2LMEA

Solid-state nmr structure of the membrane anchor domain of the trimeric autotransporter yada
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
105
structure length
105
Chain Sequence
GDQASWSHPQFEKGAHKFRQLDNRLDKLDTRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRSSQALAIGSGYRVNESVALKAGVAYAGSSDVMYNASFNIEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesin yadA
publication title Membrane-protein structure determination by solid-state NMR spectroscopy of microcrystals.
pubmed doi rcsb
source organism Yersinia enterocolitica subsp. enterocolitica
molecule tags Cell adhesion
total genus 18
structure length 105
sequence length 105
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03895 YadA_anchor YadA-like membrane anchor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.30 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 GSPII I/J protein-like 2lmeA00
2GR7A 2RETA 3EMOA 3CI0K 5BW0B 2LMEA 2GR8A 3CI0I 3CFIA
chains in the Genus database with same CATH superfamily
3ISJA 4EF6A 1N2JA 4EFKA 2G5ZA 4MUNA 3IOEA 4DDKA 3HL6A 2I52A 1N2GA 2A54A 2A86A 4FZJA 2EJCA 3Q10A 3UK2A 3LE8A 2IECA 2GR7A 2A84A 3IODA 3Q12A 3IMEA 2RETA 4MUFA 2GR8A 5HG0A 2A53A 4G5FA 1IHOA 3CFHL 4DDMA 1N2IA 3COZA 1UFVA 2G3DA 3IUBA 3MXTA 2A7XA 3CFFL 3IMGA 4DDHA 3LF4A 5G2FA 1N2BA 4BHRA 2A88A 4IXJA 4MULA 3IMCA 1N2EA 3IUEA 4MQ6A 4MUIA 3AG5A 3IVGA 3INNA 3IOBA 3COVA 2X3FA 3COWA 4G5YA 3COYA 5EXCA 1MOPA 4MUGA 3QTTA 1N2OA 3UY4A 3MUEA 5KWVA 2GW4A 1V8FA 3CI0K 3UA0A 3IVXA 3IOCA 4MUHA 3EMOA 5BW0B 3AG6A 2A52A 4MUKA 3CI0I 3N8HA 2G16A 3CFIA 2A56A 2LMEA 4DE5A 1N2HA 3CFAL 2OGFA 2G2SA 4MUEA 4MUJA 2A50A 3IVCA
chains in the Genus database with same CATH topology
2GR7A 2RETA 3EMOA 3CI0K 5BW0B 2LMEA 2GR8A 3CI0I 3CI0J 3CFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR7 A;  2RET A;  3EMO A;  3CI0 K;  5BW0 B;  2LME A;  2GR8 A;  3CI0 I;  3CFI A; 
#chains in the Genus database with same CATH topology
 3ISJ A;  4EF6 A;  1N2J A;  4EFK A;  2G5Z A;  4MUN A;  3IOE A;  4DDK A;  3HL6 A;  2I52 A;  1N2G A;  2A54 A;  2A86 A;  4FZJ A;  2EJC A;  3Q10 A;  3UK2 A;  3LE8 A;  2IEC A;  2GR7 A;  2A84 A;  3IOD A;  3Q12 A;  3IME A;  2RET A;  4MUF A;  2GR8 A;  5HG0 A;  2A53 A;  4G5F A;  1IHO A;  3CFH L;  4DDM A;  1N2I A;  3COZ A;  1UFV A;  2G3D A;  3IUB A;  3MXT A;  2A7X A;  3CFF L;  3IMG A;  4DDH A;  3LF4 A;  5G2F A;  1N2B A;  4BHR A;  2A88 A;  4IXJ A;  4MUL A;  3IMC A;  1N2E A;  3IUE A;  4MQ6 A;  4MUI A;  3AG5 A;  3IVG A;  3INN A;  3IOB A;  3COV A;  2X3F A;  3COW A;  4G5Y A;  3COY A;  5EXC A;  1MOP A;  4MUG A;  3QTT A;  1N2O A;  3UY4 A;  3MUE A;  5KWV A;  2GW4 A;  1V8F A;  3CI0 K;  3UA0 A;  3IVX A;  3IOC A;  4MUH A;  3EMO A;  5BW0 B;  3AG6 A;  2A52 A;  4MUK A;  3CI0 I;  3N8H A;  2G16 A;  3CFI A;  2A56 A;  2LME A;  4DE5 A;  1N2H A;  3CFA L;  2OGF A;  2G2S A;  4MUE A;  4MUJ A;  2A50 A;  3IVC A; 
#chains in the Genus database with same CATH homology
 2GR7 A;  2RET A;  3EMO A;  3CI0 K;  5BW0 B;  2LME A;  2GR8 A;  3CI0 I;  3CI0 J;  3CFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...