3UK2A

The structure of pantothenate synthetase from burkholderia thailandensis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
280
structure length
280
Chain Sequence
SMKVISSIQELRDQLRGQNRTAFVPTMGNLHEGHLSLMRLARQHGDPVVASIFVNRLQFGPNEDFDKYPRTLQEDIEKLQKENVYVLFAPTERDMYPEPQEYRVQPPHDLGDILEGEFRPGFFTGVCTVVTKLMACVQPRVAVFGKKDYQQLMIVRRMCQQLALPVEIVAAETVRDADGLALSSRNRYLSEAERAEAPELAKTLARVRDAVLDGERDLAAIERRAVAHLSARGWQPDYVSIRRRENLVAPSAAQIEAGDPLVVLTAAKLGATRLIDNLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Ligase
total genus 88
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3uk2A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3uk2A01
1N2JA 1IQ0A 2J5BA 3AKZA 3FETA 2H2AA 3CVVA 4MW1A 4OUDA 2QUKA 3UMVA 4R2MA 1S4MA 1GLNA 4KR7A 1QTQA 1RQGA 1T6YA 2D54A 1U3DA 2QTRA 2QUJA 4YP7A 2GKSA 3TQIA 4P2BA 1WOYA 2PZ8A 5LM3A 5KWVA 3CLTD 1GTSA 3N9IA 1Q11A 1T6XA 2X3FA 3BL5A 3SP1A 4AQ7A 3H99A 1F7UA 3MLBA 3AL0C 3A4IA 1TFUA 2YY5A 1G8HA 4QBTA 4EGAA 4MUHA 1JHDA 2WQ7A 1N2GA 2A86A 2DXIA 1MC1A 2A4MA 2E21A 2YXNA 3AFHA 4MWEA 1WJGA 4ZCPA 4MUKA 1OWNA 1EJ2A 4DJAA 4AS1A 3AG6A 1J09A 1GPMA 1J1ZA 3IUBA 2J08A 3CLTC 1Q77A 1U3CA 4RUKA 3DV2A 2ZP1A 3ZGZA 2O5RA 1Q19A 3CLSD 4MVCA 3IH5A 1GN8A 2EL7A 1EFVA 1LW7A 4YMIA 5KCMA 2E0IA 3QTTA 4MUJA 3A05A 3RJZA 4HPWA 3TQOA 1GZUA 1K97A 1PFWA 2AG6A 4ZT7A 4G6ZA 1KH3A 3PNBA 2VTBA 4MUGA 1O97D 1I6KA 3FG9A 4PBTA 1YULA 1NUQA 2YWBA 3KT8A 1NP7A 3MMXA 2QJTA 1HYBA 2ZUEA 2IJGX 3CLSC 5EKDA 3G59A 2A7XA 4EG6A 2XRYA 1ULHA 4MW4A 1A8HA 1NUUA 5FO1A 4JXZA 3ZXIA 3QTBA 1EE1A 3ND7A 2X1MA 1QU2A 1YIAA 3H97A 3VRHA 2DETA 1JEDA 4J76A 4XFDA 1TYBE 1JIIA 3ND6A 1J1UA 1O97C 3SZ3A 3IOCA 4MUEA 2JAXA 4I6EA 4MW6A 4MVWA 3DLAA 4U63A 3K9WA 3COZA 2RE8A 5FNZA 2AZXA 1M8FA 2OV4A 1O0CA 3Q10A 3COWA 4JYZA 1OWOA 2QUHA 2ZUFA 4ND7A 4DDKA 3GMIA 5LLTA 3H05A 1Q15A 4CDNA 3SYTA 3FDXA 5AHWA 4MVYA 4ZCTA 1UFVA 1WXFA 2PIDA 1QJCA 1R6XA 2V0CA 3G6KA 1VBMA 5K0SA 4F4HA 1KR2A 1KH1A 2X1LA 4ARIA 4DLPA 1WXHA 4XFJA 3INNA 1N2EA 1O94C 3X1MA 1M8JA 4L2IB 2QTNA 3KT0A 4FZJA 1EFPA 1OBHA 5BNZA 2X0KA 1VBNA 2A1UA 1DNPA 4EFKA 2J07A 3M5WA 1N78A 1WQ3A 3F3MA 4PBSA 4NZPA 1NUSA 2HZ7A 5FO0A 2WQ6A 1WQ4A 1WXIA 1TYAE 1ZH0A 2Z3VA 4JZYA 1X8XA 3CVWA 1I2DA 3KFLA 4KPUB 4MUFA 1ZH6A 1Y42X 1F7VA 1N75A 3SEQA 2DERA 4MUIA 3MUEA 3FH0A 4TS1A 5K0TA 5LFAA 1WZ2A 1YI8A 3CVYA 1U7DA 1WKBA 4UZEA 3CVXA 1WY5A 3HMQA 3N2YA 1EUQA 3IOBA 3TNJA 3VGJA 1KP2A 4MW7A 2J4DA 4CDMA 4JFAA 3MLAA 4J75A 1JZQA 3DO8A 4UZFA 3TZEA 5F23A 3IVCA 4OUDB 1KQNA 4JXXA 2EJCA 1TQ8A 1M8GA 4YP5A 1O6BA 1QRTA 2C5SA 3Q4GA 4ZT3A 1N3LA 1G8GA 3Q12A 2A1TS 4MWCA 1JMVA 3N05A 4ZCRA 4MUNA 1IH8A 3CVUA 1H3NA 3MXTA 2G36A 2GM3A 1O5TA 1IVSA 3COVA 2NZ2A 4Q93A 2AKEA 2WSIA 3N8HA 3HZRA 4MAFA 3X1JA 3FOCA 1WXGA 3SDBA 4KR9A 1TYCA 1EUYA 4MULA 4S1OA 1OWPA 5J58A 2CFOA 2PZBA 1T9GS 4YBRA 3RFFA 3P0HA 4DNXA 2NSYA 1KP3A 3CLUD 4MVXA 1MAUA 3NV7A 4MWDA 4NAUA 2E18A 4MW9A 4MW0A 1R6UA 3RHSA 1JZSA 1QQTA 4EG8A 2RD2A 5DASA 2CYAA 3FNRA 3OP1A 3IMEA 1EFVB 3C8ZA 2A1TR 3SZGA 3DPIA 2CV2A 1YUMA 1OBCA 3H9BA 3PRHA 4Q16A 1G8FA 1LI7A 1O95D 4ZT5A 3ZUGA 1PG2A 2CYCA 4H3SA 5HUHA 3CLUC 4RPIA 3ND5A 3CR8A 3IOEA 3I05A 4GU5A 1I6LA 2XRZA 1VL2A 3FY4A 4CT0A 3ZJTA 1MAWA 3AIIA 1T9GR 3UC5A 4PY2A 1FYDA 1ZUNA 4K03A 2D5BA 5IJXA 2PG3A 2I1LA 1T6ZA 1MB2A 5J59A 5TS2A 5HG0A 1QNFA 1JILA 1JGTA 2HMAA 1O95C 1ZJWA 3A04A 3ELBA 4EG7A 3IVXA 3ZXSA 1J20A 2IP1A 1O96B 3ILVA 1EXDA 2PFSA 5TGTA 4BWVA 1N2IA 1VBKA 3E27A 4L2IA 1IQUA 4DDHA 2QTMA 1M8KA 1NYLA 1MBZA 1NSYA 2J09A 3U1VA 1LI5A 1ILEA 4A91A 1TYDE 2H29A 5JBNA 2O8VA 2CSXA 1M1ZA 1KORA 4KPUA 5TEVA 4NATA 4EF6A 5HUJA 1IFXA 1KQOA 3COYA 1O0BA 1XNJA 1JIJA 2A84A 4NDAA 4YP6A 4ZCQA 4HJXA 4ZT6A 3LOQA 3PNYA 3ZJUA 1MRZA 1JIKA 1EFPB 1XNGA 1MOPA 2YWCA 3A2KA 1V47A 2A1UB 1F9AA 1SURA 1PFVA 1NUPA 2PXHA 2JANA 4I6GA 2DLCX 1PG0A 1V8FA 4WSOA 1B6TA 1OWMA 3PXUA 2DUMA 4MWBA 4CQNA 1MB9A 1U7XA 3H9CA 3FIUA 2B7LA 2JA2A 4ZT4A 2DEUA 2QJFA 4U7JA 1U0BB 5DK4A 3L93A 1NI5A 4E1AA 3IDFA 4R0NA 2GOYA 3P52A 1PFYA 3NBKA 3IMCA 3UOWA 1M8PA 2R5WA 1KAQA 4ND6A 2QJOA 3LE8A 1KAMA 1COZA 1MJHA 3JXEA 4DDMA 4QRDA 3D6UA 4R2LA 3OTWA 4ZT2A 4EG5A 2V0GA 5H16A 4QREA 4X0EA 3GLVA 4HK4A 5KHAA 1OD6A 2DPLA 3K32A 1OWLA 4PBRA 1R6TA 1NURA 3ISJA 1N2BA 2D13A 4MW2A 4G5YA 3RBAA 3TS1A 4HJRA 5DB4A 4F3RA 4KKVA 3RK1A 3HFJA 4MLPA 3X1KA 2Z09A 4DE5A 2IELA 1X6VA 3IVGA 4NX2A 1H3EA 2OQ2A 2QUIA 3HL4A 4NAHA 3VU8A 2VTBB 3AG5A 1NUTA 1TEZA 3HGMA 4MW5A 1WXEA 3IMGA 3GUZA 4OJMX 3LCJA 4I6JA 3KT6A 1KH2A 3UY4A 3P0IA 4KR6A 3CA8A 1IRXA 3CLRD 1GTRA 3FI0A 5J5AA 3SEZA 2A88A 1H1TA 2CYBA 1J70A 1XJQA 1K4KA 2VXOA 3KT3A 1QRSA 3UK2A 1JEEA 1M83A 5TEWA 2WB2A 1D2RA 3FHJA 1O96A 1FFYA 1N2OA 4GRIA 4EG1A 1KKUA 1O94D 1XNHA 1PFUA 2CV1A 3RK0A 1F4LA 2Z08A 5DEOA 1N2HA 1IQRA 2PZAA 4U8HA 3PNVA 4G5FA 1G59A 2DR2A 1K92A 1NZJA 1N1DA 3CLRC 3NBAA 5IHXA 1K4MA 4MQ6A 1P7PA 5H7XA 3IODA 1KQPA 4EG4A 3IUEA 1IHOA 1H3FA 1CT9A 1YIDA 2CT8A 2CV0A 2HGZA 1I6MA 3D6VA 3FWKA 3TZLA 1QRUA 1YUNA 2CUZA 2E89A 1N77A 3HV0A 1QU3A 3L92A 4WNYA 3S3TA 1GAXA 3P0JA 4ZCSA 4EG3A 4ARCA 1VLHA 1BS2A 1J21A 4K0RA 4XSVA 2BYTA 3ZJVA 1JECA 2TS1A 3G5AA 3ZIUA 2BTEA 3QE4A
chains in the Genus database with same CATH superfamily
4K05A 3NDPA 4JODA 2IECA 1FUKA 4NU6A 4ZN6A 1GV0A 1FTYA 4BXOA 4QPPA 1Q0RA 3TZHA 4P1ZA 1R66A 3R5FA 4X20A 3RVLA 5IRCD 1JTFA 3LDGA 3AVPA 5BOVA 4F92B 2DULA 1PGPA 2YVQA 1Z82A 3OE7A 2C8JA 1G5FA 4YP7A 1U3DA 1UZNA 1HEUA 1W5TA 3KKKA 4K9LA 5LM3A 1E9EA 1QANA 3SC3A 3OO1A 3W7VA 4K46A 5JNUA 3R24A 1KIMA 2HCJB 2ZULA 2JIZD 3RU9A 3KWFA 4K9OA 1ZVVA 1Q11A 1UM8A 1RRVA 1G7SA 4HX2A 4LHWA 3BMCA 5LD2B 4QU8A 4Y6GB 2ZKLA 5L3QB 2I29A 3MGKA 3QPBA 3PUYA 4GH5A 1PL0A 3OCVA 4WZAE 4U7FA 3N7TA 2A86A 3H11A 2AE2A 4KACA 3AFHA 5HXAA 3G7SA 1JBQA 3AFMA 4PHGA 1ESDA 3PX2A 5CVTA 2OC4A 2A5DA 3E18A 3CW9A 3SXJA 2OKCA 3BDVA 1YS9A 3OWXA 5H4GA 2IU4A 1GPMA 3HJNA 4W9RA 1HI9A 3CNBA 5H8WA 3OQMA 1K7CA 2X14A 1C2TA 3C1TA 4TUYF 3VJLA 1QC5A 1XC7A 3M89A 4ENQA 1FDUA 1YBAA 2AF3C 4R9UC 6REQA 5A0FA 1DXQA 2O5RA 4NPCA 1LQ2A 2CXQA 3NT5A 4Y2SA 5TQ0A 2WBLC 5CFZA 3EULA 3GBVA 5DGCA 3VKUA 3ULKA 1N3YA 4HY3A 5A5FA 1CW2B 5LOVB 3GRRA 1L4EA 1W52X 2D4HA 2I4RA 4N8SA 4WI1A 3VNBA 1THZA 3MSCA 3DZIA 1SQFA 1I94B 2NZYA 1GD1O 1I33A 1PYDA 3V8PA 1AGRA 3HQ4O 4UUOA 4LJ7A 3S2IA 4PEVA 4IPTA 1OROA 4FYKA 4E5PA 4UHDA 1W35A 5DH9A 1JQEA 1KH3A 5DLQC 4ZZ2A 3MT8A 1IB0A 4QLOA 1JEAA 2F1IA 3DLIA 2G1UA 1G7CA 3R1IA 4V0ME 1BCRA 1I7PA 1YULA 4YR9A 5C5CA 2DHQA 5IWAB 4MROA 4DPMA 1QF7A 2VHZA 2VHXA 4EBFA 1JLLB 2EBFX 2IJGX 4E5NA 3NRBA 1NAIA 4DL9A 3VYWA 2DY0A 3FAZA 3G02A 1T8WA 4LHEA 1E20A 1FDIA 2O6HA 3SSNA 2QD5A 3UV7A 5FO1A 3LQ2A 2V97A 5A7GA 3R5KA 1XA0A 3Q6MA 4FIDA 2VA8A 3AIOA 4ZC8A 3TTYA 3V48A 1YIAA 5I9LA 2OBFA 3WO0A 5JEDA 1QLWA 1Z35A 2C2XA 2HMSA 2X0DA 5KCZA 2XZOA 4LOKA 3L1VA 1LTKA 3KDPA 3E7DA 2DETA 3C6QA 3IXQA 2JRLA 3JQGB 3UK1A 4MQEA 1QHGA 1C1HA 4NZOA 1XEAA 1UR5A 1H8HD 1WBJB 3BIWA 3HKCB 3P32A 2VCHA 3EVNA 4PTZA 5KQGA 4QODA 5BV8A 3KQKA 1DC6A 1ID8A 2UYQA 3LHKA 2R6ZA 4LJKA 2ZIEA 4N0QA 3RSLA 5DP1A 1DKRA 1B76A 1S1CA 1T4MA 1FYEA 2BFEA 2JIDA 4DQDA 2BR5A 2GYWA 1EFRA 2WJHA 1Z63A 1ZCJA 4JU8A 2X4DA 4P3PA 5DI3A 4UDYX 1YJCA 4ILEA 2R4QA 5GPBA 2WHYA 3IP9A 3PR2B 4MGHA 2GXSA 3C39A 4ND7A 5I7VA 1UXKA 3DCIA 4IZOA 1KDRA 2IW1A 3OF2A 5LBTA 4KH0A 3CZAA 3FXAA 4Z9XA 4TMXA 4PM4A 3HBJA 3REQA 2ZDQA 2IYZA 4G8BA 3EEQA 2YINC 2O6LA 3CF0A 2XDYA 4FGZA 4PNPA 2X86A 1ZK2A 1Y8QA 1A97A 2WF8A 4OJKA 1MPTA 2BEVB 2DLDA 2VT3A 4NCXA 3U7JA 1B8OA 2L2QA 2PH5A 4M0CA 2CLDX 4K9SA 5IASA 5K8JB 4GVPA 4UBMA 3O93A 4DWWA 2FZEA 3WXMA 1ZM4A 1OBHA 1Q50A 2EQAA 2WVJA 4ZEXA 5KEIA 2QL6A 1N9GA 3KZNA 4HXYA 4AD8A 2C2YA 3B38A 4BKRA 1NMZA 1MG0A 5ULLA 1MA3A 5BYAA 1JFSA 1XQ6A 2HJRA 4IFTA 4XDZA 5L3SB 3TLZA 5BN4A 4YXFA 4Q66C 1NGSA 1GTL1 3CG4A 2NQ8A 3QITA 5K9ZA 5U9CA 2X5JO 2Z2IA 4G2NA 3UWPA 5DT9A 1I7SB 4HWKA 3ZZ0A 1CQXA 1TRKA 2FG7C 1YQXA 1QHSA 3EK2A 1C3JA 3UAZA 4XCQA 1P0IA 3WDLA 4NFSA 3BS4A 3LUGA 4RPHA 1AZWA 1R10A 3NBXX 3G2PA 4RCZA 4JSRA 4GPEA 5K03A 1YZKA 4X6LA 4DV5B 1XXLA 2P2LA 4AG6A 2ZT6A 1GL7A 4AF6A 1DIOB 2GZ2A 3VGJA 2GPAA 3AVOA 4C14A 4WGGA 3EDCA 2R6AA 2DWPA 3AXTA 1KZ6A 1KBQA 3GEMA 1ONBA 2P8JA 4RFSB 4RC9A 2P3SA 2QI9C 3EA0A 1PX0A 5DNVA 2RI1A 4JLSA 1BXGB 3OJCA 3C3PA 3TSWA 2FJ0A 1G8GA 2GCNA 3IO5A 2HBYA 4AJ2A 4O3FA 4OXRA 4XIIA 3ZUPA 4AYTA 4ASUA 5BY2A 3TXYA 4X71A 4TV8B 2ZSKA 1YE5A 4TWIA 1V8OA 2GNAA 2W98A 3F2IA 3STVA 2J3IA 4CCSA 1KWKA 4AKHA 1SVLA 1XCBA 4CKEA 1WDLA 1YL5A 1E3LA 2ZPTX 3REGA 4U0JA 1T8YA 1XD2B 4YUVA 2VJAA 4Q1EA 5A9SB 1GNSA 1J00A 3QKSB 5ADWA 2BKLA 3KFXA 1U1GA 2UZ1A 1IN5A 3SFTA 3CZ5A 3BD6A 3PI6A 2GT1A 4PR3A 4I50B 1TKRA 1XRQA 1WDKA 3TL3A 2OGUA 5IAKA 1KMIY 1KS2A 1OILA 2QMZA 2YUTA 4D42A 1WZNA 3QP9A 3DONA 1H4VB 1SVWA 3CEPB 5CR9A 3LQ4A 1ISSA 3ZV7A 3CX7A 1LBEA 1OLSB 1T4CB 2ZRQA 3TZQA 1PSDA 1J7JA 1TFRA 3TAXA 4XWGA 5REQA 1BNCA 1E2MA 2JI4A 1WCXA 2O52A 2Y2UA 4BN0A 4MW9A 4X1OA 3DDWA 1GT6A 3QG5A 3ZI4A 1FVHA 2VJMA 2VNSA 4ZIRB 3HP7A 4ZI7B 5IJZA 4Y30A 2OLJA 3BE5A 4WE3A 3HHEA 2A9VA 3JAKA 1Q14A 4EVIA 4DR6B 3DPIA 1OXBB 2IRWA 1ADCA 2N1MA 2IHJA 2ECKA 3GEGA 3ICEA 3FYCA 1PR1A 1XVAA 3EVDA 4KQJA 1UBGA 2Q2WA 4J0IA 2ZVPX 1SA0B 2ZEJA 3K1JA 3CUUA 4MCHA 4LYHA 1D4OA 1M1YA 5K51A 1CUSA 1RPAA 2VWPA 4ES6A 2PSFA 3AU9A 4MRRA 5TT0A 3ZBTA 3O1JC 2OCKA 3FY4A 4HAYA 4EY8A 1IHUA 2XB6A 4FFBA 4LJAA 1EIWA 5K0EA 1B6GA 1QHNA 4DLAA 1A8QA 2AFHB 4IZHA 1FTGA 5IJXA 3BKXA 3LT5A 4YUZA 3OWHA 4U6NA 4KJZA 4KO4S 3DT9A 4CF7A 2EFEB 5FI1B 4XQEA 2P78A 3HNOA 1XALA 1B3RA 2K5UA 2R97A 2YY7A 4YCSA 1QNFA 2XI4A 2Q6LA 4NE7A 1KI1A 5A6SA 2PX3A 3G2JA 1XXHE 1VYUA 3DDSA 3I04A 4I19A 4JU9A 1CUXA 3A1NA 1T9CA 2QGFA 3QFTA 5FBRB 3VHXA 3WMGA 2Q3EA 1TIBA 3GEDA 1OIVA 3M6LA 1NU6A 2RB5A 2QU8A 1W5FA 4M7WA 4EAQA 4CLRA 1Z8HA 5K2OA 3H2ZA 4X7BA 1ZK1A 1C8BA 1VKJA 2R6FA 1XZPA 3NCTA 4JASB 3HS3A 3KR9A 4ISCA 3AF1A 3A1TA 3S2ZA 1M8KA 1NYLA 1WV1A 2FF5A 4LBYA 4JUBA 2O07A 4Q7MB 1AV7A 2EKPA 4ZREA 5CAEA 1TIPA 3EMVA 4B5LA 5JYBA 3BILA 1FZQA 1USIA 4LOIA 5CXXA 2RHJA 3RIHA 3O6VA 1X7XB 4M99A 5ALUA 5EMKA 4PHHA 4QFBA 4KUGA 5CIYA 3Q88A 1Z29A 2OCGA 3PGVA 3R6LA 4TTAA 3O90A 3OA0A 3WK6A 1C3OB 5AVWA 4HGRA 5JNVA 1SB9A 5JZBA 1Q84A 1FF9A 3PYXA 1MW8X 3OZXA 2I9KA 1G4UR 5IEBA 4B17A 3T5TA 1RHMA 1XVIA 4POAA 4EMTA 5ADHA 3GLIE 4O5AA 3STUA 1L1RA 1CJSA 4MV1A 1E3WA 1Y3FE 4KQ9A 5EZYB 2QLTA 3OE4A 1TZBA 2OMKA 4YJ3F 2BFBA 4TKVB 2HZBA 1V6SA 3WIVA 4OAPA 3KAJA 3FOEC 4DNFA 1ZJJA 4L4UA 1NVFA 3B1WA 3NEPX 2YC2C 2GXAA 1QIFA 4MWBA 1R16A 1MB9A 4I1SA 2C8KA 3HWSA 3FSGD 2WNSA 3ZOZA 1D0SA 2C4UA 2PRZA 4DF3A 1ESCA 1L7MA 1PT8A 2J3DA 2FMFA 3KKQA 3ZDAA 4ALKA 1NX9A 2X0JA 3WV5A 3L93A 2H1IA 3LWNA 2CLLB 4BN5A 4BTVA 5K05A 2GOYA 4C89A 2EP7A 4R1MA 5IBRA 3DTNA 3IQIX 3P2MA 2O2EA 3IMCA 1UPBA 1G20B 5JASA 2IV2X 2HV9A 1CLUA 1U80A 4LAFA 3OTGA 1DVRA 4JI4B 2Y0EA 4HPJB 2WAOA 3BA1A 2CXRA 2FCRA 4BZPA 2G6TA 2Y6UA 3BUSA 1XP8A 4ENUA 4QRDA 4JQOA 3UM9A 1ZSNA 3LY9A 2ONJA 4GL2A 1EA5A 2IUFA 3OTWA 7MHTA 2VYQA 1UADA 2WTNA 3R6WA 4U1RA 5EYPB 1OH7A 4BE9A 4YRSA 3NASA 3HXPA 1JPJA 5KWEA 4EX6A 1QNLA 1UP6A 5F12A 3V4OA 1OV4A 3W7AA 3ISJA 2CN1A 3NHAA 1KWGA 2C97A 2BELA 3LNTA 3PPYA 3D3NA 4INOA 4IRUB 1IBSA 2H07A 3V80A 4OLAA 5EMNA 4FWIB 1U6JA 4EJSB 1KMCA 3CKYA 1N1MA 1Y6GA 3E4CA 1E3IA 1MAAA 1P8JA 1WY7A 2JZNA 2RFLA 1X39A 4TMWA 2VF7A 5BSWA 5C46F 5I45A 2HYIC 1ODJA 3ET5A 2ZIGA 5G2FA 4K6FA 4C0BA 5C8VA 4IGEA 4NAHA 2MOKA 3TR5A 4C4PA 3W90A 5E7QA 1MEOA 1WXEA 3FPCA 4LRXA 1TQ4A 3C6BA 1UDCA 3PT9A 2R2GA 1GLVA 4G1VA 3CUWA 4EJ0A 4Z7NB 4FZ3A 4IQ0A 4JUIA 2FDCA 2PQ2A 2BZ1A 2FPRA 3S27A 4K6CA 1IK4A 2O3RA 4ZJUA 1ZINA 1G6Q1 2BC9A 4FGKA 4MS4B 4OV6B 1CF4A 1F06A 1UMDA 1HETA 3AY0A 4MPJA 4NABA 4XWAA 3VJKA 4BP8A 3A3YA 3DLTA 3T7JA 1VCHA 2H2HA 2Q49A 3NLLA 5CX1A 4WNCA 2ZGVA 4K9KA 4BLRA 4UHEA 1K4KA 1XRSB 1WR8A 5H68A 4B73A 2H06A 1JDNA 2HA6A 3AP1A 4GS5A 2MU1A 4NZ9A 5EMJA 5LL6P 2YZMA 3HCEA 1BGXT 1E2DA 4NCNA 2X2EA 3ZLBA 2WWYA 5IVKA 5F64A 3C4QA 2WPDA 4CHGA 4IICA 4KIUA 1OMOA 1H2EA 4TSKA 4L8VA 1RXSA 1Y7IA 2QX4A 2CV1A 1OC4A 2NNWB 4C4ZA 5C8XA 1D2MA 2VSFA 1UXIA 1E6CA 2PM8A 1Q1ZA 1Y9EA 2QT0A 2W11A 2OK8A 3C98A 3FNHA 2GA9A 3HKDB 1HTWA 2JGLA 1P7PA 1LSUA 1IY8A 1W75A 2QE7D 2Q3HA 3IIKA 3PF8A 4IM7A 4QBHA 2NWQA 1WCIB 3DFMA 3U9TA 4MJLA 1NW8A 3WFJA 2VPTA 3DZ8A 1TKAA 1YVDA 4TTRA 4PAGA 1M0WA 2II6A 4BLQA 1ZICA 1N1GA 2XR1A 3I04M 5B1YA 3U6KA 2ZBUA 5LDGA 3UWDA 1C5KA 3C8UA 3T06B 4HFMA 2E89A 3NKVA 5DE3A 3GLKA 4M22A 2BGRA 5DLYA 3L92A 3C1UA 3TK1A 1L4FA 4A16A 3X1WA 1E2FA 3P20A 5J4LA 1XG5A 5IPFA 2D7DA 3PSAA 4R1UA 3TTTA 3P71T 3OKCA 1N2JA 4Q9NA 5KTKA 1LWNA 3A8TA 3KYDB 5CT6A 1A9XA 2F59A 3H9EO 2VPWA 5JCOC 4WUVA 3G5UA 1YZVA 2Q9CA 1TADA 2F9FA 2H2AA 3M4ZA 5LIPA 2YWJA 4WKBA 1U8YA 4XUDA 3BERA 4I5EA 1VPVA 3DF7A 4G89A 5CRIA 3NBUA 1J56A 1XO1A 4IIGA 1B23P 4E5SA 5BWLA 1CUVA 3UJ7A 2HO5A 3Q3CA 3WZMA 3IILA 2EARA 3PNQA 5AK4A 2VKTA 3U7GA 3CH4B 3DV0A 3TQRA 4QUEA 4QDZA 4G1FA 4H08A 1LPNA 3DF9A 5DTRA 3RUHA 3SF8B 4GHWA 4KAJA 4LY9A 4J90A 2CLKB 1BDHA 4OHYA 1TM1E 3A4IA 2P4SA 3OJ0A 3TFQA 1CRPA 5AI0A 4LC0A 3BT7A 5B36A 5KSOA 3SYRA 1V5IA 2NAPA 3CLHA 3WWCA 4YUWA 3RVQA 3ASUA 4CPDA 2MSLA 1WB4A 2QN9A 4Y6SA 3Q3EA 2BGGA 2UUBB 1HM5A 5E7JA 3OBBA 2M6SA 1L9XA 2J6IA 1LNSA 2OB2A 2CHEA 3NAQA 5JVDF 3QLTA 1NP3A 1F1BA 4ZI3A 2ZE5A 1UK7A 2Y9MB 3SQDA 1ISIA 1OSNA 3L4EA 3BOSA 3N0WA 4JI8B 1CUGA 1LH0A 2I9PA 2QEQA 1RWBA 5FOXA 3CLSD 2A50A 1NQXA 1AXRA 1BH6A 2P9QA 2ZIWB 3IH5A 1WLSA 3OLZA 5EE9A 3RR2A 3TZBA 2G4CA 1A9QA 4R6XA 2QY6A 3R23A 4RYLA 3AFNA 1QP0A 1FJ2A 2F1OA 4L9AA 1TUGA 2JJ1A 4LWQA 3A05A 5ALZA 4DLLA 2DFDA 2FZCA 2H1CA 2QTVB 4RQTA 5AJVB 3K2BA 1E8MA 1Y8CA 2HNBA 2OUIA 3G1TA 3I23A 2P0YA 3KPUA 4URYR 4C20A 3IHKA 4F71A 2UUPA 3DFFA 1YQUA 1PNRA 3DBHB 1B2RA 2XB9A 4PBTA 3OOYA 4BB5A 5C18A 1W7AA 2C1XA 5CLHA 5I9IA 3C6YA 3PG5A 4YRCA 4L51A 1IDN1 1MGPA 2BBWA 1ORVA 3FWZA 4IKOA 3LO8A 4M9SA 2WSLA 4K2AA 1V39A 2GWRA 2H51A 4ITVA 5MF6A 1OVGA 3RANA 1CERA 1YZ3A 1EAMA 3MGGA 4G01B 3TVDA 1W0CA 4JWKA 1SCDA 1QHIA 3TTUA 1A8HA 1GFZA 1XZAA 2DQKA 3LK6A 5KU7A 5KTRA 1S3GA 1HF3A 1YNSA 3T38A 3OT1A 1CSEE 5HF8A 5KNCA 1EG2A 2VPQA 4OO3A 3E9MA 2IEIA 3CX6A 3B52X 4Y8VA 4C7BA 1NPDA 3ZTWA 2P4QA 1TW2A 2PV0A 2VYVD 1WPGA 3PPWA 4Q7KA 5K8TA 1GSAA 2KSQA 3W79A 1QFXA 2FPMA 3LI2A 3L8CA 4TXNA 2RHGB 1E7RA 1H5UA 1QOPB 2XVXA 3WGYA 2GM4A 2B9EA 1PUJA 1V1RA 3BK1A 4JLOA 5BQ3A 1J2RA 1T5IA 1N5JA 5HIAA 3B6EA 2G28A 3COZA 4J1QA 3GMTA 4CIDA 4EHDA 4LBVA 2WJIA 4H16A 2H18A 2V98A 1BS9A 1Q3TA 2HKIA 1Y7PA 3R7LA 2NO5A 2DVMA 3GNTA 1UBOS 2P11A 4H3VA 4PAQA 4PX9A 1EBBA 4NJMB 1NLYA 3GJ4A 3Q7SA 2QUBA 5D1HA 4UHCA 1HOTA 3HBLA 3RIEA 4EW3A 5B58C 5LQNA 2O1WA 4N0PA 4E6EA 1ZIXA 2GR9A 4IV5A 3W3ZB 4JI3B 1WDWB 2Z8ZA 5AJYA 3ONDA 2Z57A 2C4MA 2H5LA 2ZJAA 4IIJF 1KR2A 2UZIR 4BHTA 4F4HA 3BWBA 1G2PA 3H5LA 1O89A 1RCFA 2Q5FA 3O8DA 2AG1A 4KXXA 1TF2A 4AKTA 2FVYA 5FTNA 1PR4A 2O0HA 2ZBFA 3N28A 4BJ3A 4C6SA 3O0TA 1GPKA 4YAEA 1SOUA 3H4IA 4TSFA 3EDMA 1WW2A 4J6FA 3OZCA 1VYHA 2Y66A 3HDHA 1NUSA 1L8AA 3CMCO 1DIGA 3FHCB 2QG4A 5AIBA 2WQ6A 3SBXA 1FS5A 1I2DA 2BI7A 2E4WA 1B15A 2CFRA 1Y42X 1NWHA 1N0VC 2I6GA 1W25A 2H5JA 2VEDA 4KPEC 1F7VA 4KIGA 1XCPA 2O7SA 1AUXA 2CBXA 2DERA 4MUIA 1BFUA 2C9YA 2QD2A 2VJKA 3GDGA 3INGA 4JBLA 4OLBA 5I4IA 4QD3A 4ZAYA 5AKIA 1T29A 2RH8A 4ARZB 5ADUS 2W4QA 3LVQE 4CODB 2APJA 4IYRA 3IBYA 1CUFA 1D04A 1O1YA 3CTMA 3T7CA 3TNJA 4M9CA 4ZGBA 3C5CA 4V1CI 5TV2A 4L6AA 4MDHA 1VA4A 2FZKA 3U7QB 1CIJA 4FUQA 3HVKA 1YB2A 1S0UA 1M1YE 5IJ9B 3GZJA 1B41A 1JZQA 1XKTA 4UZFA 2FSVA 2JFXA 2OTCA 3IVCA 4BS9A 1K7YA 4CM8A 4DGSA 3AB8A 2IU6A 5BXQC 3FB4A 3DE5X 1FDTA 3GOQA 2AI2A 3KKLA 2NMVA 1P4HA 1SZJG 4LWPA 4LI3X 3UMCA 4Y6OA 1YA4A 5DGXA 2C1ZA 2A0KA 3NOQA 1A2KC 2GJSA 3Q3GE 4L8YA 3QUTA 3X44A 5EGNA 2AG8A 3AR9A 2QX7A 3I9NA 4QXOA 4YJKA 1VPEA 1ZX1A 3MS2A 1KC3A 4JAVC 3LJKA 1PJLA 3PP8A 5AI8A 5M3BA 3N8HA 1DRKA 3JU3A 3FOCA 2ZIFA 2GASA 2V96A 4RA6B 2JDID 5AUPB 1IIBA 2FGJA 4DUYB 2Q6TA 1J1IA 2QRMA 1Q1AA 2PU5A 1HOXA 4LX0A 3WYFA 2UYGA 4MO2A 5B4UA 1FLVA 1GTG1 5HKKA 2HFKA 4UC0A 4DNXA 5BO5A 1U0LA 3ZHOA 4XJVA 3TMAA 3G2QA 3FHLA 5KWIA 2XNKA 2F1KA 3BWMA 4J3JA 3ZNPA 3GAAA 3VVLA 5EXDA 4BVKA 4B76A 3BTSA 1Z45A 4RXUA 4EWLA 1QGAA 1QJ4A 1X7GA 1R6UA 4M89A 1WMSA 2GJ4A 5F5NA 2CYAA 5J5CA 1L4GA 3SJ7A 2BFCB 3PC2A 4NJOA 2P7IA 3I32A 3KD3A 3OP1A 5KSWB 2AVNA 4L9SA 4X00A 1NFQA 1N9ZA 1NSFA 1U5AA 2FPPA 4BMCA 4H7EA 3LD9A 3NPMA 4IP0A 4B3BA 3ADBA 3NIWA 3E03A 4P53A 1Z39A 3DE1X 3P2JA 3PRHA 2DPHA 2FFBA 2OO5C 1OFGA 1QGZA 4FCCA 3JZIA 4XJXA 4Q01A 4US0R 3WA7A 1KGSA 1PG2A 4WJLA 1L5WA 3BB1A 2OZPA 4D0LB 5LA6B 3M49A 2PJRA 1W46A 2XRZA 1U2DA 2HMWA 3BKWA 3ORSA 4FMDB 4U2CA 2YXDA 4CT0A 4DDUA 1RDFA 3HUTA 4IDOA 1FTNA 2JFFA 1OBVA 3EGDB 3JYLA 1C1DB 1ZUNA 4LMAA 4NC9A 3N7UA 1TT7A 1FX0A 2VOJA 3LGXA 4NH0A 4BUCA 3PLRA 1OYVA 3KRTA 3U81A 3ZHSA 1DTSA 2OA0A 4O4JF 1ISRA 2PCLA 1MB2A 4JX9A 5DCYA 3SGLA 4CI9A 5JDCA 3UJNA 3AOGA 1QGDA 3OQPA 3OZDA 1AIPA 4XJSA 3HTXA 2CUTA 3LYHA 3SS7X 1GNQA 2EKBA 3B9QA 4RORA 3RADC 2Q46A 4Y2JA 3D0QA 4HTFB 4NENB 4JI1B 3KETA 3WQHA 1WTCA 2X5OA 2I7TA 4L8WB 4S2UA 4YWJA 4EG7A 2R6DA 1PZGA 1NRWA 2O19A 2IP1A 2VJPA 3Q87B 4YDHB 1P33A 1ZXLA 1NWCA 1L5MA 1Y63A 3OFJA 1RCTE 2DU8A 3CGWA 3LX5A 1N2IA 1IULA 1Y9JA 1ZGBA 1GAQA 2Q29A 4Y1RB 3ZD9A 4ETIA 1ESEA 2IPMA 4CQLA 4EQ6B 2AYZA 4B3CA 1RRCA 2XMCA 2R65A 1JH9A 2VTEA 5CG1A 3F2VA 1JN0A 3D6AA 4QGAA 3M81A 2WDPA 1WZIA 4JVLA 2NU6A 3CPSA 3WWDA 3QKIA 1XMQB 2AS0A 2H29A 3Q15C 5JBNA 1Y9DA 1BU8A 2Z58A 3RRJA 4YPOA 4UU1A 3IQEA 4RY2A 2AN5A 2IVFA 3TR6A 4EF6A 1EXWA 2XIJA 2XMZA 4EI2A 4ZYZA 3MWDB 5JCZA 2YWEA 1TI7A 3IKVA 1B1AA 3X43A 2J3KA 4MQBA 4NDAA 1Z0SA 1BXZA 3NT4A 4II3A 2A5FA 2A59A 3GH3A 4QTYA 5DSZA 3GJTA 3CVJA 3U9SA 1EDEA 4XR9A 1HDZA 5FR1A 1GNVA 3IAXA 3ZZUA 1Y80A 4DAOA 4EI9A 2YWCA 3ZY2A 4B6EA 4AJPA 2Y1EA 4FOSA 2EFDB 4DQXA 4G5QA 4O8CA 4BJ5A 4CDGA 1PG0A 5A4MS 3FOZA 1DIAA 1COWA 3FLBA 1BQ4A 4P84A 1NFFA 5JJBA 1U7XA 3PXXA 3DKVA 5AUOB 1SXJD 5FBHA 2X41A 2G88A 2JEZA 5KNBH 3CI0I 1QGUA 2VJQA 4J0FA 2ZQZA 1YB6A 5BSUA 3M1LA 4B43A 1E5QA 5KAPA 1Q21A 1H8HA 3S1AB 2R00C 5B6PA 4P32A 2DWQA 3LDFA 4JYBA 4H4EA 4F1JA 4UHHA 1F5NA 4TVBA 4UE6A 1S2OA 3EA5A 3A4LA 1Z5UA 4MV8A 1ADGA 2CGEA 5F2NA 1GV1A 4MITA 1A7AA 4L4ZA 1TUEA 1A0OA 1I9GA 3JYPA 4GZ6A 4EPRA 1K8YB 1NPYA 5EN4A 4PPQA 3ZTTA 1E89A 2QRVB 1JKMA 4J7XA 3W78A 5A06A 2FWRA 3PHHA 5C52B 4PYJA 3H2JA 4R2LA 3VMFA 4BRZA 4E2YA 1O4VA 3WGNA 5A03A 5J23A 1S8AA 3P0RA 4ER7A 1NF2A 3FUUA 1VIVA 2CE2X 3WE7A 4QGFA 2CF5A 4NYMR 1Z17A 3S7ZA 4JOQA 4WOKA 4XKJA 1R6TA 1RM4A 1X77A 3LHFA 3OY2A 2IS4A 5F21A 4KFCA 3PYLA 4OXYA 4YYEA 3LQRA 4R54A 1U90A 4IYJA 1D1QA 3G0BA 1OAOC 2CJWB 2G3DA 2NPOA 4I1UA 2WSYB 1RYHA 1W6UA 3IAM6 4IO1A 3IS3A 1RYBA 1C29B 2Q7XA 5CYFA 3I83A 3SZRA 4GI2A 3UQZA 3BJZA 3HUDA 3RLFA 2IDKA 3F98A 4OHCA 5L7WA 1V16B 1RRGA 4GP7A 4RXTA 1K7FB 3HXMA 3OPNA 2IHVA 2XWBF 1BXRA 4BQPA 3MT0A 2IYRA 5ESRA 3GRFA 2OGWA 4MW5A 3F4KA 4H0FA 3T94A 2Z5GA 4MP8A 1D2GA 2EV9A 3BH7A 1BHO1 3TE6A 4F04A 2CLCX 1MJFA 2IEZA 1KHTA 1M7BA 4QJBA 2PGXA 2NZJA 2ZRKA 4TXLA 4ZVVA 4P5PA 4I4NA 4Z2AA 1KIFA 3GW8A 4DLBA 4DQVA 1HE5A 3CLRD 4K6HA 4B3FX 1BMQA 1ESNA 3EDQA 4FGLA 3OEWA 3AW8A 5ECWA 2YX1A 2ALJA 1RXYA 2CYBA 5TDHA 5JW6A 3AM1A 4WN9A 1ULSA 2BUCA 2O7RA 2X1VA 4L28A 4OP1A 4JP8A 4WY8A 1L5OA 1V35A 2YHAA 3KHKA 3MIZA 3TFOA 5CCXA 3HWWA 4JA0A 3MHPA 4XM2A 1UC4B 3INRA 4IOJA 1G8AA 4TMZA 5CVCA 5HRAA 1JLRA 3MS4A 2VVTA 3FDZA 3U3KA 4F93B 3SQWA 1O96A 1FU8A 4EUNA 2XKAA 2I6FA 5HA5A 1XPJA 1CR4A 1AQYA 5MN6A 1K06A 1O94D 4FFVA 3DBLB 3HEMA 1ONPA 1SH7A 3I4LA 1QCDA 3N39C 1Z7YA 1IBRA 1TNDA 3A1UA 2OHXA 3NUGA 1VKNA 3WLHA 3VSDA 1RFLA 3K5PA 5CFRA 2WHPA 4KWCA 1R9GA 2HK9A 4FGWA 3IODA 3P9KA 4K7JA 2XCQA 2I2DA 1E1KA 3G2KA 3WNCA 2NO9A 3UMJA 1NBHA 2FR8A 1RZUA 2QJWA 5LU9A 2GHTA 3AH8A 4Y98A 5B7NA 2IH5A 2VH5R 2VAXA 4ZVPA 3FB1A 3KCNA 1X74A 4XSHA 4O25A 421PA 4PZLA 5CA1B 4MS1A 5I48A 2CLSA 3C7TA 4WNYA 1M7HA 1RRKA 4QX6A 4ZCSA 4ARCA 3GP3A 1RYFA 3RVRA 1HMPA 1YVUA 1XSEA 3D8NA 4XM1A 3UGQA 3QKRB 1NXQA 3LT0A 4K0RA 2BYTA 2ZSFA 1V5GA 2FEOA 3PEFA 5EIEA 4R8RA 3ZJVA 3TRDA 4V1CA 2YYSA 4ON9A 1UZMA 1XQYA 1YJQA 2BW0A 2MSKA 1ODCA 3UFXA 4YX9A 3SKVA 3UHFA 1DT5A 1NN5A 3CX4A 4FGJA 5I6DA 1Y1TA 4KPFC 1RKVA 4OUDA 4O02B 1E1LA 1Z08A 1CWUA 2AQIA 1IL0A 1KYIA 1P7YA 4KR7A 5NLLA 4NBTA 2D54A 2W2PA 4Q3DA 4ML3A 2P9HA 5F52A 1XV5A 3K0CC 2XE8A 1W9HA 3TIVA 5FWNA 1ZMRA 5FAXA 1OYYA 4OFWA 3H6HA 1UBKS 1V5WA 2GF2A 2DJ5A 3GA0A 1CUJA 3BL5A 3LUPA 5H3LA 1XJ5A 3SFVA 1HE2A 1R15A 4OBXA 4NPHA 4ZEWA 1W0JD 2OM6A 5K1ZA 2DSTA 4AMZA 4E09A 3KZCA 1KJWA 3WYGA 4LC1A 2VIIA 1KI6B 2I6UA 1Q74A 1WXWA 4P34A 2EIXA 5JNSA 2AG5A 2BZ0A 3I6ZA 5K2MA 1CDOA 2ZR9A 4YAKA 1Q0HA 4HH1A 5BSEA 4R1SA 1YC5A 5H80A 5D01A 2Q3DA 5B3AA 3WNDA 1FP4B 3AOEA 3WK5A 4QHSA 5BV2P 1JF8A 5JWHA 3PX3A 3RSHA 3CLTC 5DTIA 3F1LA 4KO2S 4XGQA 3IUJA 2ORIA 1L5QA 2DGDA 4YV1A 5KOIA 3MBOA 3LXXA 5FPKA 3DV2A 5FX2A 1IJFA 4HZUA 1F8UA 1OCEA 2YXPX 1GDDA 1MAVA 3ZW9A 4NK5A 1MTOA 4RHUA 4NU0A 2WU4A 3EYAA 1UWVA 4X54A 1Z8FA 4JB0A 4JP3A 3U4GA 3UMFA 3GEEA 2IOFA 1YFZA 3AJAA 4BFUA 4F56A 3ROTA 5EJ5A 5AOCA 3QTLA 5AQEA 1TRHA 1D5WA 4II7A 4XGKA 3LSTA 3VV3A 1DEAA 4B3GA 2OGSA 4MHSA 4BC1A 2IOHA 4RTKA 4OSEA 4JB3A 2QENA 3NR2A 5B1DA 2VDWB 4Q1CA 1NATA 4G6ZA 1XDGA 3G8BA 2A3RA 2F43A 3K0EA 1E96A 3N0XA 4JR2A 4JJKA 4PYLA 4TWAA 4W5WA 4EATA 3E1SA 3M6WA 3SQXA 4EJMA 1NUQA 2RHTA 4YRMA 2NTVA 4CIAA 2H2IA 3TI9A 1P3DA 2BP7B 1P3JA 1R5JA 4L02A 1HYBA 2CXUA 4BVJA 1I7DA 1NR1A 4W1SA 1T5TA 3ZLJA 4I9HA 4YTEA 1R9MA 2BDEA 4F2WA 1GXSA 3KKOA 3LL7A 4M0EA 2IE8A 1Q95A 3L46A 5AK3A 5A05A 1Q12A 3R3XA 2ZIAA 2X7JA 1ZFNA 3GH1A 3H86A 2Y3IA 1T5BA 1FJHA 4IG4A 4GMXA 2QW1A 1DTWA 2O8FB 4RHXA 4TTPA 1BO6A 8LDHA 2FF7A 5KTOA 3ND7A 4YJHB 1Y4SA 2J9RA 4XE5A 3FVTA 1IVNA 1FSSA 1IQPA 4FQ7A 4OY3A 1EPUA 4PC6A 1M6YA 3GFPA 3TVYA 1N8KA 2RI0A 3HACA 3JQRA 1WW3A 3SX4A 4X3CA 5DXJA 2JLYA 2HLHA 3CBQA 1CUYA 1E5DA 1U3TA 2EX1A 2PL9A 3LUFA 1TEHA 4QHYA 3QXCA 5L7YA 5F9HA 3NB0A 3SX2A 1F5SA 3TAHA 1MCZA 2HWYA 1WB5A 4M0MA 4TYMA 5CFQA 4B2PA 5IHPA 1LWOA 2J0VA 4JQYA 1N34B 3FRIA 4B6QA 1X8JA 1M8FA 3R7NA 5ADVA 1G5IA 3D43A 3Q10A 1L5VA 2O7NA 4EA8A 5FWXB 2AGVA 5E9JA 5HNKA 3BSWA 3HY4A 2YASA 5FNVF 1D5CA 1ZESA 1I36A 3E7FA 2CD7A 5MDHA 1I5OA 4C2TA 3DA8A 3GLHB 5KTYA 4Q05A 4Y1GA 5H1YA 2IEGA 1W5SA 4CDNA 5KNBD 2QVZX 2FWNA 4GPIB 1R6DA 4UOEA 1U0RA 3ZCUA 4MWGA 3UT6A 3IVAA 4DRXA 5J43A 3BICA 1JTEA 2CK3D 2FK8A 1NYQA 1JZTA 3K4HA 4XYBA 1RS0A 3D7KA 1LRLA 5ARDA 1E69A 4CFZA 1JFTA 2A0FA 4BKMA 1KSHA 1SUBA 1XN1A 3NM5A 2IODA 2IY7A 3PJDA 5GWXA 1SUCA 2GPSA 5JAOA 1SOMA 1ZPDA 2VN8A 3WO1A 4BMXA 3PICA 5JRZA 1Z6TA 1W59A 1ZYUA 2FE4A 3NTUA 3IQZA 3SY8A 3T9BA 4AUMA 4DC9A 5ANRB 1GU0A 5C8YF 5TMPA 1PD0A 3U4MA 1NQWA 1XRRA 3FGOA 2P2SA 3DT6A 1E8DA 2ZFUA 5ENDA 3T4XA 3O1LA 5CVUA 5C8DA 3HL6A 2B78A 3EIQA 5E6SB 1R0YA 3KFLA 4HVLA 1SIWA 4KMOA 1RXWA 3DB2A 4N5NA 3A7EA 1P9OA 4NOKA 3VGPA 1ZAKA 3PDUA 1Z7EA 1JV2B 1YI8A 3TRJA 1X1RA 3BMQB 1U9YA 3FTDA 2XRMA 2WJGA 3GDOA 2EGUA 1OVMA 5HOQA 1PKEA 2HN9A 5A3VA 2YJ5A 3AF4A 1HYGA 1UBSB 5IW8A 2QUAA 4JHXA 1Z2CA 1LDNA 4U7PB 3LL4A 5GMOA 4ESHA 4DCVA 1WMBA 1TM3E 1MH1A 1U0FA 2ADMA 3MYYA 4HH3C 4IDAA 2CZGA 4NBVA 3WZ2A 3WKCA 2VDKB 1DRUA 1VXRA 4W8OA 3MF4A 3C14C 1GT91 2VPXA 3Q4GA 4JBNA 2EHDA 2P4UA 3V8VA 2PL3A 2NYVA 5I5GA 1V4BA 2D1FA 3SF0A 5JAIA 3GLGA 1KYXA 2P2DA 4Q37A 3A2KA 2G36A 2QRQA 4LOLA 3CNLA 1TA0A 4QUJA 2JG3A 1X3LA 1IVSA 5J2UA 5JXHA 2GB4A 1WUIS 3MGCA 3RUFA 1DI0A 4YAJA 2G16A 3TKLA 3ZVNA 4M9UA 3WSWA 4P4NA 4HVTA 4JL8A 1I3LA 4G86A 3SDBA 3DMRA 1K63A 3BMOA 1NL3A 3QWIA 4OPMA 1MO2A 2ZBEA 4D5EA 5IS2A 2CFOA 4F3CA 1IUOA 1F6DA 1QZXA 5DM0A 5HKOA 4N3AA 2W37A 2INGX 1PWEA 3BH0A 5JH7A 3GNLA 1QIIA 1ZK4A 4XXHA 4HQOA 4C7OB 2QE7A 4X84A 2XF8A 2QX8A 2VP9A 5CJJA 1DSSG 1S8NA 5KJ1A 4KQ6A 4ZJZA 2A9KA 4HGOA 4ZICA 4Q12A 1A9PA 1IOZA 1Y48E 2OXRA 5COAA 4FMCF 4YP0A 4Z4HA 3U4QB 1HR0B 1PD1A 3P9RA 4JGIA 4R9VA 1SUAA 3EBOA 1UEIA 1XU4A 1BD4A 2HCBA 2MWMA 4MLDA 2WKQA 4R9RA 4UM9D 1N4AA 5KNDH 2FUG1 4YI3A 1K2VN 1MAHA 3OFKA 3E8SA 4B74A 3UW3A 4CTJA 1EFVB 4ZQEA 3C8ZA 3AR5A 2I3DA 1NBAA 3HCPA 5DN9A 2BUBA 1QTIA 5IVPA 2AMJA 5AJWA 3TCNA 1WZUA 2I87A 4BVEA 3L4KA 3ZWBA 4BL5A 4FEYA 4KJXA 2ZQ5A 2PGJA 1QP8A 3DNMA 2IL1A 4ZT5A 1C9EA 1T8TA 3D8SA 2V54A 1EE2A 1VRWA 4ZARA 5HSGA 3THWB 2D2FA 1B14A 1CNMA 2ASEA 1WZEA 2B82A 2CJYA 3DJYA 3EIEA 3CR8A 4P4SA 1TCAA 3SJAA 5ITZB 5IT5A 2BKEA 2W5UA 4HTAA 3SQOA 4HAWA 4D8XA 4WT7A 5T3YA 2ZR0A 3EIFA 1EMDA 1FDVA 1NQ5A 2LVBA 1HFKA 2ZI9A 1B93A 1GDHA 1ZBDA 1QAOA 2RGCA 2I1LA 3MTAA 4OHRA 5FP0A 5G1PA 1OFHA 5EA2A 2P69A 4IS3A 4P35A 5JYDA 3E6AA 1WMEA 4F4JA 4YWHA 1WU8A 4B33A 4F4FA 3SC2B 4Q39A 1RPNA 4L07A 3IDSA 2IEBA 2OHOA 2C2ZA 1PI3A 2UYYA 3QYPA 4Z3KA 5KQLA 3CUKA 3GGOA 3RT1A 4PR0A 4A0SA 2X40A 4YJ2B 5JXIA 4K9DA 1ENZA 4QVGA 4GUDA 4HLCA 4I2NA 1HC7A 2I80A 5TQ2B 4WCFB 3QPUA 1CY1A 3THYB 1OTHA 1PZEA 2YIVX 2KX7A 1YRHA 4ZRNA 4BWVA 1U9IA 3NTXA 5IC6A 1XLTA 4L2IA 1THMA 1C9NA 3UMBA 1GJRA 1I4TD 3WRXC 2RBKA 5JH7F 2P2GA 3PIIA 3K05A 1PZMA 1GAJA 4Q00A 4NCAA 1NSYA 1RZVA 4FNGA 4E21A 4O2BF 3W5UA 2H65A 2I1WA 5HE9A 4ZD6A 5LQDA 1ZIYA 3KAPA 1ND5A 1R9JA 3ZU4A 1ILEA 4G0VA 3CFAL 3N2GA 3EXHC 4ATNA 3R74A 4E46A 5FORA 5L6LB 1L0BA 1KDVA 2F3TA 2W70A 3IGFA 3A1WA 1K5DA 2Q2NA 2FN8A 3S68A 2R751 2QJRA 4KPUA 1PS9A 1UZLA 3ISTA 5EFZA 2IZ5A 1QQBA 4BKOA 5JZ9A 1XCGB 3FPLA 1NP6A 1CY8A 5K0FA 2PEZA 6PFKA 2X5KO 3GAMA 4JOCA 1YDGA 1FTWA 1NLUA 3ZCPA 5FUXA 1BWRA 3IA7A 1RJ9B 1Q57A 3PHCA 1MZVA 3STTA 2H9AA 3DL2A 4LW8A 3FWYA 1JEYA 2QBYB 4PX2A 2A57A 4E70A 2FK7A 1FYFA 3F47A 5AXAA 4BYGA 1SC1A 1MOQA 3AKYA 3B51X 5FBKA 5KQMA 3EPJA 4KI7A 1PU2A 2VAPA 3EASA 3ZGNA 4AWAA 3HR4A 1FSFA 3WHKA 2AOUB 3DE6X 5CVEA 3CPEA 4X93A 4Z1MD 4EPWA 1UZUA 4CQNA 2Z9DA 1RZRD 1M5RA 2X4GA 2FHSA 2XEXA 1PJCA 1GPLA 1RC0A 2FSHA 3JWPA 4FJ1A 4PICA 4TM7A 2LBPA 2E4AA 2VJOA 2TRSB 1ITZA 4UU8A 4KXMA 1QXSA 4M86A 2O2IA 1FVXA 4M2LA 2AUTA 4JUAA 4TMVA 5AM1A 3WLTA 1U0BB 3HB7A 4XDGA 1W88B 4MAMA 4QYSA 1UKBA 1Y33E 3IDFA 4CKWB 3QKUA 5E38A 3ZQJA 3GZTB 3C87A 1P1CA 3VJRA 5AKGA 2LIVA 2RHMA 3PIRA 4E1VA 4C7JA 4MR7B 1NLMA 4C3OB 2G9RA 5A5VA 1U28C 3CKKA 1ECCA 2I4IA 1U2SA 3L7BA 4JELA 3ZBPA 3REOA 4D8WA 4Q9DA 3LE8A 2BKAA 2OXIA 2GSDA 1MNQA 2OCAA 3HCFA 4FYPA 4XR4A 1TCVA 2HWXA 3ED5A 5F7XA 4FM9A 4EJ2A 1N9KA 1W94A 4MV6A 1D1SA 4IIEA 3SNHA 5BSGA 5LWHA 3WBKA 3NNDA 1YFJA 1XRNA 1S2MA 1TVKB 1PGQA 4PCLA 2VP5A 2Y1CA 3HO6A 3GWZA 4OCZA 1OD6A 4F3YA 2I34A 3W77A 3Q7RA 3V3KA 1AKNA 1GDTA 1NDUA 2XNJA 2C3YA 4IMPA 5D3MB 4YK7A 3KE9A 3E3MA 4XYEA 4HNHA 3RTBA 3J81k 3WNQA 1DKLA 2CKMA 2OG2A 4E32A 3U39A 5DB4A 1DBIA 4GRDA 4OAQA 3ROZA 2L18A 3FTQA 2J1LA 4OXNA 5BR8B 1FK8A 3PGA1 4US1R 2Z8XA 5CT8A 5G4KA 3Q8LA 3ROXA 2L82A 4RDCA 4OHZA 2WD7B 3HZHA 1GGNA 3K35A 4CKBB 2H2DA 2ZSBA 4Q4AB 1NU8A 1UBEA 4EJ6A 4C3ZA 4GAEA 1QIKA 3AG5A 1RAAA 2QN6A 2NVOA 2O2DA 3HH8A 3P4UA 4LSZA 5D1NA 3JSAA 5CLQA 3S1SA 2IS6A 2C4VA 5TIIA 3IMGA 1P81A 5KWJA 2PGOA 4OXIA 5JYEA 3I1YA 2ZB7A 5E2AA 3ZHRA 1QVZA 5FR2A 2QLBA 3QVSA 1O03A 1Z28A 2SCUA 1LBHA 3L02A 2V65A 2WU3A 1ACMA 2GD6A 3MWEB 2Q6OA 5HTKA 4X65B 3TUJC 2B1RA 3AM3A 3MRVA 4Q4LA 3CE6A 1SCIA 1XEWY 2DMRA 2XUAA 2FQQA 2HMYB 2YBEA 1JTVA 3LLMA 5D7BA 4BE4A 4L57A 1RWVA 3V00A 1XTZA 1TXGA 2XNCA 5LDDC 2BEKA 1XF1A 2AYYA 1YCDA 2HD4A 4ZCIA 3VPFA 5IAOA 5CA0B 1HKUA 1F0KA 3W5HA 3G0DA 1PS8A 1RMYA 4FBMA 1XRPA 4M7RA 4O8ZA 4RIFA 3UVEA 5E3JA 2NU9B 3WMRA 3NDRA 4UBNA 3NX4A 2PKQP 2WIFA 3ZHZA 4AKSA 1FUIA 1XMJA 5IH7A 3NFRA 2Q5QA 1NIJA 1UJ2A 3TLEA 4NPAA 4FR2A 5EHXA 1ORHA 2I33A 3PNVA 4A23A 3FZQA 3H13A 3K1AA 3ICWA 4B84A 1BX1A 5CK4A 1CUBA 1DQPA 5K3FA 2J3LA 3WLLA 2CD9A 3R6GA 4ID9A 4Y9DA 5CLJA 2WT4A 1KQPA 4RIGA 1ZXXA 4K5QA 4HO1X 2JDIA 3L04A 1JIVA 2QRZA 4CHTA 4BO1A 1DO2A 1L4BA 4G8JA 3AQIA 4LMRA 4U2EA 2Z1NA 4XPIB 1GGEA 5P8WA 1Q6YA 2CUZA 3A3PA 1Y4DE 4NU5A 5CB4A 1UCFA 1WKVA 5IDXA 3I73A 3RT9A 1Y7HA 3A6ZA 1FMTA 5KX5F 3L7NA 1QUFA 4BB0A 3OPYI 3T3NA 1EB9A 4ZJYA 1AGNA 2XTZA 2FOIA 3M6MD 4LA4A 2W6ID 1QZ3A 1T3ZA 1GPWB 5DYNA 5LYJA 4B4WA 3PFBA 1IEVA 4F5EA 4N48A 4F2PA 2D0OB 1YKFA 3LBYA 4GF5A 3IBGA 2CBGA 4XWOA 5G0WA 1G8SA 2GPTA 2HHLA 3TTXA 4CM9D 3Q98A 2JGJA 5G0VA 2COKA 4K40A 3FHOA 3WDSA 3K3PA 4G0QA 3VPCA 4FQ5A 4GI5A 3T1OA 4KMRA 2ENWA 3H83A 4XWWA 3U5ZB 1P0FA 3DZDA 5KNDD 1TZ2A 4GLOA 3S55A 3SI7A 1GTSA 1E2JA 4CMGA 2RETA 1ULUA 4M0PA 1RZ3A 2GZ3A 3CCBA 1T8RA 4LXQA 2PQMA 3DEYX 3H99A 5I9BA 3TB4A 2IH4A 4URVR 2RGYA 2F62A 1AG9A 2Q4BA 4H15A 4PFSA 5DGIA 4H3KB 1NVDA 1FDSA 1EUCB 1ZGZA 3N53A 4Z0NA 4ZA2A 2JL1A 1N2GA 2VTVA 3GUHA 1BC5A 3H17A 4M9ZA 4AO8A 4DNQA 5IT4A 1VHTA 2JLZA 4PINA 2J67A 5TX7A 1ZS9A 2P75A 1CYDA 2H4FA 4EHIA 4R7ZA 2GAIA 1RPTA 1RACA 3FVRA 2ISSD 4FKZA 2WICA 3NHRA 1J09A 1AQNA 3L82B 4AJLA 5JTUA 3Q2IA 3UTCA 1KZHA 1X92A 3HB9A 2GNPA 2QM0A 3LVRE 2AR9A 4BY9E 2O2XA 2X42A 3CRQA 3W8FA 1P7CA 1FTSA 1ZVMA 3P27A 1SZPA 2HF8A 2W22A 1TEVA 2Q1UA 3FFWA 4OVKA 5EZ5A 2A9FA 4I3GA 3O74A 3G5TA 2GF9A 4OGGA 1IM5A 1JEQA 1JU3A 1NQAO 4U9HS 1R4MB 1PLJA 5AI6A 3ILHA 4YGYA 4O2RA 4C0QC 2G82A 3C45A 4UD6A 3VOBA 3GRPA 5DO9A 1BRMA 1Y4ZA 3Q8XB 2H4XA 3OZAA 1ID1A 3AI2A 3MTBA 3N2KB 1H66A 3ZKWB 5LYJF 2D5CA 3TEFA 4CU5A 3S0JA 1D0IA 1OTYA 1TVEA 3A6JA 1GYPA 2V4MA 2JGDA 3VPSA 1Q83A 5C0OE 3MFYA 2XRYA 3I2KA 4ZAFA 3ILYA 3ZCSA 2Y1XA 3PWZA 2I78A 2WAMA 2OCXA 3BRQA 4RU1A 4C4YA 5JO9A 3TLYA 4NEHB 5F4BA 1P7VA 4ZYTA 4TLEA 4F06A 4B3HA 2J9FA 5WRFA 1W5BA 4YDSA 1RMTA 4TMKA 4RTRA 4BX0A 2OC9A 4XFDA 1IZ9A 3W2HA 1U6KA 1AMNA 1U3UA 3SZ3A 2AN1A 3RIMA 4YASA 2OQVA 1DRVA 4HUJA 3TEJA 3PRYA 3O94A 3AERA 4M1QA 2PMEA 1YJ5A 2POQX 2F90A 3JALB 5DP2A 1H4QA 3I64A 4P2GA 3I9OA 5DHTA 4ZTUB 1TJYA 4P98A 1RQRA 3ABOB 4FINA 4YT4A 4TOIA 1USVA 1WW8A 2WOJA 3I6QA 4CQMA 1KDZA 5FHQA 4MS3A 1MO3A 2VRCA 1WSBA 4LVNA 3OQVA 1Z12A 1NW4A 5IBQA 5FAKA 1AKEA 5LLTA 3K2EA 3MUOA 3I72A 2YRXA 3VX4A 1KAGA 2F1RA 5IULC 4H17A 3GLGE 5A2GA 2R4UA 2XAUA 1ORIA 4K87A 5EQFA 2QYSA 1PUXA 2H9IA 3UW1A 2V0CA 3K0AA 1C3VA 3OC6A 5F76A 4EUKA 1R4AA 1JE1A 3P1JA 3F74A 2GNOA 4KQ2A 1IPEA 3I5MA 2W9XA 4AMBA 1OFVA 5BSHA 3ZHQA 1WXHA 3RUEA 1YRWA 4HKTA 4Z86A 4BEBA 5KVVA 3AI7A 4Y3UA 1MNAA 2QTNA 1ICIA 4OB7A 4Y6RA 2O3QA 2R86A 5LSAA 3O21A 1LUAA 3RE1A 2EF0A 1KZ9A 3RHFA 1WNFA 3ZDCA 3E9EA 2A52A 1V48A 3QELA 4PO9A 4QPNA 4R3NA 4XB2A 3U80A 1DQNA 4WBXC 3VR3A 3W04A 1N78A 1P5ZB 3A06A 4AG3A 1H69A 1OZAA 1E92A 2VKQA 1E66A 4M8LA 1DLIA 4REOA 2PH1A 5SZJA 1EQUA 4A0QA 4DEVA 1ORDA 3I0MA 4HI0E 3ROKA 5CFPA 4CL2A 4N6NA 2XVMA 5ALOA 3SHVA 5BN3B 2XCUA 4KR2A 1T8SA 1C50A 3CURA 4HWSA 1XPRA 3IAUA 3K1TA 4EGQA 4ESEA 2CHGA 1O95A 2AJCA 2C59A 3FH0A 3L7DA 3OIFA 4NE9A 4QUDA 4BFTA 1Z5NA 2FW7A 1QF9A 4UUQA 1KJIA 5DYWA 1MA0A 4N40A 3ZHUA 3G5MA 4GSYA 3IIEA 2PYDA 1VHWA 3WNBA 2GK3A 3EQ6A 4E22A 3B7WA 5K3BA 3MSXA 4MW7A 4HVCA 1TAQA 4G4SO 4C5BA 1HV8A 3E22A 1KKLA 5D3QA 1T36A 2YFQA 3DS8A 1NG1A 2PTHA 1L3CA 2VSXA 3ZEIA 2IYVA 5HJ2A 4F4CA 2OGZA 2NSJA 3W2GA 2Q2VA 8OHMA 3P9YA 4U3JA 4RVOA 1O6BA 2UXCB 4RY9A 3UHAA 2O2JA 3K30A 1N3LA 4J94A 2RAFA 1Y5RA 2NU7B 4KXLA 4L9WA 3LF1A 3AUAA 2BEWB 2QOEA 3K9QO 1W581 3BB3A 4LJ4A 5JCXA 4QU0A 1H93A 1OIXA 3EOAI 3ZIAA 4QQ8A 1NTRA 2OEPA 1C8LA 2VSNA 3UN1A 1CQJA 4FT4A 2Z6UA 1V11A 3DDZX 2AKEA 2E6UX 2UUCB 2Q5HA 2VCYA 1DXHA 1QH0A 1TIKA 2EJUA 1OYWA 3KDSE 5AI4A 4H6XA 5CURA 2XW6A 3OT5A 3OZSA 4WZZA 4YRGA 1DADA 1ZUHA 2HO4A 4KR9A 2BIFA 3A1VA 1EP3B 3IT2A 4B35A 2PZBA 1Y34E 1RC8A 3GPIA 5JQGA 1HLPA 3FNEA 3KZMA 4XX0A 4UREA 4XLLA 5KDLA 4YUYA 4GT1A 1XLVA 1KC1A 4YCBA 4WK2B 4TROA 4ZMSA 3AVUA 1XL0A 1H1DA 2C9CA 1ISGA 2NXNA 2P4EA 4DM4A 4Z7OB 5ARBA 1QRDA 1M2EA 3WIOA 1KTIA 3KPYA 5C8ZA 3PB3A 1C0PA 1T10A 4EF5A 1DJMA 1YOBA 3NWBA 2ARKA 1DO0A 3O91A 4I9GA 4ZAXA 2I71A 3EZYA 3VDMA 3VZDA 1X7WA 1ORWA 2QZJA 3L07A 3UK7A 4W5JA 2IUYA 1KFKB 4ZP1A 4DUZB 4HWOA 1BCSB 1I4EB 1T0JB 1VYVA 4ITRC 2Q2QA 1VSQA 3TKAA 2DR0A 3BWEA 3DWIA 5HQJA 1K7EB 2Z8YA 3K73O 3T3HA 4BMNA 4XOUA 2C82A 1G21B 1LI7A 4RIEA 3TQQA 2ZRDA 3BIOA 4QYXA 2IBTA 3WMEA 3VPDA 3ZXYA 1SOVA 4H3SA 1U0SY 1QGOA 1S7GA 2ZUDA 5EXXA 3SYLA 3X1XA 1L8XA 4TYYA 2D62A 3C5WP 5A4DA 2CXSA 2ATVA 3F9IA 3NOXA 2MYPA 4MV5A 3AIIA 4PWYA 1GYRA 4QL3A 1T9GR 1ZCBA 2WYIA 2FW9A 4LY6A 1RLUA 4RV4A 2A56A 4LGYA 5LP6A 3Q8KA 1WMDA 1BE1A 2E4YA 4G1MB 5EE0A 4JQSA 4HGYA 4NMWA 5DGHA 4F8EA 5L4LA 3GLFB 3WVNA 2HBZA 4XUCA 3DC7A 1M67A 1I1HA 1FNSA 3DW1X 1W0JA 1FEZA 2TYSB 4HEHA 2I52A 1U9CA 2RI6A 4X63A 5LXTF 4ETMA 4UM5A 3LCVB 3RYFB 2PRKA 4W9NC 3ANSA 2OENG 2P5SA 2Q9AA 4YJ3B 3KR1A 2FPOA 3ESZA 5HDQA 4K81B 1RXIA 1HRDA 4OREX 3HZZA 2XKBA 3ITKA 5BPFA 5KYXB 4D6XA 1JHUA 2WHRA 1GL3A 3W2EA 2XZLA 1E5XA 1UANA 3DTVD 4QBKA 4KPYA 5FQNA 2W2LD 2HJHA 5FOWA 4U5XA 3NEJA 2VUUA 1Q7RA 5IDYA 3ETNA 1EFCA 2LUOA 5IVIA 4F3NA 1CUAA 1XPUA 4C78A 2GEFA 2XJ4A 1EEHA 1MBZA 1SO8A 1Y9ZA 5B53A 1E4EB 2YXLA 4GX2A 1VLQA 2PKEA 2J33A 1FVOA 2ORYA 1VL6A 3HBMA 3KZ1E 1VJCA 1VHLA 2QL7A 1HXHA 2D2VA 3LQYA 3IRUA 4A91A 2XGOA 1TYDE 4I1OA 4DUPA 4P5DA 1NBEA 2O8VA 3F1KA 4KXFB 2BMEA 3D1JA 4AROA 1YBHA 4M7PA 1KP9A 3A26A 4LG1A 3ROGA 7REQB 3F4LA 3L84A 3PHIA 3LCMA 1V0JA 1RIIA 1T5HX 3CF4A 3WZLA 4GWGA 1JPNA 2ZVDA 2WMYA 1N0HA 1BOFA 2QTGA 3EWAA 4LDNA 1LLQA 3ZIDA 4RGBA 2WR8A 3RS8A 3KAKA 3HU2A 5AJZA 2R85A 4E12A 3JATB 3OFND 5L3QA 3ZD7A 4G0OA 4H4CA 5KJCA 2VP3A 4UNSA 1SD5A 2DHEA 2JANA 3O8OB 3OZEA 1B8UA 3QV1A 2R8ZA 4GM0A 3NGLA 1XOIA 4AI6A 1B6TA 2VAMA 4XVUA 4KE9A 2XXBA 2ZI4A 3O8CA 2GLXA 3CR7A 3L41A 2PJZA 3PQFA 3R7FA 1JSZA 3F5SA 1G2OA 3LLCA 3ZHCA 1QTNA 1EVZA 5LP6F 4KR3A 3CRZA 2I62A 4DXDA 3AHDA 3FIUA 2EFHB 2PT7A 4H35A 4AECA 1W4LA 4J7UA 5A1TA 1U8FO 4IV0A 4FGSA 1V8DA 5FTJA 4LDJA 4LECA 5A02A 1NI5A 2E1RA 3K9LA 3NBQA 1E0DA 5FPPA 4L5IA 3TBFA 3AV3A 3WISA 5DBFA 5E6UA 2VH1A 3EUAA 3IDOA 2RJ3A 2GR7A 1PQWA 1OX4B 821PA 1VJTA 3UOGA 3EB9A 1KZGB 2ECQA 3P9SA 4Y2XA 4X8MA 1ZOPA 5TGDA 4DMUB 5JIBA 4B9EA 2C5AA 3ACDA 3D2LA 4MGZR 2J85A 4KFSA 4MQLA 4UUPA 3LUJA 4Y2QA 1IN4A 1U2DC 3CRRA 2VBIA 1E0SA 2JFUA 3Q6IA 5H82A 5L51A 3V2HA 4P08A 2Q3BA 4W1RA 3OOWA 1KRXA 3A6KA 3QQ5A 5E2IA 1F8YA 3RS7A 1L5YA 2QRJA 2X4IA 4I1YA 1X2EA 2C9DA 3F46A 2PMKA 4KK3A 4ZAZA 3TNDA 4IH9A 1RADA 5KNBA 2E5FA 4BB9A 5BMVA 3R5HA 2WT8A 5AQ1A 4GDMA 2Q4TA 3E1GA 4LFCB 4Z4GA 5JDCC 3DOHA 1HH4A 1XWFA 2C3MA 4BZQA 1Q44A 4EEKA 2NG1A 2B7CA 2CK3A 2J8ZA 2PUJA 2QGZA 4MGIR 5TVGA 1MUUA 3GJ7A 4AUEA 4CJXA 2ECOA 5MFPA 3QXXA 3IEPA 4H27A 2NTEA 4IDQA 2PZKA 4HEA1 1H0KA 1PLLA 4KNWA 4A9AA 5LBIA 3RU3A 2A4KA 3PV0A 4I4TB 3AEZA 3VNVA 1PHPA 1S9HA 2D1SA 2PKCA 5AKKA 3SMQA 5M5BA 4LXYA 4C0XA 4X9XA 3O4RA 5CP8A 2OQ2A 3HL4A 5DBIA 1HE4A 1A7KA 3FWPA 2COUA 4TKUB 3VU8A 3ZE2B 4LXGA 3W5IA 1LPPA 2HEGA 3R0JA 4LV6A 4H6PA 4DBLE 4DA4A 1L5ZA 4IMRA 3KOZA 1NX6A 4PZEA 4GOOD 2EFCB 4ZPJA 1Y8RB 2VOEA 1NT2A 2WJVA 4I6JA 5KUTA 2DRIA 1Z2EA 3P5BA 1TK2A 2LRHA 1WG8A 3A36A 3IV6A 3ZNNA 2XWJI 1FQKA 5CXSA 4ALNA 3HNRA 4D8TA 1XRJA 4G4JA 4CMHA 3KO8A 5AVTA 3KQQA 4UTRA 1W8DA 2FAXA 3RVJA 4JBGA 4UEWA 4YRNA 3WRWA 5IYZB 1VJRA 4HNTA 2GLUA 1KNQA 4KE8A 2NXEA 2X8JB 2VJYA 2C2OA 3IX7A 1IZYA 5LMUB 3UMMA 3IL2A 2YZ2A 1VIDA 2ODPA 4QELA 3GZNA 3M6AA 3R0QA 1K8ZB 1L4KA 2OCPA 3MJRA 4NSNA 4BO3A 3U3XA 5LOVF 2IWRA 4BGDA 4MIEA 2PX5A 3D2BA 1ZM9A 1RP7A 4QOFA 4WESB 3SKYA 5DXAA 1QIEA 3GD7A 1IQRA 4PXSA 2OY0A 4AS3A 3OSZA 3BGIA 1CQIA 5IHXA 3H75A 3RIYA 5J3JA 2E4UA 3H4MA 2MR6A 2PBFA 4IJMA 1K86A 2QN3A 3P4XA 1XJ0A 1J9GA 2HSZA 4KIWA 2XXAA 3QV2A 4PTLA 3ACBA 2FWIA 2GPYA 2JH9A 1Z4MA 3FCYA 5M29A 4EARA 3S40A 2DZDA 4Q1DA 4JJZA 4EG0A 5KYWA 3F5MA 3KEOA 1YUNA 2HSWA 4BNLA 3DBRB 5LBUA 3FRJA 1U65A 3ZCVA 2C7PA 1PJBA 2ZJOA 3U7IA 3VPHA 2BWJA 2Q8QA 2RDMA 4EGSA 4Z0PA 1N5RA 3BMXA 3BX1A 4Z9BA 4INAA 2TECE 2EEZA 2PBLA 1NIPA 4KYVA 4UBJA 5FI5A 4ZGWA 4AP6A 3CEMA 2PYZA 2IXBA 2QAGB 1JH8A 4XTCS 1PQPA 1PNTA 3Q72A 1MJGA 2BMVA 1IAQA 2WUWE 3AVQA 4HDSB 3VH4A 2YMLA 3GGDA 1AU9A 1IBKB 1X86B 5BOSB 3KQUA 4RJLA 2ISQA 1QZTA 2P2ZA 3HN7A 1FS4A 1BXGA 3ASZA 4FOTA 4NNJA 3T5MA 1T6YA 2ZI3A 1JDBC 2QTLA 2QTZA 4Q03A 1JE0A 4WL0A 5EJGA 1USKA 5KWVA 3FKJA 2F4VB 3F8TA 4TV8A 5LQJA 4AKIA 3KK0A 3M9LA 4WKCA 1EXNA 3WIEA 3FCEA 1N3IA 2HRDA 2VK4A 3O4IA 4QVIA 3IKTA 1NAHA 1QVVA 3EAGA 3MLBA 1JG1A 3CZMA 4IZIA 5JJKA 3ELWA 5E9WA 1OF1A 3B1VA 5JDIC 1XD2A 1PVOA 1ZIDA 1GU1A 3QKSA 2YY5A 1G8HA 3BCSA 1XTTA 4QG7A 1KZYC 2QLMA 2B5WA 2PDAA 2Y1KA 5IVDA 2B8TA 1YBVA 4J7CA 1G60A 4J29A 5E1OA 3K5IA 1ZD9A 2XNSA 2SNIE 4I50A 4BVLA 3ABZA 4RA9B 2ZWOA 4RK5A 5C5IA 5M34A 3FJYA 1ENOA 1KIAA 2XOKD 1QCZA 2PMFA 3LC2O 4P36A 4D4MA 1CR6A 1J8DA 3KQLA 3BWYA 3N1UA 1DE0A 2DX7A 1OLSA 3G0OA 1AN9A 4JLKA 3IUYA 4ZV4A 4PSDA 3EGXB 3HXTA 4QYIA 3G7NA 5EJMA 4AWXA 3OQJA 1BW9A 3KKPA 1Z5ZA 1BOOA 3F96A 4HATA 2ZUWA 3JQ9A 3KQWA 4JD5A 4NDZA 2A6PA 4U2GA 4ZI7A 4MVCA 3WI7A 1AGPA 4R71A 4TT8A 3A6LA 3SS8A 4M98A 4QKQA 2YS7A 3SIWA 1PBTA 2GQ0A 5SYMA 4INJA 1A9OA 7YASA 1PGJA 3ORRA 5BMOA 2H1VA 4J3NA 2PS1A 1ILWA 4YMUA 4AZVA 1ACLA 3A9CA 4CG3A 4MUJA 2DP4E 3HJTA 3U6BA 1YVPA 2HLDD 3FNGA 1NXPA 2G8LA 1Z62A 3BZBA 3LW8A 5BR1A 3T0GA 1V41E 1EK6A 2Y1OA 4ZMRA 2VTBA 1UBHS 3N70A 4QSMA 3KD2A 4OQZA 3NHFA 4RAOA 2BFMA 3A4YA 4TLLB 3QPCA 4DVJA 1I1OA 1JS1X 1RVDA 2E4XA 4UU7A 1K0FA 3DMFA 3VUFA 5DYGA 3JQ6A 1ZKDA 3H5IA 4JQZA 1PYOA 1QAQA 2A9JA 2AFHA 4FHCA 4M53A 2R3SA 3DEZA 3MHTA 1PJQA 4ZZ0A 2ZUTA 4UTOA 4QLBA 1M6HA 4I08A 4MXDA 4JGGA 4JL6A 2PIAA 1CCWA 3LQQA 4ZO9A 5K4AA 4BFWA 1E9SA 3IOMA 3SSOA 4QDOA 5AOAA 2A53A 4TV8F 4Q15A 3TKYA 4QUKA 2NYUA 3CINA 4YRIA 4AF8A 1U0HC 2OORA 4HQ6A 1V6AA 4RJJA 4TWJA 4HSEA 4Y9UA 1GSOA 3R5JA 4KUHA 4PYKA 2V3VA 1TQ2A 3D02A 4Z1MA 3FFBA 4DZZA 5FBWB 5HBRA 1PS0A 5BSTA 4MR8B 1PDVA 2BSXA 2VUHB 3GGJA 1HDYA 2Z5FA 2IUEA 2BJHA 4QXPA 2FR0A 3DLHA 1II9A 4I50F 2SKCA 4EMUA 2VP6A 3F90A 1KO8A 1HLDA 3I6YA 3MAGA 2QZ4A 5F7ZA 1FE8A 5FBZA 5K4HA 3K2IA 3LWBA 3F5DA 3E3AA 4MUBA 2RHBA 3BK7A 3D4LA 3VAZA 1HDGO 3CXUA 2XQJA 1DAKA 3QU2A 4G9EA 1QIGA 4OMUA 3QPVA 3GJRA 5CLLA 1AUQA 2BBSA 2ZE7A 3HWRA 4HMQA 3A9SA 3B6IA 2XT9A 4AZSA 4Z4FA 4LYDA 3D54D 3Q3IA 3UJBA 3CGGA 1GGJA 3TIGA 2FRXA 4ENPA 1GYQA 3QE9Y 4ZI7F 2HQOA 2L69A 3K09C 3K53A 4YFVA 1ZVQA 4E5KA 2CMHA 2ZATA 5ISMA 5CT9A 1QB8A 5J47A 4ARIA 2J9YB 4L9RA 3L0SA 2X13A 3VZPA 2OOSA 2ZYAA 2QV0A 4F6RB 4MKHA 2C7GA 1I6WA 1PJ4A 1GNTA 1J8VA 4MGKR 4B3SB 3WGZA 1M2OB 5KVQA 3EVEA 1E2LA 3FF4A 3NIDB 4G0YA 4MOWA 4QASA 1P4JA 4JB8A 4IR7A 1DNPA 5ALRA 5EZYA 3UANA 2VR1A 4C7MA 4TKVA 5JQWA 1AQJA 5D2CA 1KVUA 1JR3A 2C8VA 2DPGA 2CUNA 4HP8A 1C9JA 5IKMA 3T5BA 4DV3B 4MWZA 2WIKA 1ZN2A 1ATZA 1ZR4A 3ZQUA 2CBZA 4BNVA 4X3OA 1UQTA 1PZXA 2C92A 2KQUA 5I7AA 1HNNA 5F35A 4BZZA 3INTA 3EPKA 2IH2A 5JSYA 1XE3A 1U0TA 2CVQA 4WVLA 3V7FA 1B26A 5HRCA 3Q11A 2GPWA 1NE2A 1X3SA 1WZ2A 3IVRA 4DT1B 1JALA 1MQSA 1DAEA 4GQIA 4RMNA 5UKDA 3T5GA 1I0IA 1KSFX 4INZA 4IWXA 4M38A 2GD2A 1ODLA 2QL5A 1G20A 3ITEA 1SKYB 3H9GA 4JJ4A 4GO1A 4HMOA 3VBCA 2EKQA 4IX1A 5ENVA 3IIIA 1WCYA 4XUGB 1I32A 4GXQA 3EFOA 3KYIB 3GP8A 1UPFA 3KLPX 4NI5A 3T8YA 4TZ6A 1E1QD 5EQTA 3PFHA 1AOXA 1JB9A 1U3GA 3VVBA 4B0PA 4IDEA 4POOA 2VHVA 3IVMA 3FPKA 1I7QB 3A4TA 1J0AA 3NVKI 3CVUA 4OSOA 1VGRA 4RMGA 5EJ2A 4L5YA 4DY6A 3M33A 1IZZA 2R7NA 4HLQB 3U31A 3ZV4A 2ZCJA 1EGQA 4DBVO 1W85A 5I7WA 4L95C 1ZCAA 1YQ9A 3JASB 4ZEVA 4QU5A 1P60A 1PV1A 3UMYA 1UKZA 2JD2A 1G4AE 4JBWA 4ARSA 4EVRA 3V46A 1TYCA 4KU4A 3QE3A 4EJSA 3G0CA 4FHFA 3BAFA 3UJHA 4YBRA 1E2HA 2R7KA 4AO6A 1RXEA 3TLGB 4PU0A 1PCXA 3DOEA 4QLAA 5CD1A 1RQPA 1C9DB 3Q8WA 3ZZNA 2O8DA 5TR9A 2IIBA 4KLCA 3NHPA 1KO1A 2E1PA 3Q3HA 4AJJA 1PZHA 4GX0A 3J7AC 3RF7A 4A6EA 5EZYF 3S5UA 2G77B 4JOSA 4BZWA 3U0VA 3VVMA 5HR5A 4GYWA 3RHSA 2HJSA 3A4VA 4NZYA 5SYNA 4NJEB 2WTMA 2JLWA 2Y1WA 5HHTA 1IEQA 2C54A 1KRWA 1DIRA 1KBZA 4MS4A 5AW5A 4OJNA 2OYCA 4EB6A 5B2EA 2Q1SA 2X8AA 3WDKA 1T9DA 4AJIA 3U5TA 5KJEA 3UXMA 3E9CA 2F7SA 3U3JA 1S3IA 2XHEA 4QA9A 1ZD3A 4B4OA 1GQ2A 2GERA 5EZQA 2RH4A 4DC1A 4BWFB 3CT6A 4C29A 1V71A 1XZ8A 1E1MA 3DEAA 4RHCA 1DFIA 2XA9A 1OPXA 3OA2A 4PN3A 5FL7A 1ONNA 1VLMA 4I55B 1TCBA 3F97A 2WTAA 2ZRLA 3AEYA 3X1ZA 4BYMA 2IZOA 5ALXA 2HCRA 2DPXA 4Z54A 1PFGA 1RM0A 1XYVA 1XKQA 2W2VA 3HKEB 4J1SA 4LI0A 1U0NA 3HCRA 3AM5A 3AILA 2WWHA 5FA5A 3RB8A 3V97A 5C4GB 3F49S 5BUQA 5KNDA 4P3KA 4XRGA 3EJ6A 5JS8A 3BE8A 1K3TA 1IBLB 1V3UA 1DC7A 1GPDG 1GKYA 4IILA 1CY4A 2XB4A 4ZODA 5EWLB 4C6TB 3CVOA 5TNXA 2D74A 3T9EA 1WCIA 5THKA 5DNAA 2Z9CA 2OLEA 3BSFA 3ESAA 4U00A 4FC7A 3E5HA 3AUJB 3QFFA 4CCYB 1XZLA 3EUWA 4UOZA 4OYYA 4DUGD 4RDXA 2R1VB 1RW4A 2LIPA 1F2DA 4L0DA 2JGFA 3E70C 2RBGA 1K7SN 3FYTA 5DNCA 2PXCA 1TW3A 2ZIUB 3V2IA 1SOWA 5TGTA 3M70A 4LF6B 3TN7A 4DG9A 1TMYA 5A7FA 3HEBA 5CDTA 3MTJA 3OOSA 3W6OA 4K28A 4IXJA 3P9QA 2ZG6A 4ZHQB 1HURA 2F64A 3K6RA 3E0QA 3KYDA 1A2OA 2PZFA 1NN0A 5GZ3A 1RJFA 3KJZA 3R7BA 1PJ2A 3KQOA 1F51E 3L8EA 3U7FB 4G5XA 1SMKA 1QH9A 4P81A 1L6RA 1TJ5A 1ZH2A 2AQ8A 2CXHA 2FMUA 1WSDA 2P77A 2Z4SA 4H1VA 4NATA 2NACA 4KI0A 1DBVO 1QTRA 1WEHA 4RHEA 4S2EA 4B1FA 4DIKA 2DUJA 5LUAA 1X7YA 3OHMA 2FUCA 3IEIA 4EX7A 5U1PA 2VZEA 3DVSX 2I54A 2JGKA 2ZAGA 1PJZA 1QO0A 2CMDA 1IDOA 2Q3JA 2WTBA 3BB4A 4LHSA 4MR9B 4UBKA 4ZCQA 3V42A 4DDWA 4M1EA 4P3OA 1L7NA 4JR1A 3SF8A 3TGLA 5FOTA 3AJ8A 4P93A 4ROTA 1E63A 4N12A 1Q1EA 3H7AA 3TLBA 2QW0X 1BWQA 2VDVE 3FW1A 3NORA 1UBRS 5JSZA 2OHIA 3KTOA 4WK0B 1F9AA 2PXHA 5DW3A 3JQFA 5IZCC 4OB8A 3NYQA 4IS2A 2VDNB 1N5LA 4BLUA 1V8FA 1SUPA 3F8WA 3OQIB 4WSOA 2ZK7A 3CZRA 5ALEA 4DXHA 2O8CB 2DUMA 2I03A 2QT9A 3H9CA 3M9WA 1IY0A 2HWWA 3SMVA 3T7KA 9ATCA 4LF5B 2EFYA 3JPWA 1FMJA 2IXAA 2GZAA 3E5MA 3NONA 5SZIA 4LE2A 4ZCMA 1ZA2A 2ZJ2A 4R0NA 2ZTUA 1E60A 1JVNA 3F67A 1WCV1 2BTQB 3BTOA 5ENZA 4L4SA 4F8JA 3LG2A 5KYTA 1Y6QA 4EYKA 1D9XA 1M8PA 1UKEA 2IYTA 2ZJ3A 3DWFA 3HA5A 4Z8YA 4IDDA 3TLAA 4E2FA 2XUOA 4PSKA 3S99A 2HSEA