The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
105
|
structure length |
105
|
Chain Sequence |
GDQASWSHPQFEKGAHKFRQLDNRLDKLDTRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRSSQALAIGSGYRVNESVALKAGVAYAGSSDVMYNASFNIEW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Membrane-protein structure determination by solid-state NMR spectroscopy of microcrystals.
pubmed doi rcsb |
molecule tags |
Cell adhesion
|
source organism |
Yersinia enterocolitica subsp. enterocolitica
|
molecule keywords |
Adhesin yadA
|
total genus |
18
|
structure length |
105
|
sequence length |
105
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2011-11-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03895 | YadA_anchor | YadA-like membrane anchor domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Pantoate--beta-alanine Ligase; Chain: A,domain 2 | GSPII I/J protein-like |
#chains in the Genus database with same CATH superfamily 2RET A; 3EMO A; 2LME A; 3CI0 K; 5BW0 B; 2GR8 A; 2GR7 A; 3CI0 I; 3CFI A; #chains in the Genus database with same CATH topology 3IME A; 5KWV A; 4MUF A; 3COZ A; 2IEC A; 3IMC A; 4MUH A; 1UFV A; 4MUG A; 2A86 A; 4MUN A; 1N2B A; 4G5Y A; 4DDH A; 2G3D A; 3IVC A; 3EMO A; 4MUK A; 4DDM A; 1V8F A; 3N8H A; 3IOD A; 3CFF L; 3CI0 K; 4EF6 A; 5HG0 A; 2A52 A; 3IOB A; 4MUJ A; 3IVG A; 3IOE A; 3COW A; 4MQ6 A; 2LME A; 3UY4 A; 2A53 A; 2X3F A; 2A7X A; 4MUE A; 1N2G A; 3LF4 A; 4MUI A; 2RET A; 3COV A; 4EFK A; 4BHR A; 2A54 A; 3LE8 A; 3IUB A; 3CFI A; 4G5F A; 3INN A; 1N2O A; 4DDK A; 1N2J A; 3HL6 A; 3MXT A; 2A56 A; 5EXC A; 4MUL A; 1N2E A; 2EJC A; 2OGF A; 3MUE A; 2GR8 A; 3IUE A; 2I52 A; 2A50 A; 3Q12 A; 3ISJ A; 3IOC A; 2G16 A; 4FZJ A; 1IHO A; 1N2H A; 3CFA L; 3CFH L; 2A88 A; 4IXJ A; 3UA0 A; 1N2I A; 5BW0 B; 3AG5 A; 3CI0 I; 4DE5 A; 2G2S A; 3IMG A; 1MOP A; 3COY A; 2GR7 A; 3IVX A; 2GW4 A; 2G5Z A; 5G2F A; 2A84 A; 3Q10 A; 3UK2 A; 3AG6 A; 3QTT A; #chains in the Genus database with same CATH homology 2RET A; 3CI0 J; 3EMO A; 2LME A; 3CI0 K; 5BW0 B; 2GR8 A; 2GR7 A; 3CI0 I; 3CFI A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...