3IOEA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.95 ang resolution in complex with 5'-deoxy-5'-((r)-3,4-dihydroxybutylthio)-adenosine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
286
structure length
286
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantothenate synthetase
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 92
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3ioeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3ioeA01
5JBNA 4GRIA 2PZ8A 4MW5A 4F4HA 1OD6A 1SURA 5IJXA 2XRYA 4MVCA 1WQ3A 1U7XA 2CYAA 2QUKA 3SP1A 3P0IA 2A84A 3ZGZA 4ZCSA 1O6BA 3CVYA 1KORA 1XJQA 4MUFA 1N78A 4XFDA 1O94C 1O5TA 1IVSA 1M8KA 3S3TA 1YUNA 3AFHA 1V47A 3QTTA 3HMQA 4MWCA 1O0BA 3K9WA 3C8ZA 4MW4A 1I6MA 1LI5A 2HZ7A 1N2BA 3A05A 4X0EA 3ZJTA 2VXOA 1U3CA 1F9AA 1U3DA 2CFOA 5DB4A 2QTRA 3PXUA 1OBHA 1H3FA 1QQTA 1K97A 1V8FA 1R6XA 3KT8A 3UY4A 3FG9A 1PG0A 4HPWA 3CLTC 1IQRA 5HG0A 1KH1A 1DNPA 1QU3A 2A1TS 1I6LA 1NUSA 3OTWA 4OUDB 4WNYA 1U0BB 4EG8A 1VLHA 3CVWA 3IVGA 1K92A 3Q4GA 1GPMA 1J1ZA 1ULHA 3G5AA 2PXHA 3ZJVA 3N05A 4OJMX 1N2IA 3IVCA 4FZJA 4EG1A 3MUEA 1WZ2A 3X1KA 2Z08A 1NUQA 4NAHA 1G8HA 3P0JA 3RK0A 3P52A 5K0TA 1JIJA 4JYZA 1VBKA 2X1MA 5KWVA 3QE4A 2VTBB 1R6TA 5LM3A 2RE8A 1J1UA 2I1LA 4CDNA 1MAWA 1T9GR 3RHSA 2QUJA 5FNZA 1OWNA 1JEDA 4HJXA 4ZT2A 3N8HA 3TQIA 2D13A 4EG6A 1QNFA 2YXNA 1N75A 1EE1A 3K32A 4KR9A 4EGAA 3DLAA 1EFPB 1EUQA 1G8GA 1O94D 1IFXA 1LI7A 2OV4A 1J20A 1N3LA 3LCJA 1GTSA 5DK4A 1XNGA 3PRHA 3RJZA 3X1MA 1ZH6A 3D6VA 2PFSA 3GLVA 4WSOA 4PBSA 5TEWA 2PIDA 4MAFA 4EFKA 5H7XA 4UZFA 4EG4A 1HYBA 1ZH0A 2E0IA 3AL0C 2ZUFA 2YWCA 3CR8A 2QJFA 4R2LA 3IMCA 1G59A 4DNXA 3IOBA 4NZPA 3TQOA 2WB2A 3ELBA 3CLTD 4MUKA 2J09A 4R2MA 3A04A 3CLSC 1NURA 1OWLA 1JIKA 1QU2A 1GN8A 1KAMA 5DASA 3NBAA 1F7VA 1YUMA 2OQ2A 3G6KA 3IH5A 4L2IA 2XRZA 1KQOA 4YP7A 3FY4A 1KH2A 4ND6A 1K4MA 3IUEA 3FDXA 2BTEA 2TS1A 5FO0A 2AKEA 3A2KA 1R6UA 2D5BA 4PBTA 2J07A 3N9IA 1N2OA 2A1UB 3G59A 4YP6A 1KQNA 4J76A 4NATA 1MOPA 1EUYA 1FFYA 4YBRA 1WXFA 2QTNA 2X1LA 3L93A 4MUNA 3Q12A 1TFUA 4KKVA 1D2RA 2DPLA 1LW7A 4KPUA 1YIAA 2QTMA 1J21A 2J4DA 5H16A 1YI8A 3BL5A 3CA8A 2DEUA 1G8FA 4TS1A 1EJ2A 1NSYA 3UK2A 4RUKA 5KHAA 2B7LA 3L92A 1VL2A 1Q15A 1H3EA 3FH0A 3ISJA 1MB2A 1WOYA 1NUUA 4QRDA 3MMXA 1QTQA 4I6EA 1K4KA 1QRUA 1F7UA 2CV0A 1M8FA 3IOCA 3DO8A 2D54A 4MUJA 1NUPA 3MLAA 1NZJA 1Q19A 4MW0A 5FO1A 3CVXA 1TYCA 2GKSA 4GU5A 1VBNA 3SZ3A 3INNA 2R5WA 5TGTA 1WQ4A 4ZT7A 3U1VA 2WQ7A 3CLSD 3QTBA 5IHXA 1F4LA 3P0HA 3CLRC 4YMIA 2O8VA 3FOCA 1WJGA 4MW9A 2CV2A 1TYDE 1JMVA 3JXEA 5J59A 3H99A 1WY5A 2PZAA 1N77A 1MB9A 3RK1A 1GZUA 4HJRA 4QREA 3IMGA 1H3NA 3LE8A 3H9CA 2IELA 4MVYA 2YWBA 1KP3A 3ND6A 4DDHA 1JGTA 4DDKA 1N1DA 4PBRA 3KT3A 1MBZA 1T9GS 2CUZA 1M1ZA 4A91A 3CLUC 3GMIA 4K0RA 2CYCA 4ZT3A 1CT9A 1JHDA 3FNRA 4EF6A 3X1JA 2A7XA 3H97A 1KAQA 1KP2A 4NX2A 1QJCA 1PFVA 2DLCX 3SEQA 1T6XA 3AG6A 1WXHA 3PNVA 2A4MA 4MUHA 1PFYA 3HGMA 4MWEA 3HZRA 4I6GA 2CT8A 1GLNA 2DETA 4AS1A 1UFVA 3H05A 1T6YA 2RD2A 1GAXA 1EXDA 3KFLA 4K03A 4XSVA 1Q77A 1XNJA 1JECA 3AG5A 4NDAA 4JXZA 1WXIA 4ZT5A 2QUHA 3CLRD 2E18A 1MJHA 1NP7A 2JA2A 1KH3A 1VBMA 1MRZA 1IRXA 3FIUA 3TZLA 3E27A 1NI5A 3MLBA 4MWDA 4S1OA 1OWPA 3A4IA 4RPIA 4YP5A 1RQGA 1KR2A 3ND5A 3VGJA 3UOWA 4EG5A 5EKDA 1I2DA 3LOQA 5AHWA 1ZUNA 3OP1A 1KKUA 1ILEA 5HUJA 4JXXA 2WSIA 3CVUA 3ZJUA 1TYAE 3KT6A 2Z09A 4XFJA 1EFVA 3ZXIA 2IJGX 4DLPA 2WQ6A 2GM3A 4MULA 1NUTA 1WKBA 5TEVA 3SYTA 4MUIA 1U7DA 4DE5A 1MC1A 4KR6A 3ZUGA 1TYBE 4JZYA 2DXIA 1T6ZA 5HUHA 1QRSA 3CVVA 2V0CA 3CLUD 4MUEA 1M8GA 4U63A 2HGZA 3N2YA 1J70A 4Q93A 4OUDA 1KQPA 2H2AA 2IP1A 2AG6A 2CV1A 3UMVA 4CT0A 3M5WA 3IVXA 4U8HA 1X6VA 2DUMA 4MW2A 5BNZA 5K0SA 4AQ7A 4L2IB 4JFAA 2DERA 2X3FA 1IHOA 1B6TA 1O97C 1COZA 3GUZA 1OBCA 2E89A 3HV0A 4MLPA 5J5AA 1WXEA 3IODA 3HL4A 4MVWA 3SDBA 2VTBA 3IUBA 1Q11A 2A86A 2EL7A 2J08A 3SEZA 4UZEA 2E21A 5KCMA 1J09A 4DDMA 1EFVB 3NBKA 1H1TA 4I6JA 1YULA 1I6KA 4ARIA 3FI0A 2V0GA 2H29A 3COZA 2YY5A 2A1TR 1FYDA 3Q10A 1EFPA 4P2BA 1O95C 2O5RA 5DEOA 4KPUB 4KR7A 1JIIA 1OWOA 5J58A 3NV7A 3IMEA 3F3MA 4MW6A 4DJAA 2ZUEA 3DV2A 2DR2A 1MAUA 2X0KA 1N2GA 4MW1A 3TS1A 2EJCA 3TNJA 4MQ6A 2QJOA 3PNYA 3I05A 3ND7A 3D6UA 3ZXSA 1X8XA 2Z3VA 1WXGA 1P7PA 1JILA 4ZT6A 3TZEA 4R0NA 3VU8A 4G5YA 1O0CA 3SZGA 2PZBA 3MXTA 4H3SA 4ND7A 4CDMA 2ZP1A 1A8HA 4BWVA 2AZXA 2CSXA 1IH8A 5F23A 4MUGA 1IQUA 1IQ0A 4EG3A 3IOEA 1YIDA 2NZ2A 5LFAA 2BYTA 2JANA 3IDFA 3H9BA 1JEEA 5TS2A 3UC5A 4Q16A 1PG2A 4ZCRA 1S4MA 4ARCA 4ZCTA 3VRHA 3KT0A 1TQ8A 3AKZA 1N2JA 1O97D 4G5FA 1O96A 2NSYA 1JZQA 3FWKA 2C5SA 1PFWA 3HFJA 4HK4A 2A1UA 2G36A 1GTRA 2J5BA 3FHJA 4ZCPA 3RFFA 1QRTA 1OWMA 3ILVA 1M83A 4G6ZA 1NYLA 1JZSA 4QBTA 4U7JA 1O95D 3ZIUA 1BS2A 3COWA 4ZT4A 4MWBA 4CQNA 4EG7A 1TEZA 1M8PA 3FETA 2CYBA 4F3RA 4MW7A 4ZCQA 4E1AA 2A88A 5LLTA 3AIIA 3DPIA 2JAXA 3PNBA 4NAUA 2PG3A 1N2EA 2QUIA 1XNHA 1PFUA 1N2HA 3COYA 1Y42X 3COVA 4J75A 2HMAA 2QJTA 4PY2A 3RBAA 4MVXA 2GOYA 1M8JA 1O96B 1ZJWA
chains in the Genus database with same CATH superfamily
4P4GA 4IFEA 2FWAA 2A5FA 1TM2A 2NOAA 2O7RA 1J0AA 2I9PA 4JFRA 1ACLA 4RNDB 2X9GA 4Y3UA 3B38A 3U81A 3UC9A 5CYGA 4I50F 4FE3A 4OF4A 3LBHA 5JNLA 4F4FA 4WA8A 4CTNA 2ZI4A 3QVTA 4G2NA 1PI3A 1Q0LA 4W1QA 4EY5A 1OFTA 2VJLA 1UODA 1CVIA 4PZ0A 2QI9F 3BMQB 5EE1A 3ZVKA 5HZGA 2JFWA 4I5GA 2DYKA 3BHMA 3HB4X 2H0AA 2AN4A 4R9VA 1U7PA 2J0UB 2CHVA 1WLYA 1P6UA 2P69A 4OHVA 5IM4F 4NMLA 2WHEA 1DKUA 4IZHA 4LQ4A 4YRDA 3HPRA 5FFNA 2ZUVA 3NHJA 4MW4A 3WQRA 5BY2A 2XADA 1N2BA 2YRXA 3G5UA 1E1CB 4BHTA 2PPLA 4D43A 4HAXA 4EY3A 3L7MA 5DMXA 2XMPA 3GLRA 5B4UA 2HPHA 5D00A 2O2XA 1WVGA 3PQ8A 1BOFA 1U2PA 1L3CA 4B4UA 4BNMA 2I52A 2WU0A 2B34A 4FD3A 1J24A 1WU7A 2Q21A 3ITKA 4RPCA 3VR4A 4RTRA 1D2EA 1EE9A 3FFWA 1AGRA 3RYTC 5EJ5A 1VLJA 4XEUA 1NRXA 4ECAA 3I28A 3BF8A 2JJMA 2ZRDA 3KYIB 3NYQA 5I9MA 3HKBB 4Y9UA 3U3ZA 1ULZA 4TT3D 2WNHA 5DSTA 1I6LA 5LMCA 5I5EA 2NADA 3D8RA 1E2GA 2P0AA 3VAZA 3F4KA 2X9NA 1Y1TA 1JDZA 4JBLA 1IM5A 1NVBA 1HBJA 4H60A 3ZS8A 2MYTA 4GNRA 1R0SA 3KDPA 3IVCA 3BWXA 2ZAMA 4PRZA 3UW1A 4H7DA 1GAWA 5ES4B 5JXHA 3TBKA 3KJZA 4JXJA 2JIBA 2QRQA 3OUZA 2GCEA 4C0SA 1S3FA 2NPIA 3O75A 3G0OA 5JE8A 3BRWA 2OHFA 4L4UA 5K0TA 2JDID 4M1MA 1WU8A 2JH9A 3AW8A 3HJAA 1D6JA 4DYVA 2YN4A 4MQUA 2NVBA 1EQAA 2W2LA 2ZAIA 1A98A 1REQB 4BGVA 4LYAA 1JEDA 3HLYA 4ZT2A 3N8HA 4EG6A 4IV5A 4A0QA 5IS2A 2JBAA 1R15A 3N7AA 3R3XA 3UMFA 4IZIA 5JNWA 1MW8X 4GQAA 1QG4A 3JWHA 3H5WA 3PFKA 4RD2A 1JR3A 4KIWA 3ZV7A 4BUCA 2YN2A 2GN0A 4RU1A 4D6YA 1TM7E 4KUGA 5T5QA 5JAUA 4MEJA 1TEHA 3T54A 1LI7A 3SF8A 3W5SA 1TK3A 4L8WB 2C8LA 2XGSA 3R3ZA 4WACA 3ROKA 1WCIA 3UMSA 1V5FA 2DH5A 3TWOA 5C8DA 3TL3A 2Q4TA 2X5OA 2XYHA 3NB0A 1OILA 1RRGA 1ITZA 2EP5A 1XWIA 1EKXA 1LF5A 1V16A 3HCEA 4PYKA 2RFLA 3GFQA 4LYFA 4HDNA 1CX9B 4YPFA 2W4MA 4BMSA 4CDGA 3FDFA 2X86A 3UYKA 1EAMA 5ER9A 1M6NA 4Q24A 3H2JA 1U3TA 3PEVA 4Q7EA 5E38A 5JU6A 1CQZA 1CR1A 3R0XA 2BGIA 3AOEC 3KFXA 1FXWF 5K0GA 1G41A 3H2SA 1MGOA 2PEZA 4Q9DA 4RHCA 3KQKA 1K7FB 2VJYA 2V97A 3PC2A 2R2AA 4YRTA 2Y1FA 1JIKA 3JQFC 3ABIA 2NO5A 1I1QB 1Y1RA 4O2BB 4O2AF 5JG7A 4LY0A 2AIRA 1E69A 5IDXA 2FMKA 1GYQA 2IA5A 1K08A 4XYGA 2O5CA 3DP7A 4BFLA 3TLZA 4M8SA 5BW5A 1P4HA 2XUZA 3OZFA 4W5OA 2P2SA 1KXZA 5KU7A 1II8A 1E4OA 5A05A 3TQHA 3W9SA 5LQJA 2D5BA 2GZAA 3FOEC 1DEAA 2NTVA 2RHRA 3T41A 3VHXB 1N3YA 4CM4B 1G19A 1OXVA 1YB6A 1UBEA 3O5AA 3K1YA 1NTRA 3CX8A 3TB6A 1MVNA 4DYDA 2I6UA 5CH5A 3RE1A 2F1OA 4FKBA 3K9HA 1FF9A 1M2FA 1P0IA 3NQ41 2NX2A 4DG8A 1IWBB 2I7VA 1WXFA 3AEQB 5J40A 3THWB 2FGKA 3L93A 1MFPA 3CEJA 4RHEA 5HS4A 4FCWA 1M7GA 3I1FA 3MYYA 4G5SA 1SM4A 5CCDA 1FDWA 4MR7A 1I7SB 5EN4A 3VX3A 4TTJA 4FB5A 1PDVA 4BLSA 5CCXA 2DPLA 3Q87B 2G80A 1EHYA 1UMKA 5EP4A 2YHIB 3K6SB 1I3MA 3NHRA 1GTMA 1TKAA 2XNDA 3K1ZA 4WY2A 3ENVA 1KJNA 4BBJA 2AN3A 3F5DA 1XMIA 1BW9B 3CF4G 1XDBA 2NO0A 1TMGE 3AUTA 2V55B 1GUYA 3GN2A 3H2IA 5FORA 3GFVA 2E2WA 3ZHSA 2HLHA 3PR1A 1TVKB 2I22A 2H3HA 1UWVA 2GBIA 4Y6SA 5F4ZA 3STUA 2FF5A 1J0XO 2Q9UA 1PW7A 5ALOA 1ESMA 5FTMA 2Y2UA 4Q03A 5JAPA 4K9DA 4LZZA 4HZGA 1CYDA 1XK6A 4KQHA 5E4YA 2BAGA 2WWTA 2XCLA 3EYWA 4WECA 3H2ZA 3PS9A 2WT4A 1H5NA 2XJ9A 4M83A 5AW3A 1P1FA 2GO7A 3AL3A 1YR2A 4DMKA 1OC4A 2QXTA 1S2OA 4LNUA 1VGQA 3RF6A 1DQPA 4O2RA 4RM2A 3TRDA 3HB0A 3WDKA 4TTPA 2C9MA 3CISA 1Z62A 3WA7A 3E9ZA 1QF9A 3G0CA 1RWOA 3DVAB 4W5WA 5ERXA 2ODEA 3DYVA 3P0RA 4HDRA 1U9CA 2C5BA 2P2CA 3WYCA 4ZMSA 4KYTA 5K8TA 1OZGA 3GEEA 4LWPA 3B8EA 1SKBA 2HA7A 3RTBA 3RYFB 2XTZA 1N6IA 5DTRA 3F46A 3IKJA 1M6VA 4CZ2A 4TKVA 2RSLA 1W36C 1C7RA 1C4OA 1S5PA 4LZWA 4QYTA 3B3GA 4IHJB 4W7HA 4YECA 5D8DA 5IBCA 1UQTA 1KI1A 1KGSA 3A37A 3IELA 4QPCA 3A1SA 4CLHA 4ZYYA 1KGDA 1DB3A 1KOGA 2PKQP 2VNJA 3JD4A 3W5IA 4OFWA 1XPRA 2X8LA 1SBZA 1DZIA 1IOVA 2XT0A 5FFMA 4DEVA 2HSEA 2JI6A 3O91A 3JALB 2ZR8A 1DP4A 3IOMA 4JEMA 1U3UA 4MPDA 5F5LA 4DV3B 5FPSA 3RT1A 3UHJA 4BLTA 4D92A 2OM2A 4MKFA 3IBFA 4B85A 4TLEA 1PQUA 4G65A 3ROZA 3UCEA 1U0OC 5HWSA 3LHSA 2C5LA 2P1ZA 3KAQA 1NATA 1Y5RA 4JUFA 1EB9A 4FONA 1W75A 2GHRA 3SU8A 4LF5B 4C4RA 1X86B 5EP1A 5IKOA 1NW5A 3IAFA 3KQOA 4G5HA 1ZDMA 5A3QA 1WXHA 1T8PA 1WSDA 2EP7A 3IAUA 3EQ2A 3LHKA 5IYZA 4MUHA 1AIPA 1ZGBA 4KQCA 1V3VA 3QPCA 2RARA 4DANA 3O9MA 5FRDA 1C2TA 2EWWA 3HA3A 3DF7A 4UNQA 5EQTA 1ENOA 3L0OA 2MT9A 2RC6A 3S28A 4QYSA 1NQAO 3QLJA 1SXIA 1Z0IA 2D2EA 3LKVA 1G63A 1D07A 2ZYIA 3H05A 3HDVA 4M98A 4CJXA 4D0NA 2CE2X 4LJLA 5DLPA 5FWYB 5IN5A 5TC4A 2XZLA 4HSGA 4L3VA 4J0KA 4PYMA 5K8VA 2PT7A 5DHPA 1E2JA 1NUHA 4B79A 1QZZA 1T5HX 1WAMA 2B61A 2BOVA 4A6XA 4YJHA 3V42A 5HUQA 4N6OA 4DBLC 4EP1A 5AKYA 2OQIA 4IR7A 4B75A 5L6MB 3EPHA 2WU3A 4RESA 4NEQA 2ZRLA 5U4QA 3TZLA 1FFCA 3K0KA 2H4HA 3VKVA 3ZDYB 3ZIAD 4DV2B 4FHEA 4LZJA 4ND8A 2Q3CA 3V8VA 3HTXA 2OCBA 4YP1A 4H3KB 3TQRA 4AUMA 2OV8A 4S0XA 2C07A 2GUGA 2BPOA 4AKIA 3TM5A 1OZ0A 3P96A 1TECE 6REQB 3KUDA 4UOQA 3AF2A 2WDPA 3ASYA 3JZFA 3EPPA 4M54A 2P0EA 2REBA 1EM6A 2OG2A 4WD3A 5CW1A 2ZIAA 1NMQA 2UKDA 3MJVA 5HFJA 3VC1A 3GVXA 4QXMA 4ZV4A 2IJGX 4YDRA 4P3OA 3LY8A 1EFUA 1B1CA 1JEQB 2O3TA 2QMEA 3FPLA 3MMPA 4QPZA 2VUTA 2YVLA 4RYLA 4MINA 3RYIB 3ZDEA 1QFYA 1ZGAA 3B70A 3ZUGA 1GTZA 2QSZA 2IOFK 1PKXA 4HGZA 3DLBA 1U2EA 2I34A 5D6NA 2IH4A 5BP7A 3JZIA 5DN9A 3O26A 4JBHA 4B5KA 2V98A 3PI6A 4HN2A 3N2YA 4GPZA 1E7YA 2RHJA 2JGEA 1L7PA 3F90A 4Q93A 5EZ5A 5A1TA 1USKA 2JCBA 2ACWA 1QCZA 1DBWA 3T52A 5HFNA 4K6KA 2VBFA 2WYVA 3ESXA 3E61A 3TLGA 5E1DA 1FSZA 1X7HA 2B92A 4KSBA 1M6HA 4B35A 4OI1A 2Y92A 3MAAC 5EUCA 1B8UA 3D3JA 5B2FA 3RIYA 3DE5X 2QRUA 3TEFA 3HWWA 3E9YA 5HE9A 4LZAA 4JLBA 1PUJA 2FRDC 3AIOA 3HV0A 3ZOKA 5J4HA 1T2VA 3WISA 2NWQA 4UAUA 4HLDA 2YIJA 5GONA 3RREA 1YO6A 1B1AA 2NXNA 4EITA 4YR7A 5CB4B 5M3BA 2O48X 3IUBA 1X7YA 2OORC 4RQTA 2EKPA 3AKDA 4KXVA 2FEMA 2G04A 1SCBA 2P3SA 3IT1A 4AKTA 1EXVA 4EATA 2JFOA 1BWQA 2AEFA 4LF9B 4UAJA 1L4MA 1GR1A 4ZRNA 4UPEA 1RFLA 4DDMA 1C7ZA 3UZUA 5CD1A 1JKFA 3E9RA 2GRAA 4LC9A 5CT8A 3RIMA 2RIPA 4RH0A 3O1LA 1K5HA 5DWVA 3FGPA 3PSAA 1TUEA 4PLGA 3KKOA 4KEAA 4P4UA 4RV9A 4GMFA 5DTQA 4GECA 4P3PA 4D3ZA 4L8YA 1K0UA 5AI0A 3TZCA 2EFYA 3HFGA 2FI1A 3DTVB 4MA0A 1PU2A 3ZVRA 3ICCA 5B30A 3ZTTA 2E4YA 1N2CE 1V5EA 2A5DA 2I9KA 4DJAA 1J8QA 1T5SA 2HBZA 1I0IA 4A8JC 5IZCC 1WPRA 1CDEA 4YONB 4WLNA 1TVEA 2QPOA 4FCCA 5ITZB 1G66A 3VOAA 3ZVMA 1PGQA 2Q8QA 1HURA 4GPAA 4ZGWA 3M82A 1U9IC 4DLAA 2Y1XA 2C7VA 2Z2KA 5EJ6A 3L6EA 3QPWA 4ND5A 4BP3A 3SZLA 4HVTA 2QTTA 2Q99A 2QD4A 1D5CA 3DD1A 4QOEA 5FUVA 3LVFO 5BQFA 4OAQA 3PLRA 3QV1A 4DLVA 4FX5A 3GJ8A 3OSZA 1XA0A 4NENB 2H6EA 2ZWVA 2FZ4A 1B6RA 3MWJA 1G5PA 2Y4OA 1JDSA 4W7SA 1B15A 2VFAA 2NU7B 3RK4A 1Q1BA 3H18A 5EVCA 5A0FA 4M38A 4CG1A 1PJSA 3TECE 1DIHA 2CXOA 3ZWDA 4V0OA 4B3CA 2PKYX 1ISIA 3FUVA 1H2YA 3NTQA 3R6TA 3A9CA 1T4GA 5EQFA 3TPCA 5BV2P 1TT7A 2VUSA 4J4BA 2ODQA 3WB9A 5FLYA 1E1LA 2F3SA 2PBZA 2M6RA 3CF0A 1JHPA 5I45A 2W22A 4CG2A 5MFPA 3WLHA 2XCSB 1J97A 5KKNB 5JEDA 3U48A 1QS0B 5LNK6 4D4IA 2JGLA 3IP3A 1H1DA 2R6ZA 1I2MA 1NVAA 3K8YA 3GJ7A 2AQHA 2GLTA 4RZ3A 3T7KA 1GDHA 1UBOS 4WKCA 5DCWA 1M7BA 2OHGA 5AW4A 3GMTA 4BVHA 1G8SA 2VPTA 1GNQA 3PCXA 3EQ6A 3BDIA 3FSRA 1TO1E 4LHZA 1KEEB 2FPUA 2P27A 3RTDA 3VV2A 4K28A 3CRVA 1BOOA 1ODFA 1QUFA 1ZJ4A 1SVMA 2XVYA 4W7IA 3AI3A 1F2UA 5GOZA 3QMVA 3LYUA 4Q3DA 2AOTB 2O07A 3PUKA 4TUYF 5HDQA 5KJ6A 3UAXA 3GEHA 3GY0A 3HBJA 5JEEA 1UMBB 4QBTA 3U7FB 2EFDB 2CZQA 3WL5A 4ZT4A 3MOGA 1GPLA 5JAZA 3MJ4A 3SZOA 1SOWA 1FS6A 1XUOA 4H7IA 3U3KA 1JRLA 4RTLA 4LTDA 1UBKS 1YQ9A 4O08A 4UOEA 5IWAB 3JTEA 3A7DA 1E6LA 4XQCA 4YFVA 4R6WA 2KPOA 3L0YA 4WWHA 4MPRA 3H11B 3HEAA 2FSVC 4GW3A 2R6GA 4GX1A 3ZQUA 4G8JA 4H59A 5IAAA 2YS6A 1FFBA 4WLEA 4J75A 4B4DA 1QVAA 3KAPA 1C9KA 1Q1EA 2H16A 3AR8A 1ODJA 1T5OA 1U4OA 1YZYA 1QRDA 1U11A 2P2DA 1WPQA 3M89A 5KNCA 3U7IA 1KK0A 3K15A 4M53A 2AXQA 3AP2A 2K6GA 3RTCA 2HCBA 2JRLA 2WTBA 2JIRA 4F4HA 3PEYA 1QOZA 1OD6A 1ZN7A 3F67A 3IXQA 3GYBA 4Q00A 3FOFC 1CQIA 1MEJA 3BH7A 3SHOA 3VTKA 1HT0A 3VPAA 2EERA 2AG8A 1EVYA 5EQJB 3OLXA 1ZXXA 2FW6A 3QVXA 5I9TA 2CY0A 4NCBA 1BCSB 1PDOA 1JPUA 1SQSA 3B85A 1E6CA 3DBRA 4UCQA 1T8TA 4YJFA 5COQA 3F6RA 3SM3A 1O95A 1NI3A 4WLOA 3VH3A 5JI3E 1UT8A 1RZVA 4P98A 3V1LA 5H9WA 3NT2A 2QVXX 1KDZA 4MWCA 1B6SA 1AG9A 2OZKA 4MUBA 3ROXA 1B73A 3IUNA 3OLWA 3DDHA 2HZ7A 3GFOA 3G8BA 1PWYE 3S2IA 1N5MA 5B7QA 4BMXA 4NFLA 2QTFA 5FOSA 2R79A 4JI5B 1P33A 4GL4A 1QK3A 3CFAL 1U3DA 4YRCA 1RBMA 1DADA 3DDUA 4B83A 2XJ4A 1BIFA 1D8TA 2XTJA 1GKLA 4R2HA 1C41A 2BZ0A 3E3AA 2QR3A 4B4VA 2H1IA 2JASA 5IM4A 1DIGA 3E3NA 1NIJA 2PS0A 3G85A 3AEUA 3R4VA 1AK9A 2JGFA 3PGMA 3BSFA 1KH1A 4CCSA 1LDMA 1VLQA 3VPFA 3HJTA 1KDOA 1U8AA 2P9EA 4XSHA 3RGGA 2QQ0A 3SLGA 3N8DA 2SBTA 2BEUB 1R9JA 2W2VA 3GGDA 3RNOA 1YAHA 1KQ3A 1XPJA 2O2JA 3KYJB 3LY7A 3S2ZA 3OMWA 3Q4GA 1PT7A 3V2IA 3TNFA 3GW8A 3O8OB 4ZQBA 3ZJVA 2NG1A 4FZJA 3N74A 5I51A 4HB3A 2GKOA 3HMKA 1SKUA 1VJCA 5JS7A 4OHYA 5TMEA 4P31A 2GBLA 2BVNA 2VHVA 2A4KA 2VCYA 4R2KA 2ZB7A 3AP3A 4I1OA 1ZD3A 1G8YA 2OQRA 3MWYW 3QLUC 1E4EB 5B1DA 4R1LA 1Q5PA 4JBXA 4JUAA 1QGDA 2C7BA 4ZV9A 2F8TA 3V3TA 1MAWA 1TI7A 2HIGA 2ZIEA 4OVKA 3RSHA 1CG6A 1JYEA 5A6SA 1TA0A 3QOFA 1DIOB 1ISFA 3H7AA 2D13A 4PCLA 4Q66C 5ESRA 4AJ9A 1XJCA 4AWXA 3KQSA 1FX0A 3MBOA 1MIOB 3LUPA 5AUQA 4YQFA 4LDZA 5KI6A 1RAGA 2P4HX 5IKXA 5TGZA 1EG7A 1U9YA 1N7HA 2OO3A 2V7VA 1JU9A 2H18A 2PGAA 3KR2A 4YCBA 1NLYA 3ONDA 3BCUA 4LDQA 4NARA 3H84A 3EOBI 5ALIA 3OPYB 1USWA 1GCIA 4RZUA 1E6KA 4MCAA 4TWJA 5BRNA 4F4IA 3A6EA 2XGOA 1F5NA 1OKKD 1Y8AA 2W43A 4MAFA 2PANA 1LWOA 2OA0A 5K6AA 3BCHA 3MT9A 2OD7A 2AXEA 3MWFA 4M60A 2QGNA 1X9IA 4FFWA 4P4NA 2A59A 3F4BA 2WYUA 3HYRA 3AY7A 3PJGA 2DU8A 3VGPA 2YXPX 1ZO8A 1Q0SA 4FOSA 1FLAA 2AYZA 4OTZA 3DZDA 2D2VA 3GPCA 4FYKA 3UMBA 3WE7A 2BMAA 2CXPA 2GYUA 3KX2A 4JJAA 4I3HA 2WU4A 5HIAA 1FYFA 4IKOA 1MCZA 3KUKA 4JU9A 1A27A 5GPBA 2HSZA 5GTDA 1ZP6A 4WW0A 1G6Q1 4DMGA 4KRXA 1MZPA 4AZ0B 1GSAA 4LNHA 5H0IA 1E0KA 3QKWA 3T5PA 4G85A 1X1EA 2F1KA 1L5OA 1K6IA 4J03A 3M33A 3D2AA 2QRJA 2IYSA 2OZLA 3DTYA 4LOHA 3WDSA 5BWMA 1FXWA 2QMQA 2XTNA 4RA6B 4UNSA 2CUTA 1AGXA 1ODLA 3OTHA 2TSYB 4Q5IA 4UE6A 1BA2A 3D9QX 3FZGA 2XCRB 1C9NA 5THKA 3HN7A 4CLXA 3ZQJA 2MOKA 3NYRA 1HFEL 1GUBA 1ZEMA 2FQXA 3DC2A 3P2YA 4E14A 3NHYA 4UD6A 3RR2A 3W06A 4JJFA 1CXZA 3KQHA 3W7BA 3W8RA 4HXEB 4JNCA 4D97A 4D8VA 2P2YA 2H51A 5ALKA 1UKBA 1FDRA 3V34A 4DABA 5C5DA 4R2XA 1LV7A 5CNJA 2ZJOA 2GNOA 4KH0A 1GAQA 1NM5A 2PRKA 1NF2A 4Q6BA 2WF9A 1XTJA 4UATA 3R1IA 4MZDA 2GXQA 4KNVA 4ZC1A 3O2JA 4NCJA 3CA8A 5KO2A 4QWMA 1XQWA 4FSDA 3U9SA 4CIDA 3RWBA 1T2AA 1RHMA 4F60A 3JZDA 5LMNB 4RZ2A 3S70A 3X2EA 5F4BA 4ZHQB 3FH0A 2V7WA 3VOSA 4IDCA 1M1NA 2QM0A 2NYUA 4NMHA 1U0LA 1VP9A 3M6LA 1MIHA 2FZVA 4RVGA 2QAGA 3R20A 2RK6A 3NAMA 4UFPA 2XMCA 3AGQA 4QFMA 5BSFA 2FHSA 5IXYA 2YX1A 3CT6A 3SJBA 2IU4A 3CJTA 4EK9A 5FBZA 2V96A 5FO1A 1FW6A 4J91A 1SG9A 4HT3B 4H7EA 1IY0A 3H5OA 1WQ4A 1RKVA 2QPAA 2QZSA 2FWJA 4XLLA 1CBUA 3TSWA 3WV4A 2DKOA 1MJGM 5JJKA 3OFNA 5L3QB 2ROQA 1WZIA 3R7DA 2CL0X 3P9YA 4JOCA 2NP6A 1AT1A 1TYDE 2D2XA 2TECE 4RSHA 4XWTA 4ZQCB 3ENNA 3MIZA 4F2GA 4DA6A 3EZFA 1WXDA 2PZAA 1GNRA 2FUNB 4OQEA 3QE9Y 2O20A 1N77A 4RORA 2QZ9A 1FTSA 3TOXA 4KSCA 4KQEA 4EF4A 4RIFA 4HQOA 4OJQA 1OX4B 4F5ZA 3EY4A 1ZCAA 3BE8A 5JAIA 4OGFA 1M10A 4DCMA 3JX9A 1H3NA 1HRDA 4H7PA 2PN1A 5JFTA 3QEAZ 5JSZA 4A2CA 1RHUA 1XU9A 2PS1A 1JTFA 1T9BA 4IIBA 4N7RA 2H7CA 4DLKA 1H85A 2ID8A 4X44A 3DO6A 4Z9BA 3RVSA 2KE5A 2R00A 2XDQA 1J5EB 2H4YA 4ZA2A 2D2FA 4P7GA 1I6WA 4ZPJA 3ZUPA 2KJQA 3MQ4A 3QIVA 5L6LB 2VYNA 3H3JA 4TXNA 4LYEA 3GEDA 2CK3A 1K1EA 3JAWB 2G0AA 2CUZA 4BEVA 2A78A 4CKBA 3LBYA 5EY5B 2OYRA 3LO5A 1NLFA 3JCZA 2DQKA 4RJKA 4ER7A 1JXQA 2QLNA 1CHDA 1LSUA 3EDRA 1PFVA 1P39A 3C8MA 4I1IA 4GOOD 1C8LA 3KHUA 4DUYB 3HHEA 5DZSA 1CUJA 4UPDA 5EPEA 4AO7A 4EZIA 3KPUA 3KOWA 2A53A 5FWDA 5K4GA 2VDMB 1WUYA 2H7XA 1QAQA 3SZRA 4TSFD 5CLIA 5LOVB 2BELA 2IEIA 4Y1FA 5JO9A 3ROMA 1E3SA 3INYA 2JF0A 1G21B 3EZ7A 5G0UA 4BBAA 3DZBA 1MG0A 4CF3A 4UDOA 1LPSA 2W11A 1Y9JA 3UBTA 1SOAA 4O1MA 4QASA 1JZTA 4J3NA 4NCHA 3RPEA 1LGYA 4DXHA 2WJYA 1MDBA 1Q50A 2Q4BA 3OLVA 5EIWA 2BFOA 2NQTA 1XZCA 1PR0A 1TK2A 2W58A 2RJNA 4LVCA 1ZD8A 1U5BA 2QD3A 3RS5A 3KHSA 3G8CA 3DH0A 4I4TB 3SNKA 2X23A 4EB3A 2DBQA 2EKZA 2YJ4A 3INGA 1X0XA 3O2NA 4Q3LA 3HNPA 4Q05A 2D0OB 1CJMA 1Y3HA 1XEWY 1GQSA 2HTEA 3NHMA 1RLOA 3H6KA 3UJDA 3ZCQA 2G77B 4B45A 1JQBA 4M86A 4L22A 4J7AA 1H8HA 1QIIA 3L1HA 1M76A 4KPYA 3AHJA 1FY2A 1UJ5A 4A36A 3BMNA 2BJWA 3X1ZA 2QW0X 2COKA 4CLOB 3QBVA 1KKUA 5ECDA 4DC9A 2JGMA 3TAUA 5EXDA 4ZN6A 1U04A 2QLLA 2ZQZA 1RQRA 4MVJH 1Z4PX 3TZBA 2OV2A 4FCTA 2QROA 3BULA 4MCIA 5CH3A 4Q3OA 4RVOA 1EFVA 5CVJA 4ZVLA 4DLPA 3DUFB 2WT8A 2ZUSA 3O8QB 5C1DA 3D8UA 3DBIA 3QVOA 1PNRA 1T0JB 1NUTA 3VR3A 1VIDA 5TEVA 5IMBA 3AIKA 4U00A 2R7LA 4MUIA 3L46A 4S04A 5D2CA 4MKZA 1XDZA 2JRCA 2OY0A 3BCRA 3ASZA 3OU7A 3CKMA 2ABWA 3WQHA 4RY2A 4WUTA 3E7PA 4IIGA 1D9XA 3GO4A 3D8BA 2FH5B 4HVAA 4FOTA 4G8CA 3G1WA 2Q6LA 3NBYC 4U63A 2OKGA 2Q7XA 4U2CA 3ZE8A 5H8WA 2ORWA 4AB1A 1PV4A 2J9ZB 1JLSA 3MT7A 2EGHA 2W6QA 3QKIA 4L5YA 4QQKA 4LJ8A 4G4JA 4OB8A 1XYVA 3PR2B 4LJ7A 2SECE 3MMSA 2IPLA 2PY6A 3IQWA 3MA0A 3VR5A 4EFNA 1C1XA 1ZKMA 4C14A 1FB5A 1T2UA 5AXCA 4L2IB 5K3AA 4KAAA 1JJFA 4Y9SA 4BMCA 1G20B 2I55A 4K8RB 4YJ3F 2ZTHA 3H1PA 3MJHA 2XB9A 2E1PA 4ERXA 5J5AA 2IZ6A 2Q5JA 1AHHA 2YQ4A 3QFTA 1TEVA 4JJKA 1M2OB 4P83A 4UCWA 5K3EA 2WWYA 1W4AA 3JQ9C 3L0IB 4W1RA 4GI1A 3TIXB 4JLUA 3GGJA 5HF5A 2C7OA 3C8UA 1BMFD 4YI3A 4CPDA 3HVRA 3HO8A 3CX7A 4ISBA 3TBFA 1RRMA 2XE4A 3Q2IA 3QU5A 3ZWBA 2UXBB 3IV6A 4N5HX 1HFWA 4HV4A 2NUAA 1P4JA 3LZDA 1C1DB 2QRLA 2R84A 1NJFA 1JR4A 3FPEA 5EJ2A 1QLJA 2FP4A 1GLGA 1U9JA 2DAPA 1BRMA 2GA9A 2H06A 4J1QA 2NUTA 2BKEA 4ZODA 5J47A 3K71B 1T29A 2XE7A 2HYIC 3AJRA 2OZPA 1AK2A 1PYDA 2BLNA 2JZOA 3JATA 1LBEA 5A03A 5J58A 1WMDA 1PR3A 3IMEA 4JC8A 4K9RA 4UUQA 1DJNA 3QGMA 4KK4A 3KOZA 4CEHB 1N1GA 2GK3A 4P9NA 4FB4A 3UMJA 1RVDA 1CZHA 5DW3A 2JEZA 1HSOA 2QJOA 3LRTA 4BGUA 3I05A 3ND7A 2CL7X 5FPYA 3EH1A 4ZO8A 2JLSA 2VVTA 1IZ0A 3HY3A 1SKQA 4JX8A 4LMAA 5K3DA 1KP9A 4BV8A 4IEIA 4R0NA 4YGYA 5KNBH 1KJWA 1PHRA 1JHYA 4H3SA 3PITA 4JLKA 3R77A 3KXDA 4ND7A 4D8UA 2ID4A 5T4BA 1Q12A 4J7XA 1WS6A 2R87A 1Z0ZA 2ZSIA 3AETA 5DHRA 5F2KA 2HMUA 2ZJ2A 1EWYA 2QTWB 3CX4A 1XKXA 2IIVA 1YDGA 1I0LA 2XOKA 1HE1C 3I9V6 3K16A 3KV1A 3QVLA 4G36A 5G2OA 3DOJA 5LFAA 5LP1A 3M4ZA 1UT5A 1XCPA 1LQUA 2I4IA 4K40A 4XD2A 4LFBB 1EWRA 2HLDD 1ZSVA 3KWFA 3L9XA 4FDUA 4AO8A 4B84A 2ZE8A 4MRPA 1KYQA 2J3IA 3BB3A 5DWQA 3WL6A 1O97D 5DHSA 2CVFA 4G0MA 4CR7A 3DVSX 4DZTA 3AOGA 2JD2A 2JZNA 4EJMA 3QSGA 2PX8A 1XQYA 1OYYA 3A1VA 3I01A 3OPNA 4BJHB 1H4SA 3RJMA 2QQ5A 2D0DA 2CXNA 1BZYA 2F59A 2HC9A 3D54D 3HFJA 3NVAA 5JNRA 3SKVA 1JR2A 3O8LA 1Z36A 3FYUC 4GGPA 2H59A 2Z5GA 5FYDA 2X41A 1VPVA 3LX5A 3BQNB 1BROA 3PGA1 4M9QA 5LIRA 1G3QA 2A0KA 3ER9A 1YRWA 3VZQA 3O8NA 3QNWA 4QXQA 4LMRA 4MKHA 4D98A 5JPDA 3OAAA 5JVDA 4O3MA 4OQ4A 3R0QA 4F5DA 2Z5VA 5CK5A 3WLRA 1U2DC 2JZCA 1ZJYA 2VBCA 2Y6VA 3C2QA 1ACMA 2BSXA 5T4HA 1TEZA 1TMKA 2CYBA 1WV1A 2DE0X 1S2MA 2VC2B 2JHFA 1JKMA 3L0ZA 5EWLB 1M34E 3G8DA 1MA0A 2FUG6 4KCGA 2R6FA 3CF4A 3NHUA 4NAUA 3WYNA 4BQQA 4DADA 4J6EA 4EA8A 4EHFA 4KJZA 1H23A 1G0NA 1G5IA 1PLJA 2BW0A 5DPMA 1UK8A 4JGBA 2Z8YA 1SA0B 3FZYA 5K20A 1L7RA 1F1BA 5CFMA 4TUYA 2HV9A 2OLEA 4UU0A 4ZO4A 1YJXA 2HMAA 3ZW9A 1AXEA 4C7OB 4YLGA 1IZYA 3ROQA 2VK1A 3H2BA 4GZ3A 3RBAA 4ZI7A 5I7EA 3ZLTA 1F12A 1JVNA 1KTIA 1GADO 2H4WA 2XUAA 5F52A 4D45A 5IANA 1XZJA 3OIFA 4XB6B 1S8FA 4PFQA 3DPUA 2AFHE 3K96A 1OXXK 3IJEB 1L9KA 4QO7A 4F7DA 1Y8QB 4JIMA 4GGMX 3AHDA 3SP1A 1BCRB 4RCYA 1MW9X 3O6VA 3ACDA 3H5AA 4NCKA 1JTEA 4X8LA 4OJKA 2CN1A 3Q40A 3KOOA 5DLYA 5AW0A 1PK8A 2WRZA 1SU7A 4OK6A 1LJLA 1I80A 1O4WA 1O94C 1MRNA 3KLBA 5TLSA 2REQB 4MA5A 1CZOA 2IIBA 3KUXA 1K0FA 1ZUNB 2V7GA 5E3IA 1ZYUA 2BR5A 3L3BA 1D2CA 4Q15A 4QOFA 4GR9A 3ZV4A 3U5TA 3K6JA 2OAP1 3KZNA 2QD2A 4OXQA 3A1TA 2XD9A 3WAJA 1KI6A 2I4RA 2PKRA 1F9AA 3OP4A 4FS3A 1Y3AA 4X41A 1VPTA 1XTRA 3X44A 5DB4A 2JIQA 2ZSHA 3OM0A 1X19A 3OCWA 1H3FA 2ATIA 5JAMA 1E64A 1H6AA 2D2IA 1BE1A 1CQJB 4KQ6A 4ERNA 3GLHE 5J2UB 2AN1A 2NU9A 2P2LA 3EGVA 4GLJA 4IDHA 3GIDA 1JIXA 1W1UA 3A4TA 4D42A 2HCJB 5DM2A 1H9CA 2E4VA 3VNBA 3AJEA 3KJQA 3PFNA 4G5GA 1J23A 3T7SA 3P9ZA 4KUEA 4Q1DA 2ZK7A 4HS9A 1OFIA 1DC5A 3IVGA 4FMDF 2J9FB 4YCMA 2ON6A 4CIVA 3U2QA 1QRRA 2HJVA 3CC8A 4Z8YA 5FWAA 5ILGA 1V45E 1P3Y1 1VMKA 2XDYA 1VL1A 2ODPA 4BLQA 5ADHA 1K4YA 1X1QA 2X1VA 4IG4A 2Z8YM 4J7CA 4OJMX 2HCFA 4P35A 5E0OA 1OA1A 2Q07A 2G5GX 3X1KA 1H6BA 3EXHA 1WUIS 1NUQA 3NM6B 4ZDKA 1VKOA 1G8HA 4PHTA 4U0JA 3R8FA 2VUHB 3FMIA 2GAIA 1PEDA 4JU8A 1KEWA 4Q4CA 4YLEA 3VTFA 4B3GA 3A3KA 1KKLA 1RTKA 4NCAA 1A2OA 1DC3A 1LPOA 1J1UA 3GFFA 5FJJA 3OZ7A 5A5GA 3MCZA 4TQGA 5HDBB 2ILTA 2QTCA 3PQ3A 5FNZA 1KXJA 2Z8XA 4DV1B 5DI3A 4AJ2A 3SBXA 3HGTA 3I9V1 4CLDA 4RTQA 5FUQA 3CVJA 3WGNA 3H4TA 2VDJA 2Z1NA 1DMSA 1EE1A 2ZRKA 5CPBA 2F8MA 4BUJA 1UT6A 4EYEA 2AEEA 2Z9DA 2FUCA 4L5BA 2X0RA 5CBKA 2F3PA 2XAUA 1BH2A 4LXXA 2XNHA 5G4LA 2M2IA 3AF3A 2PKQO 4ZICA 3RBZA 1N3LA 2FPPA 2FR8A 2M6LA 4X1KA 4F9EA 5IVPA 5BWBA 3ZLJA 1NQVA 3E4CA 2IXGA 2GWHA 3GMSA 1GU1A 1VXRA 4JUDX 3TD6A 4PN3A 4IQ4A 1BDIA 1TCAA 4CNBA 4M1TA 2ONCA 3WBKA 2XVMA 1M72A 1P5RA 3H5LA 3VHXA 3VVMA 3PDHA 1SXQA 2J0VA 5M7EA 4TV8B 2F00A 5F1OA 3WL8A 4XH9B 2AH5A 2W8BA 3Q98A 2DWQA 4DNXA 5CAEA 1IG3A 2XF8A 4TV9A 4MLZA 3W5JA 1JEOA 4FYPA 3T12A 2WB2A 3ELBA 1ZITA 1VDMA 4XA8A 5EWJA 3CLTD 4UNPA 3U13A 4R0MA 1T1SA 1JDPA 3KP1A 2RGXA 2X3UA 3U7GA 1ISJA 4HRXA 3U62A 5KKCA 1Y9AA 4DBLE 2GH1A 3E82A 2O6HA 3U4DA 1O6ZA 2YJZA 1A9ZA 5LQAA 1KPHA 4RGYA 4AF7A 3TQFA 3S8YA 1N1MA 1RMYA 3L4JA 1KC3A 1Z4IA 3DHNA 1F6DA 3O47A 5GWXA 1HO3A 5ICSA 4BQFA 4P84A 1T9AA 4E0BA 1ECGA 5C4MA 3K0AB 4DNQA 1YDMA 3F0TA 1G8JA 4PG7A 1XV5A 3HWSA 2BHRA 2EQ5A 4P3NA 4JC0A 2AZMA 3HSKA 2WE7A 4IM7A 5LQCA 4LE1A 1WCXA 2PD6A 3L8YA 3C87A 4IS3A 1MB3A 1MOPA 2HWYA 4XDHA 1RXSA 5JASA 4YBRA 2GI4A 2PGNA 4CN8A 2GF0A 2J45A 1Y8CA 2RJOA 4F86A 4MUNA 2PDAA 1CB7A 3NGMA 1FOEB 4UUPA 5DI9A 4XI9A 2PX6A 3NKLA 4HRAA 1ZINA 3WDLA 1A0OA 2ZG6A 3BYZA 3OX2A 3SZUA 1MV8A 1NULA 4RCZA 5C4GB 2XUOA 2Z2XA 1KARA 1U8YA 1Q91A 1MT0A 3CEHA 2ZZNA 4AFNA 4TXMA 4JD5A 4LWZA 4RUKA 4Y6GB 3OMLA 1RJEA 3AUKA 3QRWA 3ISJA 1WOYA 3HBAA 4L85A 3EZLA 3FIJA 3LSTA 4QRDA 5LC1A 1ODCA 4C20A 1QTQA 3QG5A 2BGMA 1QRUA 4OHZA 4PAMA 4BNNA 4XRRA 4C01A 2BGGA 2E85A 3LWZA 3GD5A 1JKJA 3L8FA 5DGXA 3U3DA 1Y1SA 3ZV5A 4MYSA 2RETA 2VCEA 1IN4A 2PJUA 4X61A 3ZDAA 2KW5A 1I3LA 1AUOA 3A6FA 4Q47A 5TNXA 1EK2A 4YRFA 1QMGA 2KMLA 4GICA 4J1TC 4AP9A 1SUWA 3PYXA 3GCWA 2WQ7A 1DFGA 2GPYA 2WHXA 3DHEA 4GSKA 4IWYA 1J00A 2PUFA 1F4LA 4CEIB 5CH8A 1VI2A 1UK9A 2BFAA 2GW4A 5F3WB 3GEMA 2I33A 1B0ZA 2O5VA 2V6JA 4OQZA 2CJPA 4YASA 5KSZA 4AC9A 1EUCA 2PL1A 1U4SA 5LLDA 4Q39A 1UJ2A 2HFKA 3FSGD 1WSAA 3T35A 4TWAA 4D6PA 5BW8A 3B1YA 3E5NA 2W37A 3JQQA 4V3BA 3G13A 2ERXA 1BX1A 2IU0A 3T1HB 3U1TA 4ZOCA 3PRJA 4YUVA 1BJTA 1V1JA 2ZI7A 2ZJ3A 3BTVA 4J6FA 1U8CB 4BB0A 1K3UB 3C3AA 1NR7A 1EWQA 1G9TA 1CUFA 2OE2A 2QX6A 3VA7A 2Z6AA 2ZVJA 1ZD4A 1MN6A 2RGGA 3N8IA 1YZQA 4QEDA 3VR2D 5HQ3B 3AVXA 1HK7A 1TCBA 3LXUX 1R8JA 3B6EA 3EQZA 3JASA 2BY4A 4KQ1A 1X3LA 3A6KA 2OLKA 2UZ3A 3EGIA 4IEFB 5DWDA 2IWHA 4EDFA 4QUJA 3G8YA 5HRCA 4DCJA 1JE1A 1AKRA 4DDKA 1SVNA 2ETXA 2GAFA 3FDZA 3BEDA 3OTQA 3EC1A 3KIPA 2PZLA 3CZRA 2JD0A 5LKAA 3RIGA 1E8DA 3OX3A 5FJIA 1D1QA 2I4NA 1CUBA 1B7GO 1N8NA 3K0FB 2NYAA 3WSVA 4ZT3A 2Q9CA 2RHLA 1M1YB 3RAJA 2PNFA 4EG0A 4WI1A 3EK2A 4WV3A 3ZKWB 1IHUA 1PJ2A 2PUAA 1C0EA 3AG6A 3LAWA 1A96A 1TW3A 3I3OA 3QUTA 5G0VA 2A4MA 3VPDA 3KCNA 4CM6A 5JS2A 4WX2B 3MS7A 2B9VA 4F4UA 1PFYA 3BMOA 3EASA 4IQFA 1OXUA 4LJRA 3QFFA 3HZRA 2CT8A 3GL9A 3WHKA 2DETA 4HUQA 3B6KA 2WP0A 1BJKA 3KKEA 4QAJA 4HDRB 1I2ZA 4UZSA 3P20A 5DGIA 5B57C 5U9CA 2BFPA 2WB4A 3CG0A 4ATNA 3LX4A 3CFHL 1B3RA 1U63A 1S7CA 2KX7A 3RFVA 1IYZA 2Z3WA 4NYIQ 1YZ3A 2QD5A 3KO8A 5MFZA 1R6DA 3AG5A 3BIOA 1CRPA 3EIHA 1DQZA 3IHLA 4J16C 4JZKA 1YONA 5CX1A 5IT9A 2WC1A 1I4TD 3F9IA 1XP5A 4AUKA 1DJLA 3C3DA 4PFSA 4RK5A 1F8UA 2BDUA 3A1CA 3ZTWA 3V97A 2WPDA 1E1KA 1IC6A 1JBEA 2OUIA 4MWDA 3TUZC 1GO2A 4DCTA 4L74A 2JHAA 3A10A 4FFSA 3QU9A 5K7SA 5EKDA 4NECA 3NDPA 2FWIA 3FAKA 2QX8A 1RIFA 5HKLA 5B3JC 4R8RA 3WO1A 2HTFA 3H16A 4P4SB 1Y4SA 5T3UA 3I6ZA 4MK4A 1YJ5A 1NFQA 4F9GA 1ILEA 1P74A 4WA7A 4XAQA 4EECA 3WRXC 5FX2A 5IYZB 2FDRA 2JEYA 5MN5A 3V1UA 3SK0A 2VZ9A 8OHMA 3K9GA 1OBFO 1YBMA 4L51A 4ZQIA 3OKFA 3AV0B 5AP9A 3W7AA 2W90A 2ZJ6A 4WKPA 4GMHA 4KP7A 1U8UA 5AESA 4GVPA 3ZN2A 4J0HA 3AV3A 4EKEA 3EXEA 1RP7A 1Z35A 3P4YA 1K7XB 3HXLA 5HUHA 3I5AA 3SLKA 1G7RA 4K8OA 4KXNA 5BV8A 3F8WA 1SIUA 3ICPA 1D2MA 2FJPA 2PO7A 2RH8A 5KWEA 1B26A 2GCIA 5JHGB 1YVUA 2AG6A 1Z4MA 4Q4JA 5KPJA 3VR0A 1TJYA 1CUXA 5EGSA 5BSWA 5HOQA 3GFBA 4IWXA 4RZIA 2ERCA 7GPBA 1LSJA 5FP0A 5SZJA 2CVOA 1AV6A 3RSCA 1Y9DA 3VC7A 1A71A 1LTKA 1YL6A 4ND8B 2WU8A 1U99A 3OU6A 4IKEA 2GVZC 3HVKA 2V3VA 4D4LA 3K4QA 4QLBA 4KDCA 5FUXA 1WXEA 2GK6A 3W8NA 4MVWA 3LY9A 4CTOA 2YDXA 1DAMA 1H42A 3QLEA 1U2GC 3PL5A 3C6QA 4OSEA 3G2JA 5FB3A 2V7UA 1KU6A 4UZEA 2ZJBA 3D2CA 2RGBA 2P2ZA 3M6WA 4M7RA 2M6KA 3VDQA 3AR2A 1BVYF 2WI8A 3D8TA 3IT2A 5ALVA 2PYIA 2BDEA 5F5NA 4C78A 1TZJA 4EPYA 1V4NA 1P7WA 4YJ3A 2A1TR 2P8JA 3WIVA 1SZPA 4YV1A 2CEKA 2P9BA 3MCUA 4OI4A 4B3RB 3LPMA 2FWPA 1EFRD 2OR3A 1RPTA 3H1AA 2ZBVA 1C14A 3RVPA 3R75A 2PQ2A 3AERA 4MA4A 1EVKA 7MDHA 4R8LA 5ITVA 2X14A 1U8FO 4V1CB 2QTAA 3J7TA 4LRYA 4F5YA 1YQGA 2IVFA 2FK8A 4TMVA 2P6MA 3R3VA 2X2EA 3B9BA 2A3RA 4Z99A 2F4VB 3Q0EA 2IXFA 2ARKA 2AZ4A 4Z1MA 4G5XA 5HXAA 4YUAA 2P90A 4S2UA 5HCUA 1JILA 2Z57A 1CZRA 3KZVA 3T7IA 4UU7A 3RVOA 2YFKA 4BZZA 3CS3A 2EKBA 3RQSA 5BVGA 1DT3A 2B7CA 5JMTA 1ZK3A 4KB5A 3FNIA 3DCJA 3TD9A 2LWIA 3O0TA 4KR0A 4LN1A 4LTNA 3UPTA 2WA1A 3E7WA 1ZCBA 3PR3A 4KLZA 4L5JA 1CY7A 3VR6D 2VBIA 2YN0A 1A8QA 3AOEA 4O1IA 1R8XA 3WLPA 1PS0A 4WJLA 4OB7A 2OT3B 1A5TA 2CKMA 2VBGA 4RKWA 4WBXC 1RBZA 3JQFA 1FMJA 1PYOA 1M34A 4FI3F 4YRRA 4PLPA 5EKUA 4RQBA 2PUVA 1WUJS 1QC5A 1RXYA 2X7HA 3QE3A 4OK5A 2R8RA 3AI7A 1YK0A 2Y66A 4AJNA 3U7QA 1VA4A 1SULA 4L16A 4J07A 1HMYA 1T2EA 4R2WA 2FMFA 2HAEA 4G0QA 3QJYA 2SHKA 4GQBA 1X77A 4KAFA 3RWMB 1QIEA 4PR3A 4YCDA 4ZIRB 5T41A 5TQVA 1XZDA 1ZU5A 2Z6VA 4UBMA 3WJAA 4DLYA 3DAFA 1GWNA 3THYA 1Z2DA 1BKSB 1TYEB 3FNQA 4LE0A 1AK1A 5GOTA 3UWSA 4WZAE 3MK31 3RROA 3HYTA 2A9PA 3FMFA 2I03A 2MMCA 2B94A 2VI5A 3JRWA 1BVUA 1MAHA 2AFHA 3L7NA 4OMDA 4RNCA 4YO8A 5F64A 4PGGA 2Z4RA 3E0XA 3LTEA 1INLA 4D4HA 5CLLA 2V7QD 3Q6MA 1VQ1A 1RFGE 3K2QA 1QHSA 1BE0A 1JA9A 3HKCA 3OWHA 4KWIA 1JSZA 3ZIUA 4RTOA 3GA5A 3R6DA 1JG1A 2DQZA 3VYSB 1X1BA 1HE2A 2JA1A 2VT2A 2E5FA 3JVEA 1NNUA 4LOJA 3UMCA 4GYJA 2P5UA 4MW7A 4L6IA 1TVCA 3PKJA 4ZCQA 3DPIA 2FPXA 2GVDC 3HUEA 2SCUB 4K9NA 2XEDA 2NTYC 3ZD7A 4IZOA 2E7ZA 3I2FA 1LVUA 3MWDB 5F7XA 3IEUA 4I55B 1JHUA 4GM0A 2I2CA 1T1RA 2PVSA 3UBMA 1M2VB 3VR4D 4COOA 1P4GA 2VR1A 4FFNA 8ATCA 4BNKA 3N0VA 1DAKA 4RA9B 1IBCA 1RACA 4XPIB 1UBUS 2I8CA 5LP6C 3ZCPA 4EL0A 2XGJA 2H85A 1ZJJA 5CA1F 3DGFC 3MCWA 4A6EA 2CDRA 2XNJA 3ZWVA 2NU8A 1H2XA 3LF4A 2D00A 5FOQA 1G4UR 3KPWA 3O8RA 4BKOA 2UZ4A 2D6FA 1IN8A 3EEFA 1C9MA 4IEEA 1JNYA 4WN3A 4UUAA 3HXOA 2C9OA 1A9SA 3RTEA 2PTGA 2XA1A 5F7ZA 1N0UA 4DQUA 2R6AA 2VA8A 3O4FA 3BRWD 1NMZA 3EVFA 1OY1A 1LA2A 3Q8MA 1XSEA 4BO2A 1Z0AA 1DG9A 1PEAA 2QRMA 1UP4A 4RF5A 1KKMA 4AYXA 2F1HA 2CMKA 4DCGA 5AXDA 3TW6A 5F7OA 3EHDA 2GD1O 2ZJ0A 2D1SA 1C3OB 1B8PA 1Q0ZA 4P7BA 3LTNC 3NHSA 4HLQB 4D99A 1HNWB 2JCSA 1JT2A 4HQLA 2X5NA 3BZUA 4DQ0A 1VOTA 5B7GA 3EF1A 4D9HA 4G37A 3PX7A 1K97A 4XWYA 1XTUA 4KOAA 4IIXA 1WDWB 1X80A 2IPXA 5EJMA 2UUPA 1OREA 2IOYA 3I53A 4JI8B 1ATZA 1UDCA 5IJAA 2OSVA 4FTWA 2AYXA 3PEUA 2OFXA 2RB4A 4IVNA 5HIIA 4AX4A 1U7WA 2DQYA 2IYTA 4XW2A 3C3YA 4XTCS 1N8SA 1U1FA 3OEHA 4YA6A 3SQNA 3DVQX 2YTZA 3THOA 2NZYA 1LJUA 1QPBA 3FZNA 2PXHA 4HH1A 3GVCA 1YL7A 4QNMA 1T0HB 1CE8B 3RFUA 3ZJ5A 5C9ZA 2I2WA 2IYVA 1M2EA 4H3VA 2Z08A 4AKSA 3DT9A 5IVDA 3L01A 4BVAA 3IBTA 4YJFB 3KJGA 3NOOA 5CIQA 4EA6A 3WK4A 4GI7A 4MRMA 3IEVA 3QE4A 3DZKA 4ONEA 5FWXB 3U60B 2ZS7A 3ND8A 3WL3A 1N32B 1ZU4A 3R3SA 5EZYB 1BWSA 1UDXA 2NVUA 4ZEXA 1AM4D 5CCBA 3L5KA 1AQ6A 2GLXA 4Q21A 2XYRA 2M9MA 3D7NA 2XNCA 4KQFA 4WIAA 2CNKA 1M9NA 4UOZA 1DUSA 1UUFA 2GYWA 2O8FB 1NV8A 1BKDR 1TAHA 3KZXA 3LVRE 1YRBA 3TLJA 4KR9A 5BN5A 2DZDA 3K32A 2O8EA 2H9IA 2RHDA 4FFRA 1ONSA 3DLAA 3LT4A 2J7PD 4QA9A 5G3YA 4MDFA 4Y1EA 4YBZA 4OKSA 3DO5A 4OIFA 2VF5X 1XMQB 4DJTA 5KYGA 2BF7A 2R1VA 1J20A 3U7HB 4HGQA 5AK6A 4K6MA 4L4SA 2I4MA 3EXIB 1QONA 3PRHA 3M70A 3RJZA 1BRTA 4TZ0A 1IEXA 3FVWA 1FTQA 4TLAA 1DVRA 1EH5A 4J2OA 4P32A 5IJWA 4B9EA 1OJ7A 5TPWA 4DJJA 4MCJA 5K8JB 4Z3DA 4Y2GA 3HCBA 3EQ9A 3WSTA 3LF2A 3KKQA 4RQAA 3QI2A 1FC0A 5MN6A 2R85A 2XVZA 3BX1A 3GLIE 3OH8A 1PSWA 5CM8B 4IJ5A 2RHTA 3RVDA 1V1RA 2XNDD 5CDGA 2V9ZA 3CLSC 1JYFA 1Z34A 4DSOA 4W5RA 3VBCA 5A6SB 1XJ5A 2FN3A 3KSZO 1SCIA 2EBUA 3NJRA 2KB0A 2DWCA 3PDIB 3QJ5A 5L3RA 5A71A 1RXEA 1ZHOA 2P8SA 4UTPA 9LDTA 3ROFA 1E0DA 1FX0B 4HFNA 1P2GA 1RS0A 2J5RA 4G56A 3PF9A 3MRSA 3HB9A 3DZCA 4AVYA 1PNOA 3D2LA 1MTOA 2IEGA 1K4MA 2Y1EA 1GPDG 1UANA 2WG0A 3CT4A 3DYBA 4V24A 5INTA 3OD1A 3A2KA 2FRDA 2JGNA 3PHCA 2I3DA 5CT5A 3H13A 2R4UA 5FV7A 1U80A 1ZSYA 4LY3A 4NMMA 4FJ1A 1DRVA 5EIHA 2I6TA 2PSJA 1IONA 4X8HA 2ORYA 1CIJA 1GCUA 2OORA 4MZXA 4X7PA 5I7WA 3NETA 4BFZA 2QVZX 3JYNA 4HATA 4BRWA 4L0DA 1O5IA 3AJ8A 1A8IA 3CRRA 1EUYA 2FZ5A 1CDOA 1RAHA 4M55A 1SPBS 2HU2A 2YW9A 3M4YA 2X1LA 4M0FA 4MDEA 3AESA 4EYGA 2EQBA 2W2KB 1HF3A 4DCCA 4FD2A 1TKCA 5AW8A 4OHBA 2PSDA 3VNVA 5AJTA 3NANA 4HQ6A 2ZBQA 2QRVA 1YRAA 2YRWA 2ZRHA 3KKKA 4GLFA 3IYLW 5DX8A 4KN8A 4A15A 2QTMA 2WFMA 1AKNA 3N2KB 3VNUA 5LBIA 3B60A 1FYEA 3BXOA 1KDTA 4EGFA 1NNLA 2PAAA 4PRLA 1G8FA 2I7XA 1E9DA 2NV2B 4A8JA 1OT5A 1BH6A 5CBPB 4QEZA 2EFEB 2JLXA 1ZVMA 4OXKA 1C1YA 1R0KA 2VJQA 4ZI5A 2VDVE 4AIRA 1R4MA 3OT1A 1K5DA 4D9BA 2GAJA 1U9IA 3RS4A 3QI7A 4QOGA 3K9CA 3ABQB 1FYXA 2OGTA 1BO6A 3VNRA 3LQ2A 5IJZA 3CVOA 3NASA 5TARA 4XX0B 4WOBA 1ADCA 4K1LA 4B73A 1Z28A 4MIYA 4MW0A 2ZPAA 1SD1A 3T95A 5KTPA 4CQMB 5A5EA 3OZCA 4H0FA 4HO1X 3RSFA 4RAQA 4PCVA 4PAGA 1QLHA 1VLVA 2ACEA 2BISA 3B5IA 3T3MB 2BEVB 1CPYA 3HV2A 3JQ6A 1V8ZA 3KYCB 1BFDA 4LXYA 5KTYA 1CS0A 3P0HA 5REQA 4DMLA 3ZBTA 4YCLA 3I09A 5AOAA 2OAEA 1WJGA 4IQ8A 1K7SN 1FNCA 2X8JA 1YQUA 1T4MA 4RELA 1N7GA 3EG9A 3LDAA 4IVQA 4D3DA 3PIRA 1DO2A 4ETWA 3EA0A 4MITA 2B1QA 4A8HA 1XTPA 1WY5A 5CG1A 1OXBB 3GP5A 4UNIA 1ZM3A 1ZHFA 3BGVA 4N3AA 4LVOA 5F21A 4N6GA 2A67A 1WSWA 1G2QA 3B2EA 3NALA 4R6XA 2V6IA 1HA3A 4PPQA 5AI8A 3WGOA 4CLRA 3KZCA 1SOVA 2Y76A 4DMHA 2YUIA 4TLCA 5EFOA 3T0IA 5JTTA 2VQFB 1Y98A 3MRVA 2G63A 3FNHA 3IESA 1FEZA 2HWUA 1Z4KA 2ORVA 5LA6B 4OKNA 4UVIA 1QZUA 4PX5A 4NPAA 1WUHS 2NZUG 4RJLA 3UJPA 5I3CA 4JLJA 4EJFA 2C82A 1QR2A 1ZPDA 2QV7A 3E03A 1MF7A 2I6SA 4IQGA 5BYAA 3HCFA 1T9GS 3GA7A 2PKEA 1DWOA 2F3UA 3DKKA 3RWOA 3ZCVA 4K6HA 4GC9A 4CEJA 1QQ6A 2HWKA 1GVNB 3IQGX 4QU0A 1VIAA 5UKDA 2E55A 1Z5OA 3TH5A 1KP2A 4B6EA 5CA0B 5KKAA 1KAGA 1T4CA 2GAOA 1CP2A 1TZKA 1F06A 1FDUA 1SN7A 2QSUA 4DHEA 4CU2A 3DXFA 2VWHA 2GSWA 1G3RA 4E5KA 1VHDA 2XTMA 5A0VA 1FMLA 1XZEA 4F4CA 3RANA 1VKHA 2C92A 3KAJA 1AKMA 4ZEWA 1E6UA 3UCXA 5LZ2A 1NXQA 1E2DA 2FSVA 3P5BA 4FT4A 5GVRA 5BNIA 4Y2QA 1RI4A 1GL3A 2ZCUA 5DFAA 1RYHA 5CHYA 1ARZA 1JLLB 3DWIA 2OHXA 4OLJA 1HT2E 3BBLA 3QKSB 3K8QA 3ILSA 4H1TA 4M8IA 1ZUHA 2PRSA 1XNJA 1JECA 2Q2QA 1QFZA 2B2XA 2O2DA 5DLDA 2X2PA 4LXQA 1N4DA 3P4UA 1NPDA 1KYIA 1X8KA 3Q15C 2NUBA 2ZLBA 1GRCA 2RONA 1ZVKA 3AZOA 3X3HA 3SGLA 2D7CA 3T3DA 3EGXA 4LX8A 3WY9A 1C0LA 2EFHB 4GT1A 2HMTA 1LKZA 2KI5A 1Z88A 3PUZA 3B7WA 5LMUB 3RS0A 3SLRA 1T8UA 3QWAA 4OGKA 3A4IA 2VQSA 1EUZA 4EQ6A 1ZG3A 1K8RA 4NSNA 4RKFA 3RYHA 4E2YA 4XWGA 3JVUA 5EYPA 3U17A 5L95A 1MJFA 2IQIA 3P9XA 4HGRA 1NONA 5AHWA 4G9EA 4LVNA 1KJYA 3F6CA 4XVRA 2XAAA 2VT6A 3RABA 5JD4A 1ZQ9A 2JLWA 1Z4OA 2OXEA 2RBKA 2H4JA 1NP6A 5SYMA 2PGOA 2DUNA 3ICWA 1N5LA 3F6YA 4QJ4A 5ILOA 1JH9A 4E5SA 4OOFA 1ZEJA 4HD8A 1F2VA 1U28A 2ZIUB 4MLDA 3LK7A 3ZV6A 3CWCA 4CL2A 1R0CA 1WKBA 2DKFA 1E98A 3FBGA 1U7DA 4LPSA 2GJKA 5HZMA 4KR6A 3CSUA 2H11A 3FUXA 2GEKA 4V02A 1T8YA 3I8SA 2O3UA 4CF4A 2GBPA 1P4SA 3DEZA 3GEPA 1C0KA 3H8JA 2VUUA 1M5UA 4II7A 4FX2A 2NTNA 3U44A 5CEFA 4Q9JA 1OBVA 5IU6A 2YKGA 3KSUA 2FX5A 5CFZA 5HF6A 5TQ2B 2V3WA 1U5BB 4B0OA 4W1SA 2DLNA 2IP1A 2P11A 2CV1A 1XG5A 2VLBA 3ERCA 4TL7A 2BHSA 4CUJA 3IPRA 2H65A 1H9BA 3W2HA 2EWMA 4D9NA 3PJRA 1NBIA 4C6HA 1JAXA 1NYQA 2AXPA 1TM5E 2HF7A 1NASA 3F3SA 5CT4A 4CYMA 1Y3IA 2O3QA 5A3JA 3ICQB 1M67A 1R16A 3IODA 3BMNB 1LLDA 3QX9A 2P2GA 3AH8A 2I87A 3I2IA 3UAGA 3VO8A 1S4QA 2FPKA 4XYMA 4GMXA 4CKYA 5CB6A 3HJHA 3NC4A 3QLUA 1KMCA 1Q0UA 3UAZA 4BB6A 5C5CA 5KINB 1EFVB 1HZJA 3AEXA 2PRZA 3Q8KA 5B5SA 3O7MA 2JLZA 1Q6ZA 2YW2A 4ARIA 1P2SA 5L51A 1U7ZA 1JS1X 2WT9A 4PXAA 3C3KA 2PXCA 3DAOA 4BVLA 3TW0A 2LRHA 3Q10A 2DT8A 1OC2A 1SH7A 2PGIA 3EN0A 1IWPB 3AQ4A 1DRWA 2W00A 5TMBA 4G1EB 5B1IA 3RSGA 1UEXC 1UXGA 1GY8A 1R50A 2VK2A 1ND6A 4BMNA 1X1AA 4G01B 2ZXFA 3DKRA 3WGGA 3ZU4A 2YY7A 3D0QA 4IFIA 4OBBA 4OP2A 1F60A 1GUZA 3AR6A 3D4NA 4NH0A 1XXLA 1ZD5A 4ZYWA 5ILQA 4LF6B 3KZKA 3C1AA 4QYXA 5TQ0A 4MI9A 4YAKA 3AM1A 1CUCA 2PA0A 3F71A 4O2BF 3L84A 3LUGA 1MXFA 1GL7A 3SC2A 5KJCA 1IY8A 3V1YA 1O0CA 4BKPA 5EHGA 2PJZA 1ODKA 3LZ6A 1GUFA 4FGWA 1CFJA 4FMCB 4DWWA 2AOWA 3FR8A 2I67A 2ZCVA 5J4YA 1YI1A 1TC1A 1MGPA 1RI5A 4X84A 4Y0VA 3SE7A 3TMKA 4B6PA 4XOUA 4R8KA 2H9YA 3LCVB 2AZXA 3UB2A 5IAOA 3G0GA 2XV1A 4MUGA 1C30B 3WGJA 4YRMA 3R7SA 2GD0A 4CMIA 3EF3A 4CFYA 1OH6A 4ACBA 2NZ2A 1XA4A 1OB2A 5ICEA 2JANA 5FOUA 1C3JA 2LKCA 3JR3A 2A7QA 5D86A 2QTGA 1J0DA 2NUAB 4BDSA 3T5GA 1PVDA 2FG7C 1C80A 1D4ZA 3WVNA 4BO8A 3IUPA 1T3HA 5IJ9B 2Q9AA 4X1OA 1E3JA 3IP1A 3DE7X 1D4FA 3K9LA 1T43A 1UBNA 2Q5LA 2G8NA 1OTXA 2C9YA 4K87A 4UBJA 1KMHA 5KNCD 3R23A 3FWKA 1BTOA 1QP8A 2GVNA 3HUTA 3KOUA 4URFA 3V32A 1WNTA 3IAM6 4NU8X 5AW5A 3VV3A 1XRMA 1NDQA 1GAEO 1FDIA 2ISSD 5SV2A 1DAHA 3GEIA 1GTRA 2J5BA 5CFOA 2IY9A 2VPIA 1R8SA 2LTAA 3T7TA 4LCBA 2XVXA 5L7TA 4L5AA 1QRTA 4N76A 1KO1A 2C4KA 1BE8A 3LP5A 3FX2A 2CVPA 2FW0A 4YV0A 3TAXA 2ZI6A 3O31A 3ABRB 4X6YA 1RAAA 4S1NA 5HNKA 1O95D 5BN3A 1RDFA 1RWXA 6LDHA 1RYYA 5K0JA 4R8MA 2IY8A 3FETA 2NV6A 2NN3C 2FKNA 3EMDA 1XELA 3PNBA 1HM5A 1IBRA 5CMLA 5FPQA 3SN6A 3BE4A 3C6BA 2GR7A 3T5BA 4XB2A 4OKIA 4AI6A 1HFJA 7REQA 2GN6A 3OTGA 4GE3A 5HKAA 4C2BA 4AF6A 2YWJA 1N2HA 4TMTA 4BIMA 2P6RA 1G5HA 4KTVE 4ARAA 4MQFA 2NO6A 5FTKA 4YQYA 4GOKA 2WWIA 4LX0A 1IPHA 4TXJA 2QL7A 3OZGA 1R0BA 5C53B 1QPGA 4C9BA 3DE3X 2Q4OA 1G2OA 4L3WA 3VYVA 2C58A 3KKPA 2C94A 5B58C 4P80A 2L82A 1LK0A 3A6GA 1YTLA 2D4HA 1T35A 1AOXA 4GRIA 5JMPA 5K3OA 4IHJF 4Z86A 4GAEA 5BPFA 2YUTA 4QTTB 5IJXA 4S24A 4IFTA 4R05A 1XVAA 4PVDA 1QZXA 2JNWA 3L8MA 2PVPA 1O6BA 1SIWA 3JQGB 3PNKA 4FBGA 2WAXA 3K30A 4B71A 5JVDB 3PPYA 1OI2A 2C54A 4C7BA 4C5AA 5E4TA 1U6JA 5K03A 4JT8A 4KG7A 4LKRA 1K75A 3R40A 5KQSA 3MS4A 3H5RA 1RLJA 3E3MA 4QFDA 3TLMA 5J4VA 3HMQA 2Q3EA 3KXKA 5GINE 1W59A 5BT8A 1BX0A 1BDBA 3UGQA 3H5VA 4EPVA 1F14A 3D5TA 5B3KA 2NT3A 5IRCD 2V54A 1ADYA 3ZGVA 4K6FA 1M74A 2B82A 3F9RA 3IIJA 4KBGA 3FTNA 2B0JA 2Y6UA 1OH7A 2OGSA 3G2MA 3HWX1 4N65A 5E2BA 1SXJB 1XD8A 1L4HA 1O5OA 1Y1KE 4NHEA 1Q3KA 2ZKLA 3LT5A 1FLDA 4B7CA 3MFYA 4IJKA 2AWNA 3NH6A 5AFSA 4N3BA 4DRXA 4ZI7B 5BUSA 1SR8A 5H81A 5I3ZA 2FVXA 1LK5A 4S1WA 4BEWA 4ER5A 4KXYA 1Q7GA 3Q88A 2BGRA 4QTYA 2EKLA 1P29A 3OJEA 2NXEA 3ILXA 3Q5GA 4WNYA 5DXJA 4QG3A 2ZBUA 3DAHA 1U0BB 1ZBDA 3L1KA 4YROA 4A3SA 2YZGA 4PV7A 1IHYA 1CRLA 1DG1G 2K5UA 4I5EA 4F9FA 1HZZC 2EVWX 2HMVA 4FOLA 1JX6A 1JQKA 2OZEA 3RC2A 5HX7A 4JHLA 2O0MA 3UMYA 3MW8A 4J1NA 4LMPA 1JDVA 2VSQA 3AXSA 4TWZA 4ED9A 4LJAA 1GPKA 2XHZA 4AS3A 4H6PA 4U9HS 4QECA 4W9MC 3WLLA 4EW3A 1HEUA 1ZX1A 5DT2A 1PVOA 1PG5A 3LDUA 4OFXA 5BQXA 2HA0A 5K2OA 4TLBA 3KZOA 1Z0FA 1R18A 3H17A 2Z3ZA 2I1LA 1RSZA 4ZJUA 3RKUA 4WH0A 1HDCA 2B30A 2OCIA 3FWNA 2BCJQ 3U4IA 2IS4A 4U9IS 4YT8A 5BSKA 1JHXA 4CMAA 3AVYA 4FLFA 5EQDA 3WXMA 4I0WB 5IPFA 1LFAA 1UIMA 2PBLA 4H6XA 1KL7A 3IIIA 4I2NA 3TEJA 4EYOA 3I6IA 2NYVA 4C1BA 4CKZA 1HKUA 3M1YA 2RHMA 1TM3E 2QVCA 3GFSA 2CHEA 4Z0TA 4LOLA 5IDQA 2H2DA 3CPEA 3TM4A 1APBA 1Y6FA 3O9ZA 1T0UA 3EXFB 3FN4A 4PGMA 3TGLA 1GTSA 2BFEA 2G7ZA 3QEMB 5AKKA 2YBEA 4MV7A 3ZH2A 4MQ5A 2Z4TA 1E2MA 2IK8A 1I7QB 2FDCA 3D7SA 4TWBA 5JXIA 1KK1A 2X5JO 4RHTA 1DWUA 1PWZA 1Y8RA 1IJKA 1XZ8A 3EY9A 4TM8A 4NABA 4QT0A 4EG4A 4EGQA 4I36A 4C7MA 4P1ZA 1TQHA 3SX4A 5CG2A 3UATA 5FPKA 3QEJA 3CG4A 2D5LA 1FFXB 2Y67A 2O05A 5LQSA 4WNAA 1U8TA 2FXIA 3VZSA 1ENZA 2J6IA 1VJDA 4FR0A 5CB4F 3LQ1A 1R0YA 1O08A 4MRAA 1OVGA 4DLSA 5JALA 3ETHA 4FW8A 2VNSA 4OI0A 3C3JA 4WERA 3NC1C 5JLAA 5KTTA 4FN5A 1F7VA 1R6VA 1H0HA 1DEXA 1AD2A 5C18A 1SWWA 1YUMA 2OQ2A 1TUBB 1ES9A 4J0EA 4A2WA 1C8VB 4PGFA 1KQOA 4KWCA 4YP7A 4EKGA 3DE2X 2OUKA 3WL7A 1FFYA 3T7RA 2ECFA 5DO9A 5FO0A 2C4VA 3CY6A 5TT0A 4EHDA 3P4XA 4YAWA 4ZQGA 4Z3KA 1E0SA 2OD2A 2JFFA 2AD5A 1IULA 1T34A 2H9AA 3G9TA 4MXDA 1L4LA 3JQ9A 4FNOA 2A1UB 1HEYA 4RK7A 1Z6GA 1KQNA 4C29A 4AMBA 1GLVA 3P2JA 1A8UA 1VFPA 1JQJC 2QLFA 3FOZA 2ZYHA 3A1FA 3BXHA 4W9NC 3DBLA 1KI2A 5FTWA 1NT4A 4PNPA 1QYWA 4JJGA 1DX9A 2B37A 5FL7A 3RAGA 5JYEA 4LFAB 2DCMA 3JAKB 4P33A 4TMYA 4NP6A 3D3NA 4L6AA 5CAEB 4TV9B 3ZWYA 3AEKB 1GPBA 3IMKA 3OZWA 2RAFA 4B43A 1ZNWA 3C7DB 3FYTA 3K1AB 3W9UA 4C21A 2QU7A 5BUQA 1NSYA 3C6KA 3UK2A 2CXRA 2X15A 3AYXB 3NORA 1R6BX 3RARA 4C3ZA 3GPDG 1GR0A 4CMBA 3DDOA 4AK9A 1NUUA 5CW2A 3K72B 3T7DA 4TOIA 4KO2S 3DBVO 2JGRA 5CU7A 4WCDA 5CYOA 3TDKA 1O9BA 2UU9B 1H1LA 2VPYA 2QVYX 3GGPA 3MHPA 4IDBA 3OC0A 4PFJA 4TROA 3KS9A 4I1VA 2CK3D 1XXHB 3DO8A 1QR6A 4KN9S 2VPWA 4R81A 2QYTA 2WZDA 3PDWA 2PGXA 4MVJF 3L8EA 4WN9A 5U4XA 3UV3A 721PA 5L8VA 4ME6A 2ZIGA 3S4YA 1NBWB 2R6R1 3HY4A 1ORTA 4Z8XA 2GKSA 2F6RA 2ZPTX 2UZ0A 1Z6ZA 2ZUBA 3SYRA 4DY6A 4PPNA 1DV2A 3H0CA 2A6PA 4YC7A 5BNFA 3K4PA 3QBEA 4W5JA 1JSXA 5E7IA 4DAOA 3OQIA 1RPZA 2O59A 2O8VA 2HZBA 1T5DX 1SBNE 5DNEA 5FBLB 2PXAA 3GWGA 1FFAA 1P2DA 1KAOA 1U98A 3NT4A 4QLOA 4BO4A 1MXHA 4KZKA 2HQ1A 1EVIA 3RVBA 5IT0A 1RYFA 5M34A 4G0XA 4Q82A 3O0DA 1XMSA 5LCXA 4RVSA 3C5EA 5FLKA 4EFDA 1XZAA 2Z9CA 2RGUA 4ZJPA 4RSRA 5FOXA 1IUNA 3ZI7A 2F1RA 2Y2VA 5EXTA 3LY5A 2PWPA 2ZRCA 3FROA 3OOJA 4P3KA 1YUBA 3TOSA 2IY7A 1XTSA 2QTHA 4LDAA 4OP3A 1L5HA 3GGOA 1QDUA 1OLSA 2YWBA 1E2FA 4WGFA 1SC3A 1T26A 4HQRA 2QJWA 2FV8A 1J2TA 2VHTA 2ZSUA 3E18A 3OIUA 3QYAA 4QPNA 1SFRA 2W2PA 3FYUA 3BGIA 3BWCA 3L2OB 3VDRA 3CPHA 1AZWA 2HU7A 4F85A 3WC4A 3BGOS 3TI7A 1FNDA 1O4VA 3V4OA 1H8HD 1KAEA 4MOWA 2JFXA 1MB0A 5EJFA 3VTZA 4YJGA 3QNUA 4OBWA 1FMFA 3OSUA 1RJFA 1YE8A 2AUTA 1PJQA 3NJ8A 2NAFA 4QOSA 1H69A 3MN1A 2G70A 3LMKA 4XASA 4E5VA 2Y9MB 5B7NA 3HC7A 2QRNA 1Y9EA 1BHSA 2IQ5A 3VVCA 2B69A 3GJ4A 4DRZA 5BN4B 1CF9A 1XD9A 4KVFA 4DM7A 2EGGA 3ESBA 1PS8A 2G1JA 3D8HA 4D82A 3QSYA 4QUEA 4UASA 3WSWA 4YCJA 1HL7A 3KQLA 2XUHA 3F9CA 5HMMA 2BC9A 2VJCA 5FUYA 1LB1B 4RENA 3MGKA 4MLCA 3ZR4B 4NR0A 1Z82A 1T6YA 2V1XA 1WZCA 3IQZA 5FFFA 4U6QA 4C7XA 5DISB 3KFLA 5JPIA 4BV9A 5KYXB 1EBBA 2TMYA 2BMFA 5CITA 4H1WA 1MEEA 4DIDA 2G1KA 4DA8A 4L50A 2YYSA 2FZLA 5HQ3A 4L3OA 3CNLA 5EPUA 1UXHA 3H8WA 3I73A 4X1YB 1WXIA 2CHGA 4LQDA 4YMVA 4UTNA 4FFLA 3I5YA 3BGDA 4Y2TA 2EKQA 4MMYB 2P9YA 3LWDA 4FR2A 2AXNA 4B3BA 1MRZA 1XRQA 3FDZB 3UCFA 4MTLA 3BMQA 3BG5A 3OCUA 5L3ZA 3V46A 3L9WA 1GQOA 2YVAA 1PJ4A 3TIGA 3U7JA 7ADHA 1KR2A 1EEHA 1RLUA 3UOWA 4E5NA 2J0UA 1JXOA 2QY6A 3ZEIA 1ZW6A 4BKQA 4L5CA 4DY4A 3IT0A 1OIVA 3A0UA 4DJ5X 1ISHA 1WEHA 3NHWA 1LRKA 2OGUA 5KYUB 1DSSG 1ECBA 3AR7A 4XRGA 1Y3DE 1U0NA 1G5QA 3IGFA 3B51X 3R2JA 1ND5A 1GZ3A 1Z68A 1Z7GA 3M6VA 1R7RA 4Q7MB 5AJYA 4ZWNA 2W98A 5IN4A 2BN4A 5D1NA 2IEBA 3C7AA 3OFJA 4Y7DA 4RX1A 3W90A 1PBNA 2XTAA 4JI6B 4BGDA 2PMEA 2C7RA 4EOGA 3CVVA 1IOLA 1CP3A 4KYVA 2KM1A 3PWKA 1LFDB 1QZ3A 2YWHA 3PFGA 5GZ3A 3HEMA 3EW9A 3HKBA 1J2EA 3DL2A 3ED1A 4LPKA 4HB0A 3GBVA 1P1KA 3HVJA 2C9CA 3KSAC 1IEQA 1DARA 1AA6A 4G4GA 2WJ3A 4QBIA 2IXAA 3ENWA 4JENA 4AU1A 5C1OA 1PD0A 1DINA 1BU8A 1QBKC 1U3VA 3G82C 1LPPA 5D51S 3QXHA 1HXHA 3CNEA 3H2YA 3QP9A 4U39A 4BGIA 3KDSE 4RLFA 4QHTA 2ZYWX 5AOCA 5ALJA 3L1IA 1OBCA 2E89A 5T8KC 5ADWA 3GXOA 2V03A 1MVLA 1PT5A 2XYPA 3CRW1 1IHXA 1BGVA 1D2HA 2C7GA 2J46A 4BQPA 1AV7A 2II6A 4NXMB 4OHKA 2ZRMA 2AFVA 5JD5A 1ZAKA 4R98A 2N47A 4RW0A 4Q3EA 3U4HA 1CUVA 1REQA 4X90A 1U1IA 2J32A 3LW7A 3GUCA 2VP3A 1ZXBA 1YULA 3M34A 1JN0A 3FI0A 4MB2A 1QE5A 4WJKB 5TV2A 3VM6A 4AY2A 5KOJB 4Q1CA 5E7QA 3SVLA 5THXA