3UA0A

N-terminal domain of bombyx mori fibroin mediates the assembly of silk in response to ph decrease
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
83
structure length
79
Chain Sequence
FDEDYFGSDVTVQSSNTTDEIIRDASGAVIEEQITTKKMQRKNILGKNEKMIKTFVITTDSDGNESIVEEDVLMKTLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroin heavy chain
publication title N-Terminal Domain of Bombyx mori Fibroin Mediates the Assembly of Silk in Response to pH Decrease.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Protein fibril
total genus 1
structure length 79
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.60 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3ua0A00
3UA0A
chains in the Genus database with same CATH superfamily
3IODA 3UA0A 3QTTA 4MUIA 2A52A 3COWA 1V8FA 2G5ZA 1N2JA 3MXTA 3COVA 3CFAL 4DDKA 2X3FA 3IVXA 4DDMA 2A56A 3CFIA 5HG0A 5KWVA 2GW4A 2A54A 2I52A 3Q12A 3IOCA 3INNA 3IVGA 3AG6A 3N8HA 3CI0I 4MUJA 5EXCA 2A53A 3COZA 3HL6A 3CFHL 3IVCA 3LE8A 3IOEA 4G5YA 4MULA 2GR8A 3UY4A 2RETA 3UK2A 3CFFL 3IUEA 3IMEA 3LF4A 4DE5A 1MOPA 1N2IA 3IMGA 4EFKA 3MUEA 4G5FA 2G2SA 1IHOA 4MUGA 1N2BA 1N2OA 3AG5A 3CI0K 2A7XA 2G16A 3EMOA 2IECA 4MUEA 4FZJA 2A84A 4EF6A 2A86A 4IXJA 3Q10A 3ISJA 1N2EA 3IMCA 2GR7A 5G2FA 1N2GA 3IOBA 2A50A 3COYA 4MUFA 4MUHA 2A88A 4MUKA 2OGFA 4MUNA 2G3DA 4BHRA 2LMEA 1UFVA 2EJCA 5BW0B 4MQ6A 4DDHA 1N2HA 3IUBA
chains in the Genus database with same CATH topology
3IODA 3UA0A 3QTTA 4MUIA 2A52A 3COWA 1V8FA 2G5ZA 1N2JA 3MXTA 3COVA 3CFAL 4DDKA 2X3FA 3IVXA 4DDMA 2A56A 5KWVA 5HG0A 2GW4A 2A54A 3Q12A 3IOCA 3INNA 3IVGA 3AG6A 3N8HA 4MUJA 5EXCA 2A53A 3COZA 3HL6A 3CFHL 3IVCA 3LE8A 3IOEA 4G5YA 4MULA 3UY4A 3UK2A 3CFFL 3IUEA 3IMEA 3LF4A 4DE5A 1MOPA 1N2IA 3IMGA 4EFKA 3MUEA 4G5FA 2G2SA 1IHOA 4MUGA 1N2BA 1N2OA 3AG5A 2A7XA 2G16A 4MUEA 4FZJA 2A84A 4EF6A 2A86A 4IXJA 3Q10A 3ISJA 1N2EA 3IMCA 5G2FA 1N2GA 3IOBA 2A50A 3COYA 4MUFA 4MUHA 2A88A 4MUKA 4MUNA 2G3DA 4BHRA 1UFVA 2EJCA 4MQ6A 4DDHA 1N2HA 3IUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UA0 A; 
#chains in the Genus database with same CATH topology
 3IOD A;  3UA0 A;  3QTT A;  4MUI A;  2A52 A;  3COW A;  1V8F A;  2G5Z A;  1N2J A;  3MXT A;  3COV A;  3CFA L;  4DDK A;  2X3F A;  3IVX A;  4DDM A;  2A56 A;  3CFI A;  5HG0 A;  5KWV A;  2GW4 A;  2A54 A;  2I52 A;  3Q12 A;  3IOC A;  3INN A;  3IVG A;  3AG6 A;  3N8H A;  3CI0 I;  4MUJ A;  5EXC A;  2A53 A;  3COZ A;  3HL6 A;  3CFH L;  3IVC A;  3LE8 A;  3IOE A;  4G5Y A;  4MUL A;  2GR8 A;  3UY4 A;  2RET A;  3UK2 A;  3CFF L;  3IUE A;  3IME A;  3LF4 A;  4DE5 A;  1MOP A;  1N2I A;  3IMG A;  4EFK A;  3MUE A;  4G5F A;  2G2S A;  1IHO A;  4MUG A;  1N2B A;  1N2O A;  3AG5 A;  3CI0 K;  2A7X A;  2G16 A;  3EMO A;  2IEC A;  4MUE A;  4FZJ A;  2A84 A;  4EF6 A;  2A86 A;  4IXJ A;  3Q10 A;  3ISJ A;  1N2E A;  3IMC A;  2GR7 A;  5G2F A;  1N2G A;  3IOB A;  2A50 A;  3COY A;  4MUF A;  4MUH A;  2A88 A;  4MUK A;  2OGF A;  4MUN A;  2G3D A;  4BHR A;  2LME A;  1UFV A;  2EJC A;  5BW0 B;  4MQ6 A;  4DDH A;  1N2H A;  3IUB A; 
#chains in the Genus database with same CATH homology
 3IOD A;  3UA0 A;  3QTT A;  4MUI A;  2A52 A;  3COW A;  1V8F A;  2G5Z A;  1N2J A;  3MXT A;  3COV A;  3CFA L;  4DDK A;  2X3F A;  3IVX A;  4DDM A;  2A56 A;  5KWV A;  5HG0 A;  2GW4 A;  2A54 A;  3Q12 A;  3IOC A;  3INN A;  3IVG A;  3AG6 A;  3N8H A;  4MUJ A;  5EXC A;  2A53 A;  3COZ A;  3HL6 A;  3CFH L;  3IVC A;  3LE8 A;  3IOE A;  4G5Y A;  4MUL A;  3UY4 A;  3UK2 A;  3CFF L;  3IUE A;  3IME A;  3LF4 A;  4DE5 A;  1MOP A;  1N2I A;  3IMG A;  4EFK A;  3MUE A;  4G5F A;  2G2S A;  1IHO A;  4MUG A;  1N2B A;  1N2O A;  3AG5 A;  2A7X A;  2G16 A;  4MUE A;  4FZJ A;  2A84 A;  4EF6 A;  2A86 A;  4IXJ A;  3Q10 A;  3ISJ A;  1N2E A;  3IMC A;  5G2F A;  1N2G A;  3IOB A;  2A50 A;  3COY A;  4MUF A;  4MUH A;  2A88 A;  4MUK A;  4MUN A;  2G3D A;  4BHR A;  1UFV A;  2EJC A;  4MQ6 A;  4DDH A;  1N2H A;  3IUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...