJWA 4IFIA 4X8OA 3FW1A 3FETA 5KDLA 5CEJA 5LLTA 2EFYA 4LSWA 2I7XA 4MA5A 3K31A 4C3UA 1IY1A 1XO1A 3C14C 5SZHB 5JRJA 2BGTA 4FC7A 3AF1A 4TLBA 3FWZA 3MJEA 3NR2A 3RS5A 2FSHA 3EEYA 3D3EA 4ZOLB 4NJMA 1X70A 3MWGA 3FBWA 1F8GA 4FYPA 4J9UE 3ZWKA 1D8AA 4WQMA 1WQ1R 2OZLB 1LJLA 1LV7A 3KT8A 5IM4A 4DV1B 1RBYA 1MU0A 4NCBA 2VT7A 3E5MA 2AFRA 5DN6A 3AW9A 4XXHA 1GGKA 4H7JA 3ZLBA 1CUBA 3TL2A 1IZ9A 1V6AA 1NQUA 4G1UC 4IDEA 4Q18A 1XTVA 1WXWA 2YJ6A 1P9LA 1NNSA 2A1TR 1JXOA 2PNFA 1EIZA 1YZVA 3LC1O 4YLGA 5FWXA 4MQLA 1PGQA 2AC7A 3CF0A 3RFTA 1XV5A 3GRCA 3THYB 1WZEA 1TZJA 2K2WA 3FCUB 3BGIA 4RFSA 3V4PB 2GR7A 3F67A 3ORSA 1J00A 5FBLB 1ND5A 4FGSA 1GCOA 2QTCA 3CLSD 3IRUA 4K6CA 1OZHA 4OHFA 3P4XA 4KO4S 3T1YB 2YOGA 4TTIA 1JV2B 1BH2A 4ZMRA 5JMOA 3CF4G 3ZD7A 1Y1PA 2X13A 3TTVA 2A58A 3THXA 2F6RA 4Q7EA 1UPXA 4BMZA 3LUFA 3BK7A 1W0KD 1WUIS 3NV7A 2ZSJA 2MSNA 1NMXA 1V8BA 4MPDA 4PYOA 1L8AA 2JI7A 4L3VA 5IAAA 5LDGA 4RV4A 3ZHBA 4GD3Q 1YZLA 2V45A 3VNRA 5BW0B 1U2DC 3BJEA 3IOBA 3E48A 3KALA 5EXTA 3I9V6 1SNYA 4EG8A 1DL5A 1HDGO 1K6JA 2PEZA 5CVCA 4C88A 2CZQA 3I9FA 4YECA 1PR1A 5JUWA 5KJCA 2HZBA 2WKSA 2OCBA 4WZAA 3LM8A 4ESVA 2N9UA 1XN4A 2NVWA 5D1HA 1P17A 4S24A 3IPXA 2VDUE 1O8BA 2O4CA 2X2FA 5BY2A 1NLYA 2P11A 1NKTA 2BFBB 3F49S 5FBZA 1CB7A 1SCQA 1PD1A 3GJ4A 1IN1A 3GW8A 3X3HA 2Z6QA 5C81A 2WT4A 3KWMA 4X3PA 1JLKA 1WXHA 5T41A 2I99A 4WESA 1DWOA 2RK6A 3AYXB 2JIMA 1WB5A 3PQ4A 5HG0A 3IEKA 1M1YB 3T7EA 3WK8A 4ISBA 4U7HA 1P29A 2ZBVA 1ZN7A 2NV0A 3K05A 3RADC 4FR0A 1MZPA 1OT5A 1AS0A 3KQOA 3E5NA 4ECAA 3GUUA 2W6MA 3KV1A 4A23A 3TZHA 3TX6A 5CBPA 5AVYA 3P20A 3IIIA 5ARBA 1E9DA 2OL4A 3D1VA 5J2UA 3KTOA 2GBIA 4YJHA 1AQJA 4A2PA 3TSYA 3KJIA 4URZR 4FB5A 3W5CA 3IVRA 3IDOA 4P4TA 4CKYA 3G0CA 3JAWB 5E9QA 3S68A 1BO6A 1G5IA 3UCXA 1M7HA 1JEQA 3GGGA 4R0VA 1USVA 1UOEA 3L7BA 4AZ0B 3KHUA 2REBA 2GFQA 2ZB4A 2ZTVA 3P97A 4FFNA 5A6VA 5KTTA 1YTLA 4Z9YA 5JNUA 5E6SA 4C6TA 4TM8A 5KIAA 4LOAA 4NBNA 4AWAA 2YW9A 2AOTB 3L92A 2J67A 2A92A 2KX7A 5FTJA 1JH8A 2QTVA 4CMEA 2WZDA 1QO7A 1GFIA 1NRIA 3UK6A 3I4LA 3GARA 3OETA 1GL9B 1MAWA 2D7DA 1T3ZA 2IYYA 3TE6A 3KAQA 2EBFX 1M74A 1FFEA 2ZROA 3FZEA 3ND6A 3NAMA 4MJ3A 3U4CA 5I5GA 4D6XA 2I65A 4ICIA 3TYXA 4JXXA 3AGPA 4MVJI 3LUGA 3WIEA 4PZDA 2O8CB 2FPRA 2F3UA 3EAGA 2Q3LA 4JUCA 5FWDA 4D3XA 5KVSA 1KKMA 3LWDA 2OESA 1QFXA 4DMRA 4OA8A 4P35A 3TSZA 1KS9A 2ZFUA 4UVDA 3VOBA 4R1NA 4FBMA 1N7JA 3RCBA 1ISGA 4U5QA 5BN5A 3PPXA 2OV4A 3DH0A 1W73A 1N2CB 4G0XA 4J07A 2CV0A 1U9IC 1YB6A 3EW9A 3ZXXA 4E5SA 1UC5B 1WY5A 2DFNA 1TX4B 5B6PA 3OZTA 4EI7A 4YQYA 1SG0A 1Z0IA 4N9WA 4YT5A 3DEIA 4KTVE 4QTTB 1Z29A 3T1QA 2ZR9A 1C1HA 1MAHA 1UWKA 2BUBA 4U0KA 1EUCA 2BEWA 3EJ6A 4QTXA 3ZV4A 5JBIA 4O4HA 5DWDA 4MXDA 3TZEA 4BCDA 3P9KA 1G6Q1 4YUXA 3BPSA 3ABOB 4E2WA 4AQYB 1T4GA 3WGGA 4C4TA 4DA6A 1KVUA 1U0TA 3CR7A 4EDHA 2R4TA 1T8RA 3UA4A 1JPJA 3U31A 1FX0A 2O2JA 5LKRA 3CI0K 2OXIA 5C0OE 3HC7A 4Y2TA 3VDMA 4LWZA 1MOSA 3ZXUB 3T5AA 1ZAYA 3CNBA 3E7DA 3MJDA 3O2JA 1U11A 4W4TA 4I5DA 1Q12A 5ICGA 1DZIA 1KPGA 3OPQA 5KNCD 3RR2A 3A0UA 4HS9A 1DQRA 2JDIA 4PG5A 5IJXA 3FM9A 1DAGA 3KUDA 1VKHA 1HEYA 1CRPA 3R74A 4JWTA 4JN6B 3EG5A 5K0ZA 2O14A 3HI6A 3VOSA 5KNLA 2F8LA 1OFVA 2CZCA 2YV1A 4R3WA 1CY1A 1MIHA 5REQB 3FOCA 3WGHA 2XUPA 1XYVA 3MWLA 4JHXA 2BLLA 1V11A 2WINI 3LHFA 4KAXA 4RZQA 3TNLA 4L5BA 4R3NA 1X7GA 4W7SA 4X3OA 1OI3A 3OLZA 4Y7DA 3TQQA 2ORWA 4BNNA 5J2UF 1Q1BA 3M5WA 1KO7A 2C1ZA 4K9PA 4QDJA 4BKQA 1OWLA 4I99A 1O9GA 4ZI7A 4F46A 3BRWD 4FFWA 4NOLA 1VLVA 1V16A 4KIWA 4Y18A 4W5HA 4J0EA 3KE8A 5CFRA 1PSWA 4PWZA 1T2FA 3EZNA 4IIBA 4UXJA 4QGGA 2QNRA 2EBUA 4FW9A 2Q0QA 2WT9A 5HQ3A 1W85A 3GY0A 4A8JB 1X7XB 1SAYA 2IWHA 4CM8A 4CJXA 1YQ9A 4DCGA 1WTAA 3KKPA 4RZXA 1E1YA 1PO7A 3NUZA 4B40A 2E37A 1AN9A 1O9BA 1WSWA 4DPLA 1O87A 1MQAA 2HA6A 2QVGA 3I2FA 3OC6A 4U4AA 9ATCA 1HZJA 5EESA 2B0JA 1W44A 1OYVA 3N8DA 2GD1O 4LE1A 4BMYA 2Q0XA 2WUFA 1FW8A 4HDKB 5EHIA 2K5UA 3HL0A 3L0ZA 4QSHA 1GG5A 4X6XA 1OH5A 5IT5A 1EINA 2CFRA 4JLSA 3PUIA 2QEQA 4MVYA 1F4PA 1IWPB 1ZEMA 4AY6A 3AF0A 3OIVA 3ZHZA 1U7ZA 1SY7A 4I4NA 3VJKA 2E82A 5AKZA 1N5IA 3U7HB 1Q11A 2FK7A 1Z4NA 2CJWB 2BTEA 2FX5A 3EFHA 2MJLA 2Z2KA 2CFTA 4OXXA 4BJ3A 5CYOA 2Z9BA 4AF6A 4M99A 3CINA 2C58A 3BMXA 1YFJA 1NPTO 2IGTA 4G8JA 4PR3A 3EYWA 4W99A 5LQAA 1H8EA 3ED1A 3EARA 3QTLA 5T4BA 3JQ9A 4KTTE 1E2DA 1EX6A 1FUUA 3NATA 4OVKA 4UHDA 1Z16A 3DFZA 4KQFA 2YZ7A 5EL0A 1CZNA 2A1IA 4UCFA 4NRDA 4EVQA 2Q8NA 3EFEA 1XTBA 1OIXA 1RYMA 1U6KA 1ZRSA 2XMQA 1CJSA 4R69A 5M3BA 1G20B 1LLUA 3JQ9C 5I7EA 2Z6UA 4D0LB 3OJOA 3LCCA 1JHVA 3N2NA 4QOJA 4L07A 3R7DA 1ARZA 2J7PA 2ZVQX 3BHJA 3LLVA 5HJ7A 4NWIA 2C7RA 1BDHA 1HWYA 4ZN6A 3LQQA 1RWOA 4TXHA 3B36A 3PZRA 3CMMA 4RZSA 2ZYVX 2NTYC 3C7TA 4HGZA 3S7ZA 1M2GA 2VTKA 3OJFA 4D99A 1OLXB 1T5HX 2Z9DA 4LZAA 3SZOA 1KP2A 3DEJA 3JARB 5JD3A 1GQSA 1BVHA 5F2KA 2J9ZB 3BWVA 1U3GA 5EJ8A 4U2BA 2A94A 2JGNA 1ZAKA 2PUWA 3IP6A 4OB8A 4UTPA 3EF1A 5EGNA 2E18A 4PBTA 5CAEA 1BS2A 2V65A 1SXJE 5EJIA 4DAEA 2HDWA 3H1EA 3UTCA 1OI7A 3T9FA 2NVUB 2O8NA 4TLEA 1PZEA 3EOAI 1N32B 3IX7A 4UVEA 2D2IA 5K4GA 2V7XA 1O2DA 1JZTA 4LY0A 4MHSA 4XCVA 4OXQA 1KZ6A 1NJFA 2HK7A 2H4JA 4JMLA 3IPLA 2RJ3A 2C29D 4B7ZA 2BUAA 5CMLA 3ZHYA 3TXYA 3USCS 2Q9UA 3GA5A 3OJEA 1NI4A 2DF8A 3S2EA 3IB6A 4KXXA 4HK4A 3V48A 1WSDA 4MUNA 1RRPA 3DAOA 4IH4A 1I80A 5G3ZA 1N6PA 3H3FA 2W6ZA 3I23A 1C4XA 3UJDA 3ZHXA 4BQFA 3LC7O 1YFLA 3L7DA 4X7BA 2F64A 3K0EA 3WYBA 4YALA 1Y3HA 3AY3A 5DSZA 4YT2A 1WDKA 3OPYB 5CDUA 3C4QA 4GX5A 2VUUA 2NXCA 4F4JA 3P9YA 2BGNA 1LTQA 1VMKA 1IPHA 4HX9A 1Q7BA 4HNAB 5AWFC 3LZ6A 5HDBB 3W2GA 1K8YB 3U4QB 2AUTA 4X1OA 4XA8A 4YRTA 3STXA 3DEYX 1KI7A 1NVXQ 1VL8A 1KSJA 4M37A 2E5LB 1QB8A 3GQVA 2Z6VA 1JQJC 2AV6A 4PIVA 4DS3A 2HSWA 3UN1A 2ZGVA 4DMHA 2WE8A 2ZEJA 3QEJA 2Z6AA 3L06A 1I0LA 4NC9A 2Y6VA 4FFBA 5HFJA 1PP4A 1SRQA 3RB8A 2R3SA 4CLRA 2Q2NA 3WGYA 1DQZA 3U16A 1Z4PX 4CLHA 2KHZA 3HBJA 1R4MB 2DAPA 1M0WA 2O52A 1B7GO 1T2NA 3OOEA 1QRTA 1RT9A 2VDNB 3HJBA 2WTEA 2LKCA 5K2MA 2WLTA 1OZFA 1QHHB 2OE2A 5B1SA 4OLHA 3PA6A 4I5EA 4BEJA 4WLNA 4DC9A 4LVCA 2HQSA 1UPBA 2Q3CA 4W5QA 3FZQA 2XJ4A 4G0MA 3V1MA 2Y71A 3OFJA 1YWGO 2NX2A 2NXEA 3D6NB 4KK4A 3SX4A 4ND3A 4D5GA 1CZKA 4C7MA 4MHTA 4F2WA 1DQSA 2UVDA 3FOZA 3DOIA 1TGVA 2PSHA 4NDZA 1NOJA 1YE3A 4WFKA 5I8PA 5B57C 2HX1A 1QO0A 1KAGA 3ANMA 4UNQA 2D1QA 3PQ6A 3QUQA 2B37A 4PHHA 3T7SA 3EMOA 2VN8A 1P1RA 1H22A 4ALLA 5L3QB 1YZGA 3Q5DA 4HUJA 2ZITA 2VJOA 5TMPA 2EAUA 2GTIA 2O2XA 4IHKA 4N8DA 3QIVA 3NIGB 3TSOA 4DR2B 4DTIA 2NU6A 4EG6A 3EA0A 1N5RA 4LI0A 3EWSA 4BZPA 2ODEA 1H0RA 1TTQB 4P1ZA 1MEOA 1Z8NA 5T4HA 3K2BA 4AC9A 2QTAA 3OZVA 2B8WA 1KY4A 1PJRA 1P1IA 1NBEA 5FYDA 3BYZA 1RWPA 5MFPA 4O4JB 5HJ5A 4BNDB 2FAXA 1E98A 2XADA 1CHNA 3CU5A 3B1YA 4G5XA 1Z4JA 4MS1A 4FFMA 2YTZA 3L6UA 4TTJA 5A7GA 1GGNA 1DT3A 1OYYA 1DOHA 1VL0A 2G28A 3OEHA 1USUA 3DMTA 1IVYA 3UHAA 4RA9A 4IGFA 4CTNA 3P26A 2Q3HA 1IVNA 1C9EA 4BJ6A 4E22A 1LLCA 3FDFA 3W2FA 3FUXA 3NWOA 3TOSA 3ZUPA 5HVNA 1W5AA 1FPMA 2HWYA 2P4SA 1NJ8A 1QDEA 3CVOA 5JLJA 4FONA 4FS8A 3DMTC 2PX2A 3OQIB 5TMEA 4F6CA 3O3OB 3QPBA 1JAHA 4Z51A 4WI1A 1NLUA 3SVZA 5DPMA 2YC2C 3H9CA 4OF4A 3AW8A 3M3HA 2PUJA 5ER6A 1ZXBA 221PA 1BAPA 4XFKA 2O0KA 5EXXA 4AO6A 2RK3A 3ZDBA 3EIHA 1NW6A 3OSUA 4ZOLF 2ZJ8A 2YJ3A 5EKDA 2KWIA 3QX7A 4KQWA 1ST2A 4WXEA 1E18A 2FB9A 3DT9A 4DTCA 1V25A 2AS0A 2C2MA 3R5XA 3SMVA 4YMGA 1EMDA 1FF9A 2AZMA 1M34A 1WSBA 3DBIA 4LYFA 2V96A 3LVRE 2P79A 3QKSA 4Q1CA 4XX0B 3EJWA 4HJRA 4HGNA 2DBVO 5H9WA 3O93A 5IM4F 2G08A 4OAOA 3T54A 2I1WA 3MOSA 3RBVA 3L6DA 4FS3A 2GHQA 5UKDA 5HDQA 4UQPA 5HQTA 3KQSA 3WK9A 3M6MD 4LMPA 2FW7A 2G71A 3ENQA 1IOLA 4MH0R 3RRJA 1DJNA 5HQJA 1Y9ZA 2HR1A 2WTBA 121PA 3UWKA 1NT4A 4A73A 4Y6QA 3GJZA 2XWBF 1NUHA 3QGMA 2NV6A 2E9SA 3SFZA 3SQMA 1TVEA 1U7PA 1G5TA 2PXCA 4P8RA 1E2MA 2AEFA 4YAEA 4P31A 3ONVA 4YRMA 3I9KA 4LV6A 1MD9A 3DEAA 3GLHB 1A7UA 1G8KA 3FGNA 1JR2A 4W9NC 4ZO4A 2HXSA 4QYIA 2Q29A 3UT5A 3CVUA 4GKVA 3IUQA 2F43B 1H69A 1KARA 3LPAA 5C7IO 1W30A 5AVJA 3VPFA 2P41A 2H00A 4TLDA 4XSHA 3T34A 1J97A 3AO0B 4XVRA 2NUTA 3Q3EA 1SVLA 3KWLA 1XDZA 1NPYA 2GILA 1QH1A 3BMOA 4WNAA 3SJZA 4D1YA 1UBLS 1DOZA 1Z4MA 1GVNB 2QN3A 5C1OA 4LF8B 5JV5A 1P2GA 1T0PA 4RMHA 2BONA 3PNYA 3EC7A 3QF4B 4TROA 2EFHB 2HOQA 1XHEA 4RVHA 4YAGA 1X7WA 3OE7A 4DY6A 3FTFA 3RE1A 3ZW8A 3QQ5A 2A5DA 2EX0A 5C7LO 3DE1X 1AS3A 3SF8A 1A9XA 5MGNA 2EWVA 4D46A 3SKVA 3X1ZA 5IVIA 5AKJA 2QV7A 3REQB 4HBZA 1FUYB 2B8TA 1OVMA 5BOSA 3OQVA 4Y9UA 4HLQB 3K6JA 3EW7A 1N8NA 2HMUA 5E9AA 4L1KA 1CDDA 4MV5A 2AG8A 4M8IA 3NEYA 2WJGA 2CL7X 5EJ9A 3P0JA 1YB5A 3SSOA 2R5FA 4WDRA 5FTKA 1KPHA 1UMKA 3UFBA 4QXAA 3FCAA 1VSQA 1Y1KE 4Y9TA 3QA3E 3HVHA 3KYCB 2C7BA 2XMBA 1SVNA 1XCLA 5J4HA 1UOQA 1PVOA 5HEKA 1ILEA 3C6MA 1U1DA 1H05A 3G02A 4ID3A 4YJGA 3CJRA 4RTQA 5C5IA 1L5ZA 3OECA 4UVHA 3O1JC 2E0IA 3D0QA 4EY4A 3EEIA 4N7JA 1KEWA 2C4KA 3ZKWB 1I6LA 4CDMA 5IJ9A 3ZV6A 4LG1A 4BUCA 3PJRA 1T9DA 3C6KA 1YZ3A 2G09A 1G16A 2NO5A 3PE4A 2XV1A 4DG8A 1N36B 1K6EA 1V6CA 5JJ5A 1R3DA 5JVDA 2IXEA 1L4HA 2ADMA 1CY4A 1VL6A 4DLYA 4JI4B 3KVRA 1JXAA 2J9YB 4PAQA 1A8SA 2LDXA 3ELWA 4GBGA 3JXEA 4DILA 1CG6A 4XYLA 5GM1A 3K73O 5AIAA 3GFFA 4HGYA 1JSLA 3L7MA 5ALGA 5IKMA 4F86A 1KEPA 1RMQA 3T12A 3PD0A 2JIRA 2C96A 1KL7A 1JZQA 3K2IA 2XMGA 1PZMA 1YRQA 3C5EA 3DPSA 4MPRA 3PQ3A 4OHZA 3UJHA 4A8TA 3ADCA 3TQTA 2F8MA 3ZKAA 1XTTA 2AN9A 1M8GA 4FZJA 2G83A 4DDKA 2ZRJA 4ENTA 4F92B 1LC3A 2GA8A 2XLBA 1A5AB 2V5VA 2ZYSA 3MJFA 4TZ0A 1Q74A 5B37A 2F1RA 4LC9A 4YV0A 3TECE 3OJWA 3HKDA 3V2HA 3WAGA 1Y1LA 3QU9A 4ZV7A 1K7XB 3N5CA 4JDPA 4N01A 5H82A 4LOJA 1WBJB 3CZPA 4RPJA 2I4NA 1IN6A 4MPPA 5EKTA 3RANA 2C5LA 3NIFB 4OCZA 2CDBA 2Q2QA 3IKMB 5JMPA 1ABEA 1B0AA 3K16A 3STWA 2DKNA 2BGRA 5CEFA 1C4OA 1M73E 1Z0UA 3F7TA 3CLRC 4GKBA 1FMCA 1P39A 3WWEA 4GEKA 2JLRA 3ND7A 5HK8A 4F60A 1TYAE 5FUWA 5K9ZA 3OKAA 1DXHA 1GL3A 2IA5A 3PP8A 1II9A 4ZAFA 4BHTA 4BFVA 1EIWA 1HURA 3RU7A 3B1XA 4YROA 4O4IA 4V24A 1IMJA 4E08A 6AT1A 4OKIA 4KUHA 2O2CA 3VH1A 3A2LA 5EXCA 1G3QA 4JDUA 1L5VA 3AESA 4KQJA 1CJTC 4LJAA 3CMCO 5DM1A 4BO8A 2FZKA 3FPHA 5DBIA 2FI1A 3T3MB 1OX6A 4AYXA 5GM2A 5KQRA 2OP1A 1O97D 1U98A 3TIGA 1EWRA 5I9LA 1PQPA 4F56A 2WMYA 2Q27A 1SVIA 4JITA 4QBGB 3A4LA 5ALDA 2HHHB 4CLOB 1K9SA 4HDRA 3ZDEA 5A5VA 2MCFA 1G8PA 2OORA 1C7ZA 3AJDA 5EWLA 4A82A 3CVVA 3GQBB 3DAGA 3FYCA 5CT5A 5HF9A 4ZK2A 4WZ6A 2J8ZA 1E0DA 3CURA 2CN1A 2JI4A 3OQJA 1TMGE 2YWFA 1U8TA 4XI9A 5EHQA 1F2TB 1MENA 1VYVA 4L0QA 1Y63A 2OORC 1KEKA 4I1PA 4QJBA 2PRZA 2Q4OA 3DHVA 4E3ZA 4D42A 5TPWB 2R6GA 2B35A 3FFXA 1DTWA 3ZZ1A 3TQFA 2OLEA 2CE7A 1OGIA 3QSGA 1HOXA 2CK3D 2QG9A 3N86A 5HZMA 5CIQA 3X1XA 4XCXA 4EELA 5BXYA 1EFVB 2ZWIA 2O2IA 4RQTA 4MULA 4ISCA 1BX1A 2XCLA 1Q15A 4EHAA 2HTEA 3M6FA 2GQ0A 5E0OA 2E4AA 1ZN9A 5EIHA 2NIPA 3KSDO 2H2DA 4MWSA 4DVJA 3RREA 4B2LA 4DM4A 4CQMB 3FN4A 4R0NA 4YJ3B 3PKJA 1SQ0A 2Q6OA 1L0BA 1D4FA 2NZWA 2UYQA 2X4DA 2B98A 3PEFA 4LYAA 1R3UA 4Q7JB 4YJ2B 4CG2A 5KSOA 3RGWS 2XPCA 3DLIA 3CFIA 5IUKC 4FBLA 4TYWA 1R10A 1J33A 1JAXA 2DHEA 2H8KA 4IUYA 4YV7A 1SVKA 1UM9B 3NTOA 2VI5A 4DMCA 2XVAA 3SE0A 3EASA 4UKDA 2W2LA 4W7IA 4CV2A 4R9UC 4D9GA 4MVJM 4Z6KA 3EMVA 5G40A 4F8YA 3K0AA 4UPEA 2IT1A 3PJFA 1DXOA 1DTSA 2AUMA 1C14A 3TZLA 2F17A 1ZD8A 3WKBA 5B7GA 4CM1A 4BVAA 3MT7A 3KQWA 2CNLA 2ZIUB 4J75A 2VDOB 1SC6A 2P3QA 3EA4A 2ZI3A 4NBTA 4EVSA 2WJ6A 4MCHA 2CHEA 3I1YA 4BMOB 1FEZA 1CEQA 1VG9B 3HKCA 1GRCA 2ZZNA 2R66A 5EJ7A 3OWXA 5EEGA 4NIMA 2LCFA 2Q5HA 1ZI9A 1U1FA 2HPZA 1GTG1 5EZ6B 1R0WA 1CK4A 3BOSA 1YA8A 4YMVA 2OVFA 3NDBB 3I62A 4QT0A 1I4DD 3WMGA 5MF6A 1HDEA 5EINA 3FE2A 4RUKA 4BV2A 2CVOA 4H60A 2FZEA 4ZT7A 7REQA 2Z4TA 4JUAA 1MJHA 4MWDA 5DN6D 2MSCB 1WP9A 5JJLA 1DARA 5IHXA 5HF6A 1V8OA 3IULA 4ZKEA 1VXOA 4R83A 4NZMA 5BSGA 1E0KA 1LS6A 1UQUA 1JF8A 1R0KA 4EIWA 4AIIA 4RIIA 4IIJF 4G4JA 1NJGA 1SD2A 3QY9A 2WVGA 5DNYB 4JOBA 4LF6B 5JU6A 3EGDB 5G4LA 3NHZA 1W2HA 2O7RA 2RC6A 1XMVA 5T6MA 3SJCA 3SYNA 5LP6B 1N5OX 4L15A 1USKA 2EJUA 1VHWA 3HA7A 2M6KA 3INRA 3AY6A 4U7GA 2ISSD 3DW1X 2VYNA 3OTQA 4NYJQ 1RJEA 2NZ2A 1Y8QB 2OBNA 3HFGA 3S6JA 3VPHA 4E21A 3SXUA 4D8YA 1FS4A 2W2XA 3AR7A 2W6OA 1G55A 1QLHA 1A2OA 2YWRA 4CMCA 4ZYYA 1Y9EA 2OHGA 2PWBA 3NM6B 3AG5A 3M33A 2P7HA 3DXYA 2DPXA 5ESWA 5GIOE 4OX9B 1U31A 5H02A 1BXGA 3EVZA 3HO6A 2YFQA 3OCXA 2A0UA 1E2IA 3JWEA 3LPNA 3WISA 4D9CA 2D8AA 1ZUHA 1KZYC 4G2NA 4INPA 2W83A 3D6VA 1L7NA 1YJ5A 2ZSHA 4IOKA 2XWQA 3A6FA 3E9RA 1ZUWA 5MN5A 1ORHA 5FR2A 4OHPA 4DCPA 3GJQA 5A71A 1O6FA 3B8EA 1O3YA 1E1MA 3LK7A 5GV7A 1H2FA 3A9RA 2AFHE 2FGJA 2H0AA 4CHTA 2YZGA 3HCAA 2IUFA 4HYQA 5TT0A 4HPWA 2ZWOA 3Q8MA 2AFIB 3KSAC 4R1OA 4EDFA 1UP6A 2Z5VA 3QHPA 5FA5A 4KOAA 3CTPA 3LOUA 4EUKA 2XA2A 4Y2HA 5ILOA 2ZI7A 3G0IA 4H1TA 3JD1A 1DKLA 2Z0MA 3PTLA 3G2LA 4GPTA 1OFIA 2QTLA 5EG5A 1HE2A 1H2BA 2OHOA 4GBED 3F5FA 1G2OA 3ETJA 2PVCA 3HTXA 4DMMA 4G0ZA 3ZHQA 2B1IA 2DWQA 3OMLA 4KLZA 1CXZA 1KXZA 2C1XA 2I4RA 2KQUA 3HKEB 1JR3E 3FLBA 2BCGY 4GQIA 2BE7A 4OHMA 5AJVB 4YP6A 4ZI3A 3TTYA 2TSYB 3FSRA 1P3Y1 1WCYA 2XMSA 2PSEA 3GVCA 4MTLA 3UATA 5DNDA 2HDOA 3GBSA 4PSDA 5ELMA 4ZOQI 4FHEA 4JEMA 3TJMA 1T9GR 3M5CA 3ULKA 3HCEA 1PK7A 3GXOA 2R87A 5ALHA 3RVOA 2I76A 5T57A 1MP0A 4CL0A 1Z26A 3B2NA 3D4IA 3A4TA 4BCCA 1GADO 3HN6A 2GB4A 3IE0A 1QQ5A 1FDWA 2R44A 3PL5A 4OHXA 1QHGA 3BN3A 1E2QA 2XTNA 2G77B 4JU9A 1OPXA 2NXWA 3ONNA 1MV8A 4Q9IA 3CUYA 3I42A 2P90A 3K5HA 4FFOA 4PCVA 3WNVA 2NP7A 1A5SB 4JJZA 4U39A 5I6DA 1EVKA 2D3TA 1R0XA 1KYYA 3L0CA 4RPCA 1TUBA 4O4LB 2JAWA 1TAGA 1YACA 1IEQA 4PYLA 1VZ2A 3JYOA 4K81B 3LIIA 1VTKA 1J8YF 4DSNA 1BVRA 3GH3A 1U9CA 2HCRA 2CC2A 2BGJA 2WFAA 4L0CA 8AT1A 1KK0A 2QLNA 5K0LA 1BNCA 4A92A 1MHPA 1LBTA 3H4MA 4BO2A 4BNHA 5CNMA 2BBWA 5EMNA 1W2WB 4C5AA 2I6FA 2QG4A 2Z4RA 4UVIA 3JQBA 1U63A 3M0EA 2AJLI 3AI3A 4MVJF 4Q7LA 1ZK0A 2ZBPA 5JR3A 2IKQA 1UUFA 2CZGA 3QG1A 5DH9A 1SBZA 1VMIA 1AU9A 1N5KA 2YC4C 1T6XA 3E8XA 4LISA 4R2KA 4R1LA 4ZGWA 4YAFA 4WK4B 1QJCA 2W2TA 1SXJB 4TWZA 1TF2A 4IX1A 2B2CA 2BBOA 3JQBC 1PS9A 1OVGA 4G1FA 4O4JF 4TS4A 3AVYA 2GHIA 4HN2A 3IQFA 1TVMA 2JEYA 5LMUB 5LLDA 1CZLA 2C92A 2R1ZA 3HXKA 3IDAA 2O7VA 2OV1A 4L22A 4AZ3A 1YJAA 4CE6A 4YMUA 5K6RA 4WIAA 3VSBA 2B4RO 1DO2A 1YBVA 4RC9A 1UEIA 2VSQA 2A9KA 3CX3A 5BVHB 5C2JB 5C8VA 4KBFA 3BS4A 3AF5A 4YRIA 2RGYA 5CHEA 3ILHA 3SHOA 1DX9A 4P9NA 2VK2A 1VYTA 2MINB 1Q84A 1U99A 1Z5GA 2F3TA 4JLVA 4MKRA 1XZQA 2OGZA 4MW1A 2OG1A 4O1HA 4NMMA 4CKEA 2O6HA 1YMVA 3MUFA 4QJ3A 3ZIAA 1PL0A 2OKGA 2P1RA 4KPUB 3ZHSA 1F9EA 4A0QA 5L7YA 3DDUA 2RHDA 4Q1EA 3H2HA 3HFJA 3MS4A 2I66A 2OCDA 3GR6A 3HUTA 4TWRA 4YMSA 3WZ2A 1W87A 3KDPA 4M88A 3BBPA 3PGMA 1UK9A 4EPYA 2QD3A 3WG9A 4OK6A 3ACCA 3NTLA 2YFYA 4EKDA 5K7SA 2V58A 2IDKA 5B3AA 1KQGA 2NT3A 3GZTB 3QE9Y 2C9BA 1BGWA 1XZIA 3SFVA 5AI4A 3FCXA 5ALYA 5HIKA 3QXHA 4FC6A 2ECFA 3EPKA 2UXDB 2YNMD 4ZIRA 4NYJR 1E9EA 1V5IA 4U0JA 1ZBQA 3H2KA 3STYA 4KNYA 4YACA 3S2GA 421PA 4DMKA 3NHKA 4TV9A 4BO3A 1LDYA 3CW8X 5KOJB 4WCFB 4IIEA 4CV1A 1X38A 4IUDS 2O5VA 3U7EB 2RAFA 3JQFA 5DTEA 1Y6GA 4AQDA 1X80A 3L8HA 3MTIA 3BC1A 4TSRA 1IM5A 4NZOA 3WHKA 4YUYA 1VA4A 2K7ZA 5TC4A 1W1WA 1UIRA 1EGVB 3H16A 3TEMA 3CR3C 1OAOA 1JVBA 3A37A 1RTTA 1KZHA 1XMPA 3LDUA 4P2BA 2D5BA 1OXUA 2WICA 4F6LA 3AVUA 1YFZA 3B70A 5COQA 4KQIA 1JDPA 3RFUA 3GEPA 3KO8A 1PQWA 2I55A 3I5AA 3VU9A 4BRUA 3B2QA 1OAOC 1Q7CA 2AYZA 3H4VA 1XU9A 3Q5GA 4GWKA 5CNKA 4OIFA 3CB2A 3IUMA 5H3CA 3WDLA 3DOCA 5I47A 4AX4A 2QNIA 1OBCA 3DKVA 3RU3A 5IYZA 3OIFA 3RIXA 1YCFA 2AWNA 1U5BB 4OA5A 1Z6ZA 3RPEA 5JAHA 2NMVA 1TYBE 3OZDA 4CM4B 1S2GA 4Z49A 4KXVA 3DLTA 5ERXA 16PKA 1JHQA 1Z5NA 4JBNA 4AYTA 3ZV3A 2JGEA 3H2SA 1P2DA 3QW2A 4PXYA 4C06A 3CG4A 2G67A 2HPVA 1NULA 1DIBA 4KFSA 4RF5A 5KTSA 5HCIA 4K2HA 3OWHA 3ZGNA 2QY9A 4KVGA 3THRA 1K3UB 3U56A 3I5UA 4JOQA 3VV2A 1WXIA 3I45A 4QLOA 1H3FA 1YR9A 4CIBA 2IYFA 3K3PA 1X7ZB 5CDFA 4OQEA 5DYNA 1NA5A 1BCSB 3WYGA 1TM4E 3LZDA 3KYIB 1QRDA 1IUOA 2BUCA 2ABWA 4ZD6A 4F38A 5KHLB 1J22A 1E6LA 3IAS6 2ZOSA 1W36D 2HRCA 1QCYA 4KJZA 2ZYUX 1X92A 3E61A 2GR8A 3PVZA 2Y4OA 1DC6A 3VR3D 1LGYA 1SVSA 5J4YA 3L7JA 1GJRA 2BPOA 1PT6A 1J24A 2EZUA 2HD4A 2CDNA 4R41A 3IV7A 4MQFA 1DKPA 4QGAA 2EKZA 4HB2A 2WWRA 4MWCA 1REQB 3MWDA 2H3EA 4MI3A 1Z63A 3E9DA 1DIHA 2WWTA 3AZQA 3QVXA 5IXJA 3LKZA 1ZINA 2CL0X 2CUZA 3CNEA 3C85A 3MMNA 1HUQA 1FNSA 3N9IA 4UM5A 3U19A 3A6PC 4ZYZA 1HC7A 4AURA 1IVSA 1N92A 5ALUA 2PT6A 2ONJA 3OIWA 2EWWA 3Q72A 3EODA 1Y8AA 3IHTA 4JJFA 1UMBA 4MVJH 5EJMA 3R5JA 1XNHA 1E77A 3KM0A 4WGGA 4KFRA 2YBEA 1Z62A 3DKIA 3TI9A 4BEWA 2BFEA 1YL6A 3IT0A 4DCMA 4PANA 3EQZA 1NU6A 4DSAA 1T4BA 3FHCB 4FMDB 3VOAA 1UT8A 2UXCB 4ENUA 1C9DB 3BCSA 1XDGA 2C78A 1D0SA 4DV4B 1K66A 4DJDC 2WHPB 4O25A 1KI3A 1P61B 5DWVA 5K99A 3RHFA 2RE8A 2DHCA 1HQYE 3WGTA 1L8XA 3ROTA 5ADUS 5I7FA 1Q0RA 1SZDA 2ZZKA 3NBAA 2A5FA 4C7XA 1PBNA 4BHRA 2XQGA 4RJLA 4AVYA 1FQWA 3HVJA 3R0IA 3WGOA 4AN4A 4J4BA 1WEHA 4LXQA 5CVTA 1UF9A 1M83A 3LJKA 4XJTA 3SLKA 2A1UA 1Y4DE 3T35A 5E3HA 4E1BA 4FB4A 5KYYA 1IZZA 2FN9A 3HYTA 3COJA 2VQFB 3N2IA 1EB8A 5CFQA 1E2LA 3U5ZB 1IQUA 1CKEA 1HA3A 1ZVJA 4R16A 4ZAXA 3UY4A 1KGSA 5JOQA 1TO6A 1CIJA 3K15A 1I4OA 4HRYA 2Q3JA 2GM9A 4RA6A 1YV9A 1DLIA 5KX5B 1OH6A 5B12A 3W3AA 3NTUA 3T4XA 1P5FA 4I4IA 4W5WA 4U3JA 5LUBA 5L3VA 1E66A 4U02A 4LSGA 4ZO7A 3D3JA 2HXYA 3SFTA 4YUAA 1XD9A 1R0RE 4HMPA 2Y77A 4R1UA 2WSMA 3RAGA 4HNTA 4PN7A 1WCWA 3L40A 4H16A 1CUDA 3KTAA 1SUIA 4I1RA 4HVTA 2JATA 4MIEA 4P3PA 4C4YA 4GXTA 5AXCA 2IYTA 5FULA 4MQ5A 1NGSA 3TIXB 1YHNA 4RVUA 2YHIA 1K63A 3T8YA 1U94A 1BDIA 1ZK3A 2ROQA 1GQQA 1XF9A 2QQ5A 4HUQA 3GZNA 1LQTA 4II3A 4DANA 3HM9A 3ZJUA 4MV8A 3BWCA 3RYFA 5HTOA 2VLBA 3P2OA 4AXXA 3HHEA 3NYWA 3ZVLA 1V5GA 4BC1A 5A5DA 3VNSA 1NG1A 1FMTA 2IOHA 3LC0A 4XGNA 5CVVA 3HXQA 4XIYA 1EUYA 4G86A 2W58A 1RKVA 2ZTLA 3D6JA 2MU1A 4TRRA 2JA1A 3E3LA 2BFFB 4FNOA 4RCYA 3L3BA 4KYUA 1RZRA 2ZVDA 2PXXA 4GECA 1DIRA 5U1PA 4HFNA 4LCJA 4ZZ1A 2VYCA 3R3XA 4EFKA 2CHQA 2R6JA 4KMRA 3NC0C 2EDCA 2WJ4A 4I5GA 4YP5A 3D1JA 4YFYA 1I7PA 3TPZA 3TRIA 3Q6NA 4GMXA 4QPZA 1X87A 4M9XA 2QLBA 2QXTA 2Q9BA 1JJ7A 1S9HA 1PS8A 2J5BA 4GR5A 1UXOA 2QN2A 2ZT5A 4YXWA 4RS4A 3TLKA 3U7QA 5FJIA 1SUBA 1W4RA 4BV3A 1XZPA 1M8JA 1J0AA 4YJ3F 4G0WA 3UGTA 1GT91 2JBWA 3L0OA 3T61A 3ZX4A 3JVEA 1ESMA 4YJ2F 1X1BA 4LNAA 5ADWA 5H16A 1JJAA 2I7DA 2IY9A 2ZG6A 3RYIA 3DVQX 5TQJA 2IHNA 4BFLA 4J0DA 2VXCA 3WWCA 4X1YA 5A6SB 2PX6A 1E9BA 4G0PA 4YI5A 2IQIA 3WLQA 4YUVA 1HTTA 3K0CA 4PM4A 1TYDE 5J2TB 2FJUA 2XKBA 3NHMA 1GQYA 4XZ3A 1JGTA 1CY8A 1YBHA 3PNMA 4IS3A 4LRSB 5LYJB 1RRMA 3G5MA 4GLOA 5AI6A 3M9XA 3D6TB 3HRIA 4DHWA 3IIEA 1KAHA 1STOA 4HYTA 4N39A 3VPGA 3O1LA 3H04A 3O9ZA 4AKTA 5AR1A 2W98A 3U3MA 3GJRA 1HZZA 2ZSEA 3BCHA 3AR5A 1V2HE 3IEUA 1IHDA 4WV3A 4B44A 3CFFL 2OMKA 1BQ4A 2H7CA 2BP7A 2W4QA 4OI4A 1QANA 5EMHA 4AJ1A 4I46A 4N4AA 4BIMA 2Q45A 3BULA 2YQ4A 3G5LA 2JARA 2PRYA 2ZJ5A 3KEMA 3O0TA 2YQZA 4FFVA 2KBEA 1HZZC 3PVCA 4MYSA 4Y9SA 3EEOA 1M2VA 3FLMA 2H6EA 3WX0A 2PWZA 1ECLA 2Z08A 3A14A 1L4YA 3BFKA 4MCAA 4OJQA 3TNYA 3W6NA 4EHNA 1GNRA 4GT1A 4OMDA 3S1LA 3LCMA 5EIEA 2G70A 1ZESA 2ZPAA 4ZOBA 3EBOA 4BB0A 1V1MB 2BKUA 3TGLA 2FE1A 1CUYA 4JBWA 5DHSA 2J1LA 4EZIA 3BICA 3JWGA 4TZ6A 5LP6F 1ZS9A 2ATVA 1XX6A 2X0NA 4IV5A 4QE3A 3WY9A 2KLHA 3N0XA 4KSYA 1BMDA 1JDTA 1PJBA 1Y98A 1T0JB 1XZEA 1PW7A 3NEJA 3QOXA 4GBMA 1X1DA 3I72A 4IIVA 3LQ2A 3IEXA 3MTGA 5KHOC 4Y6OA 5A3SA 1FTSA 3F5MA 4O2LA 3OPNA 3OZWA 3RVQA 1NNUA 5FWAA 2JLCA 1ADCA 4ZREA 1P1CA 4CDNA 4PYIA 3MHTA 1CPYA 1SVMA 3AV0B 3BT7A 3LF4A 1UADA 5LQMA 1I4TD 1Y33E 4C14A 1WU7A 2VZEA 2RSLA 1L5QA 4GKKB 4KRFA 5LU8A 3H86A 5KJ6A 2WP0A 2IGBA 4H18A 2ZYGA 1Y8RB 3Q6IA 2GO1A 1XJQA 1MJNA 1Z8HA 1KDVA 3VAYA 1XZHA 3AJ9A 2HSJA 3LUBA 4F5WA 1QP7A 1FFXB 1MOQA 3OE7D 3O38A 2ZREA 4M76B 1S8NA 3M49A 1E3WA 2V1UA 4D9EA 1UWCA 1E7QA 1SZPA 1XQVA 4RD0A 4DUGA 4N8SA 1TU3A 3BXOA 2ZULA 5JXWA 4WERA 1BFDA 1OJ7A 3WS7A 3B78A 2HIMA 4OQFA 3CONA 1GNSA 4RAOA 5E7JA 3D4BA 4R2XA 4OXKA 1RLTA 4G0YA 5E1DA 1MW9X 1PV1A 4ZC8A 4D74A 2Z83A 4TQAA 4BLRA 5LZ2A 3CNLA 4V0LA 3TTUA 3BHIA 3GLGE 1J07A 3GRAA 5GJCA 3OM8A 5LKAA 1MPTA 1QOQB 1Z4OA 4W8GA 3C5VA 1GPMA 1I14A 2C9ZA 2CF5A 2YJZA 3WLHA 2QL7A 4F8EA 1JRLA 2CWWA 2X5XA 5C34B 1MW8X 4O02B 1SA0B 4OLAA 4DWWA 4HH1A 4OQLA 3M3PA 2PKXA 3STHA 1E2JA 4RD6A 4RHUA 1E4EB 1Z38A 2E89A 2HEGA 3UAYA 5A4JA 3ON5A 1RACA 3RHSA 2WT8A 4YAWA 2HNBA 3A3PA 2VP2A 3RRMA 3IHKA 5KI6A 1IY2A 2QV0A 3CNQS 3OVMA 1M1ZA 4UC0A 4DIBA 3R5KA 4JI2B 3NQ41 4YAJA 4ZO9A 1YVEI 5EUBA 2CMHA 2FW8A 1XDWA 1G64A 5LSAA 2UZIR 1J2JA 3NWBA 4MWZA 1P7CA 1C0KA 3LS2A 3P0IA 5D3ZA 2BZSA 2EF1A 1MBZA 2PDAA 3TPCA 4KR0A 1IC6A 3AONB 3M82A 3BWDD 1MX9A 1CUGA 1X9IA 4EI9A 4B6PA 2HA2A 2ZR8A 1UBOS 3V1UA 4M1MA 4O4LF 3F6RA 3BF8A 2V74B 3BK1A 3DZBA 3JATB 3HQ4O 1N0WA 4L72A 1JWAB 2IYWA 1RRFA 2A14A 2OYSA 2NO4A 2YY5A 3L0IB 3OZCA 2X7JA 3FA2A 4N03A 4OREX 1C9JA 3UOAB 1TLFA 3EDYA 4ZEOA 5FOUA 4CM6A 5JH7B 4FEGA 4YA6A 1PJLA 4TT3A 5FPHA 3HDYA 2GF2A 3PEYA 2EGUA 2O4UX 1O03A 2QY6A 2RI0A 3KJXA 1VYUA 3X44A 3TLAA 3CVXA 1ZK1A 3AR2A 2ZIZA 1E32A 1PT5A 3EH2A 4WKNA 3AXSA 2GASA 5JXIA 1Y7TA 4XWKA 1OAKA 1KKLA 2R47A 2VPWA 3AEYA 3ISVA 3Q0IA 3ZVRA 1L7VC 4DNQA 5AVUA 2BI8A 1XD2B 4KR9A 3QI2A 3QVKA 1DAEA 2GJAA 3K5WA 1O4VA 1K8ZB 1SCUB 2IIBA 2JAOA 3CZ5A 4YRCA 3ZGYA 3DKRA 4JJIA 3EGXB 4IH1A 5AM0A 3ZYZA 4JB3A 2VJAA 4Y2UA 4B5LA 5JAPA 5AKGA 5KWIA 1TZMA 2FMHA 2WILA 2C2WA 3QMPA 4IXJA 3UH0A 4DLRA 4P82A 4DMLA 2JCYA 3QVTA 4RULA 3HVUA 1WE2A 4GQBA 1EE9A 2Q2OA 1AMUA 3FCCA 3H9BA 2RJOA 1JYSA 3AEQB 3PA8A 4GX0A 4Q4DA 3T3DA 3HA3A 4UBMA 2AG5A 1XXHE 3DPIA 4ZVSA 4ETIA 2AFHB 2JJYA 4F9TA 4X1KA 4MOWA 1GLNA 4Y2QA 5DGTA 4FW8A 2ID8A 2P69A 4E70A 1T4MA 4H7IA 5DCYA 3QV1A 4GYKA 1O5TA 3SXPA 1KJIA 1C3OA 1HXHA 2AF3C 4BU0A 1Z15A 3MJHA 4KRYA 4X85A 1MIOA 5DLDA 2XKAA 2C9DA 3FPEA 3OX1A 4KDCA 4M9RA 4FLEA 3ADDA 2A7XA 5JZOA 4KNVA 2WPDA 4LECA 2G1AA 4RH0A 4MP8A 3EDOA 4ZCMA 4DE5A 5AKLA 3HLYA 2FEMA 1KRHA 2NU7B 1C7QA 2WHYA 2AHRA 3FVVA 4WNCA 3VSAA 5HKOA 2ZJYA 2GD0A 2IXGA 2VTDA 3L8GA 4ZQIA 1RM4A 2HF7A 1RXIA 1TRKA 4K6HA 3T7IA 3VNAA 5D51S 5LM3A 3DBVO 2C0QA 5JAZA 3O1IC 4NL4H 4K3UA 1CR1A 4WXPA 5I9SA 4I2NA 5CX1B 2PRIA 5DBOA 4UEQA 1NZJA 2DH5A 3WSWA 3ZW7A 4C2UA 4GRIA 4PZUA 3V4FA 4WHMA 4ER6A 1PTJA 4BKMA 2AW3A 5BSFA 3GLKA 1G3RA 3JAWA 5BYAA 4L8GA 4IKPA 3KG2A 4KX3A 3UOGA 3INTA 4YCCA 1KSFX 2EOAA 5KWVA 3EG9B 3PNPA 2RI6A 2XNKA 5DGDA 4G56A 2DY1A 4TV8B 2BH9A 2A7QA 4PGGA 3ODGA 2BH2A 4CRWB 1CQPA 1S2IA 2DBZA 3N7AA 4ND5A 1RWQA 3TVDA 3QUTA 2JGMA 4B2YA 1C4WA 2Q6TA 3NBFA 3PRKE 1QE0A 3WO1A 3FDIA 1OT3A 3FDXA 5G0WA 4ZCRA 1LNSA 1PR9A 2OGFA 3L8DA 5F64A 3R7AA 2G5PA 3BIFA 2NQTA 2W2LD 2VKQA 4IUBS 4M87A 4OYLA 5DLQC 5KTMA 5DYTA 3UBMA 2PLWA 4BJ1A 2GSDA 1Y7PA 1FBNA 1NDHA 3O7MA 4L7VA 5K0JA 2BFNA 4B80A 1TJYA 1XEWX 3WLSA 1F1JA 5KQPA 2FPXA 1DC7A 1SURA 4PPQA 2FWPA 4DUPA 4MQBA 4RDIA 5LQJA 4Q48A 4QPJC 5DM4A 1VBNA 5HW0A 2JCGA 3R9KA 4L28A 1Z5UA 1KP9A 2GFHA 5LJIA 1AURA 2XUDA 3JAKA 5FPSA 1GZ3A 4NCAA 1NBOA 2AMJA 3B9RA 3EMKA 5GP1A 5AJUA 4BQQA 1Q20A 1WJGA 5JCZA 2QN9A 2EFJA 3KT6A 1ADJA 5CVUA 1PYDA 1U0OC 1W6UA 1Y81A 2VBFA 2XNDD 4JQYA 5JRZA 1GPUA 1NPDA 5HIIA 4ZDJA 3V55A 4N3CA 3L6BA 1UKBA 1V3QE 1Q14A 2RH9B 3R44A 1C0IA 2B9EA 3TD6A 3RYCA 2ZR7A 1NNEA 1XB2A 2EJWA 4QKQA 2GN1A 1FS6A 2IYXA 1JX6A 2LV8A 1PFYA 4PAOA 4WZZA 1UM8A 3VO1A 4C21A 5IZCA 2JBAB 4C3OB 1MC5A 1RMTA 2GYWA 5EQDA 4C20A 1YCGA 1GAEO 4LJYA 2CGEA 1AKWA 2CMGA 3VTZA 2DZDA 2I0FA 1V71A 2QPAA 4KCGA 1PGNA 2ZYRA 3OD5A 5DCWA 1ULHA 2VYND 4LJLA 5H5JA 1V6SA 3O8BA 1YQDA 2QVXX 1GQ2A 3UAWA 2XWPA 3HBLA 3KU1A 3QE2A 2QX8A 1A98A 3U44B 3O3NB 1IM2A 2HLHA 5F9HA 1C7JA 1JT2A 2R7AA 5EXSA 2QQEA 4P4NA 2QAGA 3IPYA 3SQNA 2YWHA 3EY9A 4Q03A 2XB9A 3LYLA 3NJ8A 1FXWF 3VI3B 3VNBA 2PZMA 1RBQA 2PX4A 5CB6A 3ZCXA 3HS3A 3JX9A 3QKIA 5LBTA 1K88A 1ZCJA 1ZX1A 3S5JA 2Z04A 1AJEA 2CDRA 4X1IA 1KSGA 2X23A 3HE3A 3VI4B 1KZ9A 2XD9A 3JQQA 2QAGC 2QRNA 3OQHA 3FKJA 4FMDF 4ARZB 1X42A 5AW6A 1T6YA 1G5HA 4KDEA 4XQ0A 3RYTC 5C1PA 5IPFA 5MN6A 1N1EA 1AKEA 3MFQA 2K2QB 4D9BA 3PI6A 4OSPA 3L1KA 4W5OA 2XVMA 1JIJA 2VHUA 4MSUA 4C0LA 1NE2A 2QJRA 2R8BA 1A9TA 3O8OB 3HXMA 3PQ5A 1OTHA 3AUJB 1FYDA 3FFTA 2GCOA 4RV9A 3FY4A 4MDEA 3W34A 1N6OA 1IK6A 3F5QA 3EH1A 3I6QA 4IOMA 4A8JA 2ZUWA 5HK9A 1X7XA 4BPBA 3LP5A 4UBKA 1RBMA 3N3AC 4J0JA 5EYPB 4DLUA 3R5HA 2C7OA 1AUQA 5FO1A 3A7DA 2IVFA 4MV3A 3IT1A 3WYFA 2OLJA 2FQ1A 2Z5GA 4H3SA 1AC5A 1JQDA 3WL4A 2GD2A 2VNSA 2O59A 4KXNA 5MFZA 3EGOA 2FWRA 1X8LA 1R8JA 4ZP1A 1P31A 1GN8A 4M38A 4A26A 5GVSA 1CFJA 2IZ6A 3S40A 4HNVA 2H2AA 3ONEA 5KX5F 5CT8A 3O31A 2Y66A 1J90A 4AJKA 4V2IA 2JFOA 1VJ0A 5BUQA 5JSHA 4RWZA 4B6QA 1H42A 1R15A 3O4JA 1CUUA 4FEEA 3EVBA 3L4SO 5DLYA 1NWCA 2HRQA 3ORYA 3P0FA 5FL7A 2GKSA 3HABA 3UEOA 1XTJA 4N5NA 5ALPA 2PGLA 4MUIA 3TZQA 2GPSA 1YZKA 2W2KB 4BAZA 2ETVA 2A0KA 4CCWA 1YS1X 3OFND 1ULSA 2HA4A 4AB1A 3FD8A 5C35A 1BGVA 3ECSA 1MRSA 3JZDA 4WKPA 3DLCA 3IODA 2X7HA 2C98A 2ISCA 4MEBA 3T1HB 4F1JA 1OX5A 1EVQA 2ADFA 3PQ8A 1QK5A 4D8TA 2QR2A 4ER7A 1KZ7B 5LFAA 4GGMX 1NQXA 1T8TA 2X8LA 2I4TA 2FN3A 5JYCA 1G6OA 4YI3A 5DO9A 3FSGA 3GT7A 5KOHA 2NN3C 1H5NA 2BHRA 5DN9A 3LA6A 2JLUA 1UH5A 1ZLYA 2BGMA 2O3TA 3G82C 4MLCA 5K45A 4PC3A 4TS9A 4ZQFA 2QRKA 4QLAA 1TUIA 1ORWA 3O92A 3GT3A 4NH0A 1S8OA 4ZGBA 5H4GA 1Y1TA 5HHTA 5U9CA 1DAFA 3NFYA 4IZOA 3F97A 2W6QA 3DOHA 2C5AA 2BKXA 2QMEA 1I7QB 1X13A 5ICMA 3WNCA 4Y1FA 1P4AA 1ZIXA 2AG1A 1S7GA 1L7EA 1SK9A 1UKZA 1V95A 4R7TA 5D7NA 3DJFA 5EUCA 3T5BA 1CUZA 3VC3A 2CHVA 1N7IA 4BLOA 2QN7A 1CS0B 1KVSA 1MH1A 2UVPA 3AF2A 4X63A 3ISJA 2IHYA 3RJ5A 3GFBA 4L8FA 5CW1A 4DDUA 5HBGA 4QDZA 2E85A 1DUVG 1E5TA 3KKOA 1X2BA 4DWOA 1MEEA 2O2DA 5J2TF 4HZUA 1GPYA 3EEBA 1WEKA 4QEZA 3UT0A 1LBIA 3T6KA 2IPXA 4UBIA 1EJ0A 1UBTS 5IARA 3WFJA 3LGAA 1EXNA 4C0JA 1NJSA 4F3TA 2X76A 2FCRA 2HJ9A 4YP0A 1DAOA 4O63O 4BLPA 2PZ8A 2PVSA 3AUYA 3ZIAD 2Z5LA 1NUAA 3ZG6A 3HY6A 4MB2A 4BUZA 2I1LA 1FNCA 1X77A 2G0AA 2R8ZA 3PXUA 4FDMA 1B00A 4GI1A 4MRPA 4XD7D 3H9EO 5AI5A 1KH3A 1NN1A 5LA6B 5IKPA 4EHHA 3PFIA 2QL9A 4GW3A 2FSFA 5C5EA 3VPSA 2D0DA 4PFSA 2DT5A 1JPNA 2HDNB 1NLMA 4IFEA 4FIZA 3AX6A 2J0SA 1UP7A 4MHOA 1ILWA 3IXLA 1YKFA 2IXBA 2GVNA 2YS7A 3D31A 4P54A 1L5YA 2IHVA 4LOLA 3SQWA 2C54A 2GJ8A 3IAEA 5DF1A 2OOSA 3RSZA 1Y5NA 3KP1A 3VX3A 2ZB7A 3HHPA 1I9CA 4CNQA 1KJ8A 4NNOA 5DSXA 4B85A 1A72A 4EUFA 1XU7A 2WZQA 1ES9A 2H9IA 4ENPA 5ITZA 1JEYA 3DD5A 2ECKA 4B82A 4BQNA 1UZLA 1XMJA 4YRFA 5LIPA 2KS6A 1HFJA 3KT3A 2VHTA 3VZBA 3DOUA 4G24A 2VATA 4NENB 5INTA 4IO1A 1KJQA 3OLYA 4TWBA 2GRJA 4EB3A 2PT9A 1WDWB 3TLYA 1CULC 4LKOA 5PGMA 1UFVA 2VL7A 3HP1A 3SS8A 3UMCA 2A56A 4DEXA 3ZDRA 5JCXA 3IPAA 2JD1A 3C3WA 4JT9A 1UBKS 4OI1A 4DGQA 5JCJD 3K94A 3I12A 4CUJA 2O3SA 3IA7A 4JZKA 4CU5A 1E1QA 1MABB 2CW5A 4ZYTA 2IODA 4OUDB 5BURA 5AVWA 2VDMB 2IIVA 4L2IA 4IV8A 3VKHA 1PG0A 3TW8A 5SZKB 1RR6A 4L57A 2EGHA 2KBFA 4LV5B 3QLVA 1K6XA 2X9VA 2VH5R 1F1BA 1UXHA 1U8EA 2PH7A 3DBOB 5DVZA 4LWQA 4DIMA 4PAGA 3OFKA 3SIXA 4PLZA 4A8PA 5FUQA 4PGMA 3TGWA 1NXWA 1TC2A 4LOKA 3SAJA 1XMSA 3O75A 3RU9A 3QLVC 1E3LA 1LI7A 1WB6A 1KVTA 4DBVO 3QEAZ 5EZYA 3P4UA 2I33A 1NYLA 4NKRA 3TNJA 4LJKA 1P0CA 3W3AH 3CCCA 5FH9A 2PZLA 5L3SB 1DJOA 4DCUA 1ZGGA 4QUJA 5IKEA 2DUMA 2C4MA 2C3UA 4EJSB 2QXUA 1H6CA 4BNDA 1UJ5A 3K8YA 1KIAA 4YP9A 1ZCAA 4NHOA 2PFGA 1VLMA 5TPZA 4KQ2A 4UM7A 4EEZA 3DTVA 4TTAA 5YASA 3HL6A 2BHTA 3RVPA 2ZI9A 3RFXA 3VMFA 5L3RA 1TJ5A 1I2DA 3LY8A 4DHEA 5E7QA 4R1QA 3TM5A 3MTDA 4PO8A 1VKJA 5FNVB 1N5JA 1G38A 4Q05A 1NRJB 3AOGA 4HZIA 3OH8A 4W9RA 2G76A 3WA7A 3FJ1A 1D03A 4UEOA 1RWNA 1T0IA 2JGAA 3PDIB 1T1SA 4NE2A 5E7MA 3ZYCA 1CUVA 3JTMA 4QHYA 4UW9A 2HWXA 5BNFA 4DREA 1FSFA 1FYVA 2CXNA 5BQPA 4FGLA 4X7PA 4YRNA 5CG2A 2PUBA 1Z33A 1ABBA 1T3HA 1Q0QA 2C2BA 2WJAA 3AR4A 2B4QA 4WY5A 4OXYA 2ZUSA 1LV8A 1A4IA 1EUZA 1O08A 1VJGA 3BRCA 4N12A 8ATCA 5I3CA 1F6WA 4ZTBA 1D2NA 1G1AA 3IP7A 4CTOA 3VAAA 3TTTA 3QHQA 1OE0A 5JARA 1II8B 1F12A 3NO4A 4WA8A 1DAIA 1IAVA 1SUSA 1V47A 1VG8A 1ZKDA 2B83A 5JSZA 1WW8A 2H92A 5JH7F 2RB4A 2YVAA 3T1VA 1JKFA 1P74A 2D5LA 1XZFA 4IDOA 4M86A 5F7JA 3G6KA 5DP1A 3TNFA 4C0WA 4XWOA 3QBEA 4DV5B 3L0YA 3OBBA 4IVNA 4FYKA 3AWIA 1GT6A 1RKBA 2ZE8A 4H3KB 1SCJA 2R60A 4IVRA 2IXAA 4Q4JA 2OA0A 3ZY6A 1YBAA 1XPJA 3JZMA 5K3FA 2OB1A 1M6EX 1VG0B 1L6RA 1THZA 2ZRKA 2HPAA 3LFTA 3R3UA