3IOEA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.95 ang resolution in complex with 5'-deoxy-5'-((r)-3,4-dihydroxybutylthio)-adenosine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
286
structure length
286
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 92
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3ioeA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3ioeA01
1WXIA 4DNXA 4G6ZA 1TYCA 1N2BA 4AS1A 1LI5A 1D2RA 3CLUC 3D6VA 1WOYA 1JECA 1QRUA 1X6VA 4MW6A 3MXTA 4YP7A 3ND7A 1VBNA 4AQ7A 1NP7A 1OWNA 1O0BA 1FYDA 4DLPA 1U7DA 2CT8A 1T9GS 3Q4GA 4U63A 4OUDA 1H1TA 2TS1A 1N2HA 2QUKA 3CLSC 5AHWA 3NV7A 4E1AA 1WJGA 3A4IA 1XJQA 1EXDA 4MVXA 1M8KA 4ND6A 4EG7A 2DERA 3PRHA 2BYTA 3DV2A 4HJXA 4MWDA 4NAHA 1OWOA 3X1JA 5TS2A 1O0CA 1EFPB 2NSYA 1BS2A 4A91A 1KAMA 3AKZA 4CDNA 1YIAA 1KQNA 2DLCX 2AZXA 4JFAA 3P0HA 1ZJWA 1NUQA 4I6GA 4MUIA 2A88A 1NZJA 3CVWA 1VBKA 4MUEA 4MVCA 4MW9A 1YULA 3IOEA 4F4HA 1NUSA 3KT0A 3ZJUA 1KH1A 2PIDA 1O94C 2J07A 3K9WA 1WQ4A 2A1UB 3CVVA 2H29A 3BL5A 1I6LA 1XNJA 4TS1A 1VLHA 1JEEA 3D6UA 3KFLA 4HPWA 1Q19A 3FG9A 4U8HA 4MVYA 2XRZA 1I2DA 1N2GA 4JYZA 3A05A 4MWCA 4PBRA 2DXIA 2A84A 4JXZA 4RPIA 1R6UA 3VGJA 3CVUA 1KKUA 3ND6A 4L2IB 2A1TR 3TNJA 2YXNA 3DPIA 5IHXA 1TEZA 2VTBA 3TS1A 3VU8A 1KH3A 1TYBE 1V47A 1ZH0A 1IRXA 3MLAA 4OUDB 4X0EA 3RFFA 2PXHA 1IH8A 1O97D 5FO0A 1QNFA 5J5AA 5TGTA 4ZCRA 1IQUA 4MVWA 2WSIA 3ND5A 2RE8A 1LW7A 4HK4A 1GLNA 3FOCA 3IMEA 1P7PA 1GTRA 3CR8A 3IOCA 1K92A 3TZLA 3ILVA 3IODA 1WQ3A 1Y42X 3X1KA 2WB2A 1G8FA 3FHJA 4JXXA 2CFOA 4DDMA 2JANA 4YP5A 1QTQA 3CLUD 1Q77A 2QUHA 3IMCA 2QTMA 3G6KA 4CQNA 4KR6A 4G5FA 1TQ8A 1OBHA 3ZJTA 4GU5A 4CT0A 1N75A 3S3TA 2DR2A 1KR2A 1PFUA 1OWLA 3HFJA 1WXGA 1J20A 4Q16A 2ZP1A 2V0CA 2J08A 2HZ7A 3UC5A 1F9AA 4MW0A 1K4KA 3TZEA 3AIIA 1NURA 3CLSD 3IH5A 1MJHA 1KORA 3GUZA 3FETA 4YP6A 3UMVA 4MW7A 3A2KA 2GKSA 4ZT3A 3K32A 1ZH6A 2A86A 2Z09A 2R5WA 4L2IA 3UK2A 1MC1A 2QUJA 4WNYA 4UZEA 2J09A 3SP1A 5K0TA 2VTBB 1QU3A 3TQIA 4YMIA 3IUEA 2QJFA 2JA2A 1N2EA 1KH2A 1KP2A 2IP1A 3E27A 5EKDA 4DJAA 3I05A 1J70A 1GN8A 1O94D 3FIUA 1J1ZA 4F3RA 5KHAA 4ZCPA 1IQRA 5J58A 4FZJA 1NUPA 1N78A 2QUIA 3ZJVA 1PG2A 3HZRA 2DPLA 1N2JA 1IHOA 3H9BA 1O6BA 1U3DA 3HL4A 4R2LA 3CVYA 3GLVA 1HYBA 2GM3A 3P0IA 3LE8A 2GOYA 4ZCTA 2PZBA 1M83A 2D13A 1G59A 1Q11A 1JGTA 2DEUA 2G36A 1O95C 1N77A 4KR9A 3LCJA 3X1MA 1YIDA 3A04A 1V8FA 2E21A 3QTBA 3Q12A 2YWCA 2OV4A 4I6JA 5HUHA 4CDMA 5JBNA 4ZT5A 1IVSA 1UFVA 3N05A 1QRSA 5KWVA 2E0IA 1G8HA 3ZXSA 3L93A 1J09A 3H99A 3PNVA 1G8GA 1TYDE 2CV1A 1EFVB 3QE4A 3COWA 3HMQA 3AFHA 4EF6A 3SZGA 3RHSA 1EUQA 1N3LA 3P0JA 1JIJA 2X0KA 4MUNA 1GPMA 3RK1A 4I6EA 1O96B 3OTWA 3ZUGA 4MUHA 3COZA 1XNGA 1ULHA 1EUYA 3KT6A 4QBTA 1N2OA 2E89A 3ZXIA 3FWKA 1EE1A 1O5TA 1GTSA 3U1VA 4NX2A 2QTRA 5H7XA 5LLTA 1MOPA 1IQ0A 1JMVA 1XNHA 3Q10A 1JILA 4K0RA 1IFXA 3F3MA 5FO1A 4MUKA 3COVA 2X1LA 3NBAA 1YI8A 2EL7A 3IVXA 2HMAA 4XFJA 3IDFA 2I1LA 2OQ2A 2YWBA 2V0GA 3DO8A 1KP3A 4MWBA 2QJOA 4KPUA 3IUBA 1QRTA 1OWMA 2A7XA 1MAUA 3IVCA 3OP1A 3FNRA 2XRYA 2A1TS 3H9CA 1KAQA 1T9GR 4KKVA 3CLRC 4ZT7A 4MLPA 1NUTA 2QTNA 2PZAA 1JEDA 3FI0A 2WQ7A 1KQPA 2CYBA 4MWEA 4ND7A 4EG1A 5KCMA 2J5BA 1H3NA 3JXEA 1I6MA 1EFVA 4ZT4A 4ARIA 4RUKA 2YY5A 1T6YA 1PG0A 4U7JA 3SYTA 1R6XA 4PY2A 1COZA 4UZFA 1SURA 4PBTA 1U3CA 1M8FA 2Z3VA 3VRHA 1OD6A 2B7LA 1M1ZA 4NATA 4NDAA 1NSYA 4MW2A 3SZ3A 1NYLA 1O96A 3RBAA 4EFKA 2QJTA 2J4DA 5HG0A 5F23A 5LM3A 4EG4A 2BTEA 4YBRA 3IVGA 1VBMA 4EG8A 1NUUA 2PFSA 3CVXA 4MUJA 1O95D 4WSOA 1WXFA 3CLTC 3N9IA 4QREA 2DETA 1F4LA 2O5RA 1GAXA 1J21A 5HUJA 5DK4A 1U0BB 1QU2A 4R2MA 2RD2A 1ZUNA 2DUMA 1KQOA 2PG3A 1B6TA 1WZ2A 5J59A 2CSXA 2JAXA 1JIIA 1MAWA 4GRIA 1I6KA 2Z08A 3LOQA 3SDBA 4MW5A 3FY4A 2CYCA 2ZUEA 2CYAA 4KPUB 1YUMA 3CA8A 2IELA 2H2AA 5FNZA 4J76A 3GMIA 1X8XA 1DNPA 3L92A 1N2IA 3KT8A 3SEQA 4ARCA 4XFDA 3DLAA 1PFVA 4PBSA 1Q15A 1GZUA 3P52A 1EJ2A 4ZCQA 1YUNA 3NBKA 1LI7A 4MUFA 1WXEA 1MB9A 1NI5A 1ILEA 2E18A 1F7UA 2AKEA 4MULA 2C5SA 3FDXA 2CV0A 1TFUA 4ZT6A 1M8PA 2HGZA 2PZ8A 1T6XA 2CV2A 1QJCA 2EJCA 1CT9A 2ZUFA 4DE5A 1PFYA 3SEZA 3UY4A 5K0SA 3ISJA 3N8HA 2X1MA 5LFAA 4MUGA 2CUZA 3ZGZA 1MB2A 4ZCSA 3IOBA 1K97A 1VL2A 2D54A 4XSVA 4NAUA 4S1OA 4J75A 3COYA 2A4MA 4Q93A 3ZIUA 1U7XA 1TYAE 2AG6A 1S4MA 1H3FA 3INNA 1OBCA 4JZYA 3G5AA 3FH0A 3KT3A 4P2BA 3IMGA 1WY5A 5DASA 3N2YA 1JZSA 2X3FA 4G5YA 1MRZA 3CLRD 4EGAA 1R6TA 3HV0A 3M5WA 3MLBA 5IJXA 3AL0C 3PNYA 3C8ZA 1F7VA 1N1DA 3MUEA 3PXUA 5TEWA 1QQTA 3PNBA 3H97A 2WQ6A 2NZ2A 4KR7A 4DDKA 3AG5A 2IJGX 1EFPA 1WKBA 1MBZA 5BNZA 4K03A 4MAFA 4MW4A 1JZQA 1J1UA 4OJMX 3CLTD 1FFYA 3ELBA 1WXHA 1K4MA 1H3EA 4QRDA 2D5BA 4EG5A 4EG3A 4H3SA 1O97C 3HGMA 5H16A 5DB4A 3UOWA 3QTTA 1PFWA 4EG6A 1JIKA 1M8GA 4HJRA 4ZT2A 1T6ZA 3H05A 3G59A 1A8HA 1RQGA 2A1UA 4DDHA 4NZPA 3RJZA 2VXOA 1JHDA 4MQ6A 3AG6A 2O8VA 4MW1A 3RK0A 5TEVA 3MMXA 4BWVA 1M8JA 1OWPA 5DEOA 4R0NA 3TQOA
chains in the Genus database with same CATH superfamily
2FWBA 2XEDA 4JGIA 2EBHX 5FOSA 4LF7B 1BQ3A 1QV9A 4UVDA 2PUCA 4AS1A 2B82A 2IY7A 1WCIB 2N9UA 2Z9BA 4HXGA 4KQMA 4LHYA 2YOHA 3OMWA 4EBFA 3F6PA 4ZICA 5HS4A 2DRIA 1YDHA 3EXIB 3QP9A 4CT5A 2RH5A 5CLJA 1EFAA 2RGAA 2FN3A 2JAUA 2ZUDA 4YWJA 1G6OA 2NPIA 3ZWBA 4BVKA 2XYPA 1JLSA 4C6TB 2ONYA 1H42A 2VYQA 1HOXA 5BOSA 3MINB 4DV0B 4D57A 4F0JA 1G6HA 2I7CA 2YHIA 4QT0A 2AE2A 1T9GS 2VDVE 2EP7A 5GJVC 2IUUA 2Y1CA 4IDOA 4F97A 2L69A 3B1XA 3B13B 4C06A 1P4GA 1HYQA 3CE6A 2AKAB 3T0FA 1XSEA 3GP5A 1SG6A 2H0QA 2OV8A 3O3NB 5KC8A 4AFNA 2CF5A 3AIKA 3L8FA 1M6HA 2ZWIA 4N9QA 5G40A 1ZJ6A 1Y6QA 4FM9A 2Z6UA 4PLTA 4YI3A 3M3DA 2YINC 5BQXA 4HJXA 2C5LA 3N75A 2VAMA 2O6HA 4JJ8A 4AN0A 4JT9A 4QJBA 2OHVA 3PQ7A 5E0OA 1EVEA 1ZMTA 3UV6A 1Y4AE 2OHOA 4Y1RA 5EP1A 5CFPA 1MXFA 1XVLA 3L06A 3SJAA 1ISPA 2QBYB 2CGEA 2H85A 3PNPA 4P31A 2WLSA 4IH9A 2AW5A 2IEZA 4YRRA 1VJGA 3B9PA 1AMUA 4WXYB 3UMFA 2JPDA 4QWMA 1L8AA 3CSUA 5A05A 3D3NA 2Q1XA 4X8OA 3ZEIA 3EY9A 4FBMA 3O2NA 3CUYA 3U7JA 4BX2A 3KSDO 2C8KA 4FYXA 2VQSA 5AXCA 4V38A 2YS7A 1U8YA 3PNOA 3R3YA 3GR6A 2IU6A 1L4YA 4PLVA 3F2IA 1KA9H 1LX6A 3AHFA 2VJDA 2NSLA 3AVWA 4DMRA 1V6AA 5EE9A 2F1RA 1RE1A 2PUGA 1W85A 3TR6A 3GLFE 4OQPA 1Z25A 4CV3A 2NVOA 1X2BA 2CLIB 2GN9A 3CCBA 3IUYA 1MQSA 3IT0A 1XZ8A 2IOHA 2JCXA 4L2IB 4RULA 5FPYA 3FUXA 2RIRA 4RVNA 4NK4A 4K88A 1GXSA 1SXJB 4OPMA 5ALMA 3VU8A 3G0DA 5EFZA 3MJEA 4CZ2A 1UJ4A 1Y8QA 1PNRA 4CCYB 3NQ41 2B99A 3C5VA 4DG8A 4ZEXA 2QRGA 3LYAA 3Q72A 1MEEA 1E1MA 2WYOA 3VPAA 5CG2A 4BRSA 5E1MA 3TW8B 3PQ5A 3KKQA 5LB2A 5DHUA 1L8LA 2REXB 3IKJA 1ITZA 3ULKA 2NTNA 4IDAA 3U2QA 1PAUA 3U3OA 3KBBA 3L7OA 3IXLA 1P7PA 2QVYX 1XRPA 1K3UB 2LCFA 2ECPA 1T43A 3BD8A 1WV1A 3RSGA 3LCMA 3C6YA 4R40A 2H3HA 3S5JA 3GLHA 3ZGYA 3B7WA 1SBIA 4KQFA 2YVQA 1SZCA 5T64A 5A4AA 4ZQIA 1N5LA 4IZHA 3V7NA 3WSWA 1Y7HA 2MSWA 2X40A 1IDN1 3G3EA 1YK1A 1U0TA 2DPMA 2WWFA 3L43A 4OP2A 4WHMA 1L3CA 4HGNA 2PBZA 2I34A 5LXTA 5ESXA 3B70A 2AMLA 2QK4A 3KL2A 1PFUA 4NYJR 1DIRA 1HNWB 3K5IA 3D64A 4GICA 3KWJA 1IEVA 2JIBA 1YAHA 3I0MA 3FNIA 3VJMA 2O07A 4RJ2A 3UJHA 2RHBA 5J4VA 1EUCB 3JWHA 2JFXA 4K5QA 4YCBA 5JG7A 5JD4A 4ZVLA 1PZHA 3FLEA 1PFGA 3ENQA 2W6CX 1PS8A 4G8JA 4QO8A 5A9TA 4KODA 1DAKA 2OSVA 2AFHB 1KRWA 5DX8A 3R5TA 3EWIA 3RYHB 5REQA 1CQZA 1TF7A 3OFNA 3EDCA 5EE3A 1UEIA 3MCVA 1G7SA 1PT8A 3EOZA 3CBQA 5AP9A 1GTMA 3KHTA 3QOWA 4WKBA 3OQOA 3R3HA 4R8KA 3E05A 2ODQA 3IQZA 2YRXA 2FSFA 4QUIA 4DQXA 4CLRA 2VHYA 3CNHA 2J6BA 4FBLA 1CP3A 1WCWA 2ZANA 3BTSA 1SXQA 1ZN2A 1KNQA 3E27A 2SKDA 3QU2A 3JTMA 4RZIA 1Y9DA 3RS4A 5K8CA 2NX2A 4Z4QA 1WUTA 1O94D 1GN8A 2C8JA 2AVDA 3GRVA 5CDFA 2HLNA 2V7UA 4ZI7B 3F96A 3OUTA 3SQLA 3UT0A 1CVIA 1Z68A 3KKLA 4XI9A 2AJBA 3RI3A 1HMPA 2XRMA 2C1ZA 3OJ0A 4R83A 3T7KA 3ETHA 1UBUS 3D3QA 2A9FA 1X7ZB 4P7FA 2NNLD 3BB4A 4BJ1A 2PPLA 4DQ0A 4RKYA 4Z7JA 2L18A 5C7IO 1ETUA 4QOGA 5FWYB 2YXDA 5I7AA 4BMZA 2BGKA 2EWWA 2JKZA 4DMGA 1YS6A 1MW8X 1PT5A 1YOVB 3BL8A 2D13A 2FAXA 3LWDA 3NIFB 3O8OB 1N9GB 4RVDA 4EIWA 1Q7EA 3IEVA 3W5IA 1XZGA 1Y9AA 2N0SA 2RCNA 4R9NA 4YPVA 1KMHB 1LTKA 3AKDA 4QOFA 4PLWA 4B75A 2IOQA 4AAYA 2C96A 1UPCA 4XYLA 2PSSA 1LVHA 1RE0A 1HH4A 1KFBB 2D00A 3EIQA 1UFVA 1LSJA 4LOJA 2B7BA 2DY0A 2ZSIA 3ODPA 1Y9ZA 5BVHA 4XSGA 1YBFA 4TXLA 3SZRA 1E6MA 3VYSB 1I6WA 3RIMA 1NASA 1GZVA 3U31A 2OQVA 1BG6A 4ZZ1A 1WSBA 2B20A 3ZU3A 3AFHA 5ECWA 7REQA 5JYEA 4EF6A 3KVNA 1MA0A 4M3NA 3LVFO 4R31A 4P3PA 1UC9A 5CDSA 1P0PA 1Q0PA 2C2YA 1DIAA 5FPPA 3E9RA 1R50A 1TT7A 2O9JA 4XVQA 5KAMA 1SQGA 4BRZA 3BH0A 2FY8A 2WIKA 2ILTA 3I2HA 4PANA 3QFSA 1NVMB 5TPWA 1JN0A 1OLUB 2Q0SA 3ZLTA 4PGFA 4F2DA 2CLOB 4KTTE 4W1QA 1HPLA 2GF2A 1FVXA 2G71A 1B16A 5CPBA 3VGPA 1ZXBA 5ILQA 1X2EA 1BSVA 2EFGA 3KWLA 2ATVA 3H9EO 3GA7A 4LVOA 3R23A 5CHEA 3WLAA 4UNSA 1X92A 2EATA 4QBTA 4XKJA 3ZDCA 2ZCJA 2YWFA 3ZQ6A 1GCAA 3NC0C 4ER6A 1HDRA 4G4SO 2AB0A 4N5MA 3U1VA 3V4PB 5B6PA 1AB6A 4YS6A 4PHHA 1A9QA 5IDWA 4BFXA 2ZUSA 4XDGA 2X0JA 4JBGA 2XGOA 3PS9A 5ERGB 2OXTA 4DQVA 4EVSA 1L4MA 3HYSA 2FXVA 3E15A 3MRXA 4IZOA 4U8GA 3BFJA 1YJ5A 2H2GA 3COPA 2VTKA 2H4WA 1P9LA 3F3MA 2CD7A 1HQYE 3EF1A 3MTGA 2AEFA 3OECA 3Q40A 4UDYX 2J7PA 1CR1A 1W2HA 2HA6A 2GBGA 4L15A 3IQEA 1FRZA 4UXJA 2GM5A 3TKYA 2HJWA 4XFJA 3QBEA 4BVAA 3JARA 2UZIR 1H6AA 3DO8A 3ENVA 4FGZA 1CVRA 5B2EA 1VL8A 3O1IC 3NGMA 1K68A 3T7EA 3OCUA 4BUZA 3L0IB 3AF2A 4DYHA 1G8YA 3RT9A 4PZEA 2BGTA 3U7QB 2P2ZA 2R11A 2GN2A 2LV8A 4WZAB 1A8IA 2XDQB 1NRJB 4HRYA 5LOVA 1VMEA 4LV6A 4F2PA 2G1JA 1UJBA 2C8VA 2CUKA 3KOMA 3PZRA 4NP6A 5TY0A 3L9XA 5KO2A 3M9LA 5L3VA 1DO2A 2FZGA 3SR4A 5A4FS 4DY6A 3AP1A 3DDSA 4LX8A 5AVUA 5EHGA 3H5RA 3I5XA 4OF4A 4O59O 2GPYA 1GUBA 3BE4A 4RLSA 2CDAA 4L9AA 5IXYA 1P2DA 4ENUA 1U99A 1QYIA 2JJMA 3LV8A 2P9GA 4BC1A 1GM5A 3AW9A 1W0KA 3TL3A 1NSYA 1SCKA 2HXYA 3L8DA 1PLKA 4HGPA 4Z0HO 1XHFA 1WDLA 3RBAA 2QJTA 3SKYA 1BA3A 2YYZA 3ST7A 3FZYA 4IF6A 3L1UA 5A5VA 4OQYA 3ITNA 4KRGA 3SSOA 3ADOA 3BFXA 1HMYA 3LT4A 4PSVA 1WXFA 2A92A 5LP6A 5DRTA 4QDZA 3ZS9A 1SQFA 1CG6A 1JU3A 1P18A 4KLCA 2CHQA 3BJZA 1EDEA 2WSMA 3F1LA 3IBSA 1R0ZA 3R6DA 1W4BA 4LTNA 5LZ7A 2R8ZA 1HDZA 1PGPA 2JCSA 3E48A 3RBVA 1PF7E 1B6TA 1YKGA 4GSLA 2IS6A 4O3MA 1A8UA 3MWJA 3UWPA 3IAS1 3P9KA 4LRTB 3FTPA 2ZRFA 4AIRA 4B71A 1FUKA 1N0IA 2Z4RA 4HRAA 5EXXA 3ER6A 4HADA 1FSSA 2C0PA 3MQ4A 4HSGA 2PA0A 1UEJA 5H59A 3ZNNA 4D4KA 3Q6NA 3SHVA 3DTYA 5FXMA 1LZLA 1SU6A 2OECA 3NIGB 3RVDA 3IEMA 5HS6A 4EJ0A 1BJKA 4W5QA 1ZGZA 2WZQA 2WNSA 1B0AA 1SHKA 3CUTA 3BQ9A 2V4ZA 3N8KA 4W9NA 5ALJA 1E0AA 5JQGB 5K0GA 4YDRA 2WU4A 1UMCA 3CUUA 3IUPA 3GT0A 4WGFA 4EPYA 4NFHA 3VZCA 3IUSA 1KVTA 4CMJA 1JFVA 4D7AA 1SD5A 5CJ2A 4LZWA 5CURA 1Q6YA 5F21A 1L7XA 2VLBA 8ATCA 4MNTA 1QIFA 2TMGA 3R40A 3SM3A 3ZK7A 4F1JA 4EG0A 4TPKA 4F4HA 5AW2A 4ZOEA 3QU4A 2W2PA 2BEJA 3K70D 4MULA 4CM1A 3FLAA 2VBFA 3CUKA 2CW5A 5BYJA 1TCBA 4BJHB 5ICFA 5LC1A 4ZCLA 2NZVG 4KFTA 2X0FA 3TVYA 2HGZA 4EUFA 2R6R1 4A8JB 1X14A 1L8QA 4JELA 4UCQA 4X41A 2AXPA 4A1OA 4JHXA 3RKRA 1EXWA 1I1QB 1T4MA 2DG2A 3LXMA 4RETA 2FWAA 4WZBE 2FWRA 5H4GA 4JVLA 1CRLA 1XZNA 1IUNA 3N8HA 1RP7A 1B6RA 4RHEA 1E5TA 4AJPA 2JI8A 5IJZA 1G9XA 1V6CA 1IY1A 1D5WA 2WAYA 4TLBA 1XDGA 2X22A 3RADC 8OHMA 4J16A 3E9QA 5JTUA 2XMRA 4GKAA 4IRXA 4LRSB 4DB2A 1SOUA 2SECE 1JT2A 1IXZA 1KFCB 4FEGA 4JBIA 4Z8XA 3AYZB 5TQVA 3NJ8A 3CSSA 1P1JA 2HFKA 4B4VA 1IM8A 5LU8A 2C42A 3MLBA 1ZIPA 1DRWA 2XD9A 1E1RA 1Q6ZA 1V48A 2X7JA 4M7PA 3R7SA 3W9UA 2HPHA 1IMOA 1F7VA 3QPVA 2FEXA 1OAOA 2A0YA 5G53C 3QVSA 2XVYA 3VPFA 3DCIA 1LTQA 1BKYA 1D07A 1I2MA 5CB0A 4R54A 3E18A 2BE7A 4TL9A 1RYMA 3IP6A 2ZB4A 4Y98A 1PK9A 3GFRA 4UTZA 2IV2X 1DHTA 3PKIA 3L40A 3R3XA 5D51S 5KINB 4M6WB 5JNSA 2E5FA 5IJ0B 5DSTA 3GZTB 1GG5A 4KNVA 1PR3A 2CFTA 1HXHA 1ABBA 3HVUA 4BNMA 5HZKA 4XYMA 5AI4A 2VDQB 1DX6A 4WN9A 3S2UA 3TLMA 1JKJB 1VCMA 3WXBA 4IGEA 3MZ0A 4HDSA 5CBPA 2G9UA 4HUTA 3VV3A 2QXYA 4H60A 4HLCA 4MYHA 1TGYA 3SHOA 1ESEA 1CF2O 3FPKA 1JDJA 4D9FA 1YR6A 5AJZA 3B38A 3FPCA 4FZ5A 4L6AA 4W5WA 4RELA 3VH2A 6NULA 5CX4A 1JIKA 1M8GA 2O8EB 3HQ4O 3BIOA 1L7BA 2JGDA 2VT6A 3ESYA 4H6PA 3GZNB 4LX0A 4A6PA 4NBRA 2WG0A 5HKKD 5HZHA 1M6VA 3GUVA 4PGHA 2GLUA 1CWUA 3OBIA 1S0UA 4OHRA 5JCOA 3IJPA 4QHSA 3DT9A 1OFUX 3BMOB 1XG5A 2EP5A 3LYHA 4MJ3A 3E9ZA 3GLKA 5JZBA 4BC0A 4OH1A 2PEYA 3B8HA 1S8FA 4ABTA 2CC2A 5FR1A 1KERA 4TMWA 4D6PA 3RVRA 3QVGA 1FPMA 1Z4PX 2C5HA 2DECA 2XMPA 2VATA 3DGFC 3LD9A 5E1OA 4DBLE 1U6IA 4XJTA 2EFEB 3GA0A 2XCOA 1A98A 3EZ6A 1K2WA 3EXHA 3IT2A 4KWEA 4CQMB 3TXXA 4DIUA 3IP8A 5CCXA 1EDZA 4EATA 4KGDA 3ND7A 4R98A 4M0UA 2GD2A 5HTKA 3UPDA 1T8UA 1EGQA 3O8BA 1YJXA 3KJGA 1AKUA 3LLMA 4BFTA 3VKHA 2XCTB 1QH1B 5CK5A 1VE9A 1OILA 4IHJA 1JXOA 4QLBA 1IZ7A 1LGYA 5GVRA 1W4CA 1OPRA 4UVGA 4ZTZB 1A5TA 4C03A 2Q8QA 3O4RA 4OUDA 2IHZA 2AFRA 3PUJA 5EZYF 3RRYA 3K30A 1U28A 1RFGE 3TJMA 4B6SA 2WU8A 2ZREA 5KTYA 4YR9A 3QRWA 1E7SA 1JDBB 2BF4A 3EQ7A 3OF2A 1N2CB 2OFPA 3LBNA 1C3XA 4FDLA 2HCBA 4KXMA 4MGHA 2H8GA 2IE8A 3K4QA 2VH2A 1YCDA 2VKTA 3RYCB 3TWOA 4A8PA 4D9GA 3LUBA 3LO5A 5F1OA 4CDNA 1VE6A 2C4NA 2QAJA 3GEPA 4PONA 2QTFA 1Q7TA 5GJWC 821PA 4JFAA 5FCDA 1T3TA 1TM4E 1P7WA 1Z6PA 1KR5A 2HADA 2NVWA 3DL0A 3DEHA 4GM1A 4MQEB 3UXYA 3B3QA 1FTSA 2EX4A 3OFSA 4LYEA 4CM8B 1TVEA 2ZBFA 1KSHA 3CB2A 4GLBA 5TPZA 1QLHA 2A9PA 3TB4A 5LPNA 3HRIA 4I6GA 1NYRA 2GO7A 1UT8A 3OOSA 4FZ3A 3PLAE 2A88A 4KMMA 3UTDA 3GYGA 3I9FA 4HNQA 4ZJPA 4EO4A 5L7WA 1KEEB 1W2GA 2DSNA 4IOMA 4CKXA 2G0TA 2XB8A 2WA2A 2D5IA 3KR1A 1XXLA 5C8ZA 1U8XX 1G0NA 2IYFA 3GC6A 2I5PO 3ZQ4A 2JLWA 1GPBA 2YOGA 3VKGA 5KI6A 3K6SA 1DQZA 3JQCA 4CLEA 2IF2A 5FFMA 1KI3A 5CU7A 2OCIA 3CY6A 5H80A 4RY8A 1V5WA 2JGMA 5THKA 4IFIA 2GZ2A 4EELA 5A02A 3R76A 1LBEA 3BB3A 3CG4A 1FVHA 1ML3A 4BTVA 2GFIA 2WMYA 3D6UA 3DDZX 3LY8A 3TMAA 4Y0VA 3U16A 1KL7A 1W7AA 4O2AF 2PGDA 4MGIR 5IT5A 3B51X 3L4KA 5FPKA 3TTSA 2IHNA 2FE1A 2PZFA 2PMBA 1XPRA 1ZD2P 2PO7A 1Z73A 3ADBA 4DBLC 4HAWA 4KQIA 4DKJA 1ULSA 2WEKA 4RX1A 2X8JB 3D4BA 5DGCA 5DGXA 2LWIA 4B09A 2NUTB 3PDIA 2NO4A 3B53X 4YWHA 2OILA 1NE7A 3WR5A 1VRWA 3HLKA 4M38A 2VTBA 4TYMA 3GRCA 1FZQA 4HTFA 3HYLA 5CIYA 3LU1A 1Z7GA 1CRZA 2IXDA 1WEHA 4AD8A 4P86A 6REQB 4JP3A 1L8OA 4Q1EA 4C4TA 3AUJB 5JSQA 4FB4A 5KSZA 1HUQA 3A2LA 4KPGA 2VDOB 2HQRA 3ID6C 1L7DA 3CU5A 1RPNA 4KVAA 2H00A 5FO0A 1FVOA 4XGQA 5J5AA 5TGTA 3TR5A 4F3CA 4U0KA 2G6BA 2AIRA 5CFRA 3VR2D 4DLLA 4RLQA 5CW2A 3RSSA 2QGZA 3B1YA 4AJ1A 3RVPA 1LW7A 3AESA 3K6RA 4HK4A 3EPKA 4I08A 1F17A 1P1KA 2Y6VA 1J8DA 2AN4A 3LIPA 3GVIA 4GEGA 3CEJA 4MSUA 3HR8A 4IJMA 4MA5A 1WQ3A 4LNAA 5TMBA 4IIXA 1F2TB 4M9SA 5C5CA 5CEEA 2W37A 4QAQA 2A5DA 1ZVKA 2CMKA 4NYMR 5EC8A 3U48A 5IKMA 2I0FA 3K2IA 4M76B 4OHYA 3W9YA 2A5JA 2ZBGA 1RVV1 2X23A 3E3AA 3OT1A 4UUAA 1XWIA 3EPLA 4AT1A 1XJCA 4EZBA 5KQSA 4IL5A 1TQ8A 1EFHA 3DBVO 1SBTA 2OHIA 1LVGA 4I4CA 4IVRA 4WTOA 1T0IA 3K8YA 3QEAZ 2DR2A 1P5ZB 1RXSA 4LJRA 1KVSA 2MYTA 5JH7F 4WDQA 1XCOA 2PH5A 1PJCA 3DWFA 4BNYA 2V0CA 5LYJB 1DXHA 4DQKA 3UC5A 3HVJA 4MUBA 3EPHA 1P6UA 4UVIA 3SVTA 3A9VA 3UAGA 3EZ9A 2REBA 2P30A 2DYKA 3T7AA 4NBLA 4OB6A 1QCYA 2I7DA 1KO4A 2PYZA 2Q41A 3ACBA 3BXGA 3NUGA 4UNIA 3UCFA 4QQNA 4QHTA 5A62A 1P60A 2ZYSA 3HXKA 4NMHA 5LD2C 1F6DA 2OD2A 3LT2A 4M22A 3PLRA 1Z9BA 4CIBA 1ZH6A 3EMDA 3ZY2A 4B76A 1Z07A 2Z09A 2J41A 4FR5A 3T5MA 3PUWA 4RTOA 4LYAA 5CEFA 4XVUA 1DAIA 1JBQA 3OKAA 3YASA 5KYWA 3M0EA 2EW8A 2J09A 4XM2A 4ENPA 3PGMA 2JD1A 2QD1A 1KK1A 1NVUQ 4ZVKA 3I45A 3I9JA 1BCSB 1U4OA 1PJ2A 4MKXA 1QZUA 4E6EA 3RAEC 4QUHA 1SBQA 1CS0B 2IZ5A 2QJFA 2DFDA 2W2TA 2G9RA 2WHRA 1J56A 3JASB 4WNCA 3S29A 3PDJA 4AS2A 5JROA 3A1WA 5JWRA 4O1MA 2ZM5A 4LXYA 3BXHA 2BV3A 2HREA 1A4UA 1PTJA 4LXXA 4OKSA 4E70A 5TE9A 2ZZKA 3PC8A 1T1SA 1AO0A 3OD5A 3ML1A 1E2GA 1IQRA 4XQGA 2VSNA 2I6UA 4IR7A 3L0OA 2I4LA 4W5JA 5CVEA 1J0BA 1HGXA 3HJUA 3AHCA 4RY0A 3TD2A 1DKPA 1QPGA 3G79A 2DPLA 3QY0A 1JHYA 1QDEA 2HRDA 1HL3A 5JVDB 2BFOA 1KAOA 4NYIR 1P1RA 3T3OA 3BXEA 3EUAA 1V5FA 3HL4A 4QOSA 1YRHA 1NW6A 1A97A 1U5BB 3T5BA 1UMBA 5HF6A 3AR8A 1L4GA 1YZHA 1IZ8A 2ISSD 1FFXA 1J90A 1WA5A 2OLEA 3HYTA 5F12A 4RCZA 2C9CA 4I9NA 3EFOA 3FVRA 3KJFA 2PQ2A 4DTIA 3K5WA 1QONA 4GW3A 4W5HA 4YB8A 4JLVA 1E62A 3EEQA 4MVJE 5AI8A 3DOEA 2YWCA 2OV4A 3SWWA 2CWWA 2DBZA 5DYGA 4CDMA 5HUHA 1SUEA 3WLKX 4IIYA 4DM4A 2YXPX 4KX3A 4U39A 4TT3A 1IVSA 1P33A 2H4YA 4LOLA 4XAQA 1G8HA 4XUGB 1HSZA 3GDGA 3LOUA 1GTG1 1UF9A 2W6IA 3L49A 1QH8A 1SCUB 4NS4A 2D0PB 3UZUA 3ZV6A 2FPUA 1G1AA 4LGYA 5DMHA 4C4YA 4FYIA 4EY6A 1NLYA 1XLWA 1ULUA 4PINA 3B9RA 3EQ9A 4ZO7A 4Q00A 3P4YA 4WOBA 1GAQA 1WU7A 5DLDA 3SU8A 3GJ8A 3QTLA 2VIIA 2ZXFA 3B9QA 4B74A 1DKMA 3OPNA 3N5CA 3D0QA 3DC7A 1DIGA 1OLXB 5KOJB 2BEVB 5KWJA 3OWOA 4UU0A 1T3LA 1GPMA 3OJCA 2RETA 2VHJA 3EWSA 1RMTA 3PWKA 3C3BA 3WLMA 4DC1A 5JPDA 3NANA 2DFVA 2QG6A 3OTWA 2IOFA 4LNUA 4L95C 3TSCA 4GMDA 2JGKA 4FHZA 2R2GA 5KSYA 1FJHA 2QZPA 4PYOA 4AIIA 1VSVA 2PBFA 2B3DA 4D02A 4AO6A 4JEIA 4KPYA 1DBVO 1CUWA 4HLUC 1LFAA 3B6JA 2NVUA 4MMYB 1BWQA 2RHCA 2WSBA 3DAHA 1FC0A 5AMXA 5FB3A 5L6LB 4NX2A 1HF3A 3ND9A 1KSJA 5K03A 5JATA 1MOPA 1EM8A 4UHKA 2OY0A 3AF4A 3EPJA 3A6DA 1RKQA 1KWGA 4KZPA 5I4IA 1SNYA 3CX8A 4C2UA 1W1WA 1W9MA 2QLLA 1M2FA 4UFPA 4GOLD 2PR2A 3MOSA 3TN7A 4G5XA 1CUZA 3NHLA 4K6FA 4OJYA 4JODA 5KOHA 1E2FA 2WE8A 1GCUA 1SPXA 1MRSA 3T9AA 2NV6A 1DEHA 1EHCA 2O0KA 2IYRA 3VR5A 2D7DA 2R66A 3C3PA 2C5AA 2QJOA 2CXPA 3LGAA 4V0QA 5IAEA 3UW1A 2GUGA 1YA6A 1OWMA 2GK6A 1MAUA 2QW0X 1Z2OX 2IW1A 3GCXA 2D1FA 3TLAA 4DA4A 3IESA 4X97A 4UDOA 4QA9A 4EI8A 3KLMX 1KNXA 3SLRA 3ER9A 2WIBA 2WM8A 1JA9A 1OZGA 3N0XA 1WNTA 4XIFA 3S40A 2PHZA 3OQ1A 4MPDA 4AJEA 4DEYA 1JEDA 4F3KA 2I1QA 2ZRIA 3JSXA 4YALA 1M2WA 1SUIA 3STTA 2ZAIA 2MOKA 1I4OA 1R10A 2RIPA 3CBGA 4ER3A 1UKYA 2CKMA 1WG8A 4ZT4A 2EF1A 3W78A 2DJ5A 3SCZA 1NM5A 2UYYA 4ARIA 4F6CA 2J9YB 3SMVA 1WHTA 5K7SA 5C7LO 3OIWA 5I9NA 1CZNA 2C61A 3UT5A 1TW2A 4YLEA 2FDXA 3AVOA 3HXPA 3WSVA 1V1MA 2A78A 2B7LA 2KSQA 4GOXA 3ZZTA 4NATA 3WKCA 1L7QA 1NATA 1XEAA 2PYDA 3U37A 1C9EA 2WD8A 5K3SA 4AKTA 3R5SA 3AY6A 2BTEA 4OIMA 1QS0B 1YR8A 3WGTA 3NBMA 1ZNZA 4NICA 4JB2A 5GADl 2DETA 5TDHA 1X9IA 4XTCS 1NBEA 3HYCA 3EUFA 4N8SA 4PYJA 1QFZA 2WMOB 1AQNA 3WLLA 2HSGA 1TU4A 1QRRA 1TF2A 3K0AB 1MAVA 1VRVA 4E4RA 2R6AA 1QUEA 3EH1A 1DKNA 2P3QA 1YJCA 3RVSA 1L5KA 3SBDA 4EPXA 1XIVA 2KB0A 4EI2A 4Q37A 3EYWA 1NQOA 4Q9AA 1EU1A 2C57A 1H8EA 3Q41A 4PHFA 1T2NA 1P2GA 2QNRA 4GP9A 1ZJ4A 3LUAA 10MHA 1XMVA 2O7RA 3D7LA 4Q4JA 4BNDA 1IPHA 3TRDA 1DG1G 3WMEA 4C3VA 3C45A 5BORA 3TTTA 3DZIA 4KR2A 5AESA 1H2HA 5T7BA 2H1FA 4Y67A 1GCOA 2HA7A 3X1WA 1KI6B 4D8YA 4DNPA 1KXZA 1IBCA 1SRRA 1ZNWA 3PC2A 4S3MA 3KTAA 3MSCA 4EJMA 3W5SA 4REMA 4WCFA 4MICA 5GONB 1SHZA 3W4KA 3VX3A 4DS3A 4ZI7F 4LC9A 1ZD9A 5EMMA 3EDMA 4LOKA 4BDTA 4A82A 1Q15A 4WK0B 5ESRA 3FVWA 5BVGB 5A06A 4OKNA 3TLZA 1Y8ZA 2QYSA 3BK1A 1OH7A 2Y9MB 4N12A 2COKA 1G42A 4ZPJA 4XXHA 3AVQA 4I36A 3N2GA 3U61B 4JFRA 3LQKA 4JQZA 4J7XA 1SR8A 4Y6SA 2CB0A 3JYLA 3ROPA 2BGWA 4FKZA 3CO0S 2GZMA 3CRQA 3RIXA 4DT1A 2Q5QA 3ZYCA 3GNTA 1ZIYA 3Q87B 5DYIA 1KDVA 3MB8A 1RRFA 1SHTX 4INJA 4X20A 5K3FA 1JIXA 3WDMA 1YVRA 3ZK9A 2XB2A 4MUGA 2QAGA 3QUAA 3H83A 2XNJA 5J4HA 1E7RA 2OP0A 2GEUA 3M89A 3TRIA 3ZBTA 1U7XA 4UM7A 4C14A 1Y1QA 2UVPA 3IOMA 4RMNA 2HF2A 2CE2X 1X3LA 4RPJA 3TDMA 5CITA 2E85A 4LEIA 5ADHA 5IBCA 5JNTA 1OH6A 3I23A 2VNAA 2G04A 2ZBEA 3EGOA 3FGZA 5K0LA 3KZXA 2QT9A 2L42A 5BXQC 2G83A 4YAUA 3ETCA 5BV7A 3KUXA 5IJXA 1Y4SA 3N7AA 4ID9A 1O4VA 5ITSA 3ZY6A 5BNIA 3DVAB 2GPJA 4JKYA 5BN1A 4J9UE 1GDTA 3IKMB 1WCV1 3AHJA 1E18A 3JYHA 4EGSA 1AB5A 3VVBA 5E6RA 5BUSA 1H05A 2E1PA 3PNBA 4HEJA 3P2EA 4NENB 1KE2A 3LQFA 1RJ9B 1VE7A 3KQUA 1EFTA 1A2BA 1N57A 3L4JA 1P91A 3B7PA 2D5CA 5LMUB 1CK4A 1GFSA 1G4UR 2FPRA 3IMFA 4NFLA 5D1HA 1Q0UA 2QL6A 4A03A 3LC7O 2J8ZA 4K03A 3KQWA 5EJEA 3CT4A 2JLVA 1CJVC 1WPGA 1GRVA 1QIGA 3QU5A 3GQBA 2OG1A 2QWXA 3COSA 4JLJA 4CI0B 1GA1A 1P8AA 1YZYA 4EITA 1YDEA 1YZKA 3NP9A 1Y63A 3PF9A 4F46A 5LQAA 4M9XA 4CKWB 3W3ZB 3UJ9A 1P4RA 4BLWA 4HDAA 5DB4A 2ZM6B 2IP2A 2WB2A 4FXPA 2R8PA 2A58A 5K8IA 3G59A 1P9WA 2HUPA 3A0UA 4FILA 3ZW9A 1NWHA 3Q1KA 2W9XA 2WNHA 4M1WA 4N18A 3FF1A 2FPSA 4H0CA 5KNCA 3IAUA 3HO1A 2Z58A 1RU3A 3AM3A 2ID8A 3FXAA 4GDMA 4MV3A 4TWAA 4B7CA 4EHFA 2I66A 1TLLA 2H4JA 1QZZA 4LCEA 3OBBA 3F97A 4WD3A 4DWJA 2EW1A 2ZYGA 3PFGA 1GA4A 4G6ZA 4D25A 4RVUA 2HUNA 1CUIA 1UBMS 3SJUA 1FBTA 4B9AA 4XX0B 1Z38A 5HXAA 1QRUA 4MQ4A 2XMGA 4EGFA 2Z57A 1Z5UA 1RQNA 4Q05A 3S8MA 4F4CA 4R1TA 5FTNA 3EC7A 1TO6A 1AHIA 1OWNA 3HY6A 4RMGA 3KRTA 3OAAA 3EF0A 1G2QA 4FYWA 4NULA 4AJNA 5BSMA 2QX8A 4Z7QB 3X3HA 4PC2A 5TARA 4OBWA 2PA3A 1XA0A 3JATA 4YLGA 3ROKA 3V7YA 3CPEA 4UNRA 4OFBA 4Y2XA 5C4GB 3WIEA 3I62A 1Q0ZA 4GPD1 3AVUA 3W2GA 3RC9A 1DDIA 1V1RB 3K94A 3IR5A 5FLKA 3RSCA 4DRYA 2GTHA 2P9HA 4GLOA 1G21E 3L3BA 4B6RA 5KPJA 3F3KA 3DONA 3LWBA 4NAHA 1W4AA 4G97A 1NV9A 5F2NA 4RMHA 4GQAA 1X15A 2FFHA 1YZVA 4B6QA 1O3YA 4X45A 1QIDA 1X1RA 3FF4A 2AJCA 4EK9A 1VRCA 4KN6A 4KJZA 4YJHB 3TE7A 5IK2D 5EINA 5FF9A 1MQAA 1NW8A 1N32B 3EN0A 2R8RA 2VDNB 4WKPA 4CL0A 1SMKA 1DFGA 3C74A 3DT6A 2O0HA 4IMIB 3W05A 4QODA 2YZGA 3DPSA 3P97A 5IFLA 1RKUA 2P9YA 4FCVA 3RFVA 2C3OA 4X66B 1ZL0A 2R1TB 2IBTA 2P11A 2GEJA 4Y8VA 5B7PA 3HBJA 3Q98A 4RM3A 5BNTA 3ZJ5A 2GBCA 3QEMB 3CVVA 1TQHA 1YH3A 4E2WA 3I12A 4IJ6A 3A1UA 1K6IA 1OREA 3NT4A 4B0PA 1MR3F 5JQGF 4RFSA 4XIJA 1KZ7B 5JJBA 2REQB 2ZIWB 2PXXA 1Z0DA 2TMDA 1ISIA 3LPNA 1FE8A 3OT4A 1W2WB 1TM3E 4HNRA 5DIFA 1N2GA 3RYFA 1II8B 4YJGA 5IPFA 1DELA 4Q82A 3QYAA 3EXIA 3GEBA 1F48A 4BO8A 4R2IA 4ZVTA 5ADUS 2Z6QA 1R27A 3V8RA 2J30A 4TZ6A 1RIFA 2EERA 4ILEA 4TXMA 1ZJYA 3RROA 2ANBA 3FD8A 3UAZA 4ECEA 2C4KA 4DPMA 3TS1A 1NKSA 1T25A 2C2BA 2XUKA 1K06A 1L7AA 2TMKA 5AW0A 3BFPA 2XUJA 3JWPA 2B21A 4OXXA 4ZAZA 2F1IA 4UTNA 2DHRA 3KYDB 2H6EA 3ZZNA 2PV7A 3RRJA 1XZBA 1A7AA 1XWWA 2KLBA 1K9VF 3QX7A 4XQ0A 2JLXA 5AJWA 4L0QA 4EDFA 3J81k 1B42A 4BZXA 4JOQA 4ZI2A 5C35A 2O3JA 5ANRB 4I1UA 4RSGA 4RY2A 4JKOA 4RPGA 3EXAA 4IRUB 5CTJA 5DV9A 4EKIA 5C8XA 1QG0A 1D6JA 2VQFB 1T2UA 2VK1A 1EK1A 5JNRA 3P20A 3D43A 3E3NA 3DGEC 3IVMA 5MGBA 3ESDA 3CUVA 1I13A 4G5QA 3L7CA 1E4YA 3QEJA 2BRUC 4ITVA 1RKBA 1G20E 2J87A 2QUAA 1ZK1A 5CM9C 1BH6A 1IVNA 4YP5A 1QOQB 4EMBA 3GPIA 4YQZA 2I87A 5FQOA 4MKHA 1CJSA 2H63A 2QUHA 3CWQA 3A6HA 2P0EA 2AD1A 2Z2JA 3Q7IA 4PC7A 3BDVA 4JR0A 2E4YA 4CQNA 4KHPB 4C7VA 1LDNA 2R6HA 4QGFA 4U9UA 2D1YA 2OZLB 5JJLA 3CUWA 1O0SA 2FFJA 2IS2A 1GQSA 2VZEA 3REQB 4FFBA 5L4LA 3UIEA 1JSRA 1X9GA 2KE5A 3KAJA 1GY8A 4QICA 2B35A 4RVFA 2WT4A 4W82A 2O7QA 5C5DA 3I1FA 4RXMA 3ZWWA 5KNBD 5TQJA 2ZFUA 4RFVA 3ICWA 4ZTBA 4YP6A 4ZKEA 4HZUB 4KACA 3A2KA 3L8EA 5C1PA 5KYNA 3LKBA 3F5MA 3K09A 2BLNA 2FEWB 4PCAA 4WLFA 3WGYA 2WVGA 4TVSA 5HE8A 1G7TA 4GI3A 1JHOA 3I2YX 4J0EA 2VZ0A 2C8LA 2QV0A 3ONVA 2AG1A 2GK7A 4L2IA 2QNIA 3TLGA 1RZRA 1EGAA 1CPYA 2F3UA 1JJFA 4G07A 4WNYA 3PJFA 5EMJA 1NBWB 5E4JA 3E7DA 3KQLA 1SXJA 1XZPA 3TAUA 3H2HA 4ENQA 4CCYA 2H4XA 3SGLA 5ICSA 4RAQA 2FJ0A 1J2JA 4G0YA 3DOJA 1JYEA 3JAWB 4KRYA 4D98A 4EO9A 1UMDA 1UAYA 4EFNA 3LPDA 1KFEB 4KU4A 1JVBA 4REOA 3RIHA 3TW8A 4D99A 1E4OA 1NAIA 1DOHA 1L7PA 1ZMOA 1UPBA 2FUEA 2Q4OA 3GRUA 3DMTA 2FN4A 3LVQE 4P53A 1C0IA 1NG9A 2ERXA 2BGRA 5FI5A 1TE2A 5HDBB 2PS1A 4CIDA 4CNBA 5JDIC 4CL8A 4LJKA 3EAQA 3WLPA 4LYYA 4BU0A 2RG7A 3ANTA 3RUFA 3C3AA 1CRWG 1OTYA 1ZD5A 1W34A 4H16A 4B3JA 5JMPA 4F9EA 4Q66C 4OQZA 4GYKA 1SQSA 2E4WA 5DHSA 4DMKA 4ZREA 4CXMA 4ZEWA 3P9SA 2RHGB 1E3QA 4C0HA 2YNMD 3SQMA 2B8JA 1GO2A 5DTQA 1M83A 3SBEA 3WKEA 4YRZA 1Q57A 3D6NB 3DQQA 4R7TA 3K5PA 3LQRA 4Q3DA 4RK0A 5GAJA 4F4DA 4B8ZA 4CW7A 2H08A 1C8VB 1RJGA 4HF7A 4PX5A 1DAFA 4EDHA 4D9BA 4EVQA 4DR2B 4JX8A 1O8CA 4WADA 4ZT5A 1C8LA 4Z4CA 5FBRB 4L4SA 3O74A 3HU2A 3PPVA 2X7XA 2B1IA 3GO4A 4R7ZA 3HL6A 2AX3A 2P9QA 2UZ0A 2PX4A 3AONB 3GWGA 1J09A 3PNVA 4GH5A 4M1EA 5CH8A 4KI7A 3LPAA 5D2CA 4C01A 3BZUA 4LQCA 1MZVA 3TSWA 4Q4AB 4BO0A 5M34A 1EJ0A 3IE1A 2F3RA 1SQ0A 3SZGA 3RHSA 3DVLA 3A3KA 3RYHA 3FGPA 1ZM4A 4KFCA 4ARAA 5ES4B 2FGKA 2QN1A 4ZU1X 3D3WA 1CIJA 2IEGA 3JR3A 2OYSA 5ECYA 5HRAA 4UTXA 2HIMA 1YR2A 2EGUA 1O7JA 4BNJA 4IIJA 3QIAA 4DANA 2IGTA 1Q2XA 3PVZA 1N0UA 3BMXA 2II6A 1XNGA 1Z17A 4OIFA 4WLVA 3WWYA 4WBSA 5C8YF 3PG5A 1FVFA 1OU4A 1YD7A 3KP1A 2VDPB 3LBHA 3DD5A 3EODA 2ZSBA 2AKYA 3WNDA 5CDYA 1NVKA 3C5CA 3RO7A 2VRCD 4IF4A 3OPMA 1ISJA 3EGDB 1VL5A 1IXRC 3GJRA 2ZYUX 5B7QA 4QASA 1EP3B 3T9FA 1JMVA 2ZWAA 4CTNA 2R4UA 2NG1A 3KU4A 4EEXA 5KSWB 4B45A 1UXHA 4RTKA 5T3YA 2GWHA 2YC4C 2PIAA 5T5QA 3W5DA 2CLFB 5FWYA 3BGVA 3BXPA 3G0GA 3WHIA 4L8LA 1WUIS 1GGMA 5AVOA 3AM1A 4RC9A 1A9SA 4IKPA 3F90A 3O8OA 3DL7A 4BP8A 3PNQA 4DWVA 1CVLA 5HKBA 1ZAYA 2YV2A 1Z47A 3RUIA 2I2DA 5HKLA 3DJFA 3MPUA 4CM4B 1J9GA 4EW3A 4ZGGA 4YJ2A 1KPHA 4L3OA 1ZGGA 3TF5A 1KMHA 3GEIA 3UCXA 3UJDA 2A7XA 4Y9TA 4ECAA 3FNRA 4DLBA 3WYGA 3AR6A 5FUBA 1XZMA 2HDWA 1JMKC 3IIKA 3CH6A 3SIRA 3DWIA 4QPZA 1F51E 4E11A 1AGXA 5CVDA 1SVNA 2PX3A 1VDMA 4ZT7A 4DJJA 2I6SA 4ZI5A 3F73A 5JEEA 1W47A 3BN3A 3I73A 5CM8B 1KQPA 2CYBA 4ND7A 5BV8A 4DG5A 2WJJA 3IKLA 3OPQA 2I7TA 4LZOA 5H70A 1VHQA 2GAIA 3JXEA 3NTRA 4WH0A 4JI6B 1SD2A 3GYBA 4RJIA 4M9QA 4EARA 2JHPA 2IEDA 3ND8A 5IVPA 2BHNA 2E48A 1SVUA 5CFZA 1SIBE 3NHRA 3SYTA 4JSTA 4M1SA 4EBBA 1U0NA 1ENZA 2J67A 4Z6KA 2B37A 3BH6A 1AHHA 1OD6A 4PYNA 1SD1A 1Z4NA 1U9IA 1YBMA 1YCHA 4NDAA 5I9SA 3OSZA 3PQDA 2RC5A 4YRQA 3U39A 3R7LA 4BQOA 3CXRA 5JAPA 1KIFA 1T35A 1FF9A 3NHKA 3T6KA 3OE1A 4QYIB 1CY6A 5C5IA 2O5EA 4TV8F 1X1BA 4WZ6A 3ROGA 4S05A 2GCNA 3WGGA 5BV2P 4W5RA 2O5RA 4Q9JA 1IZ0A 4Q21A 4GIBA 4UHFA 4FFSA 1V43A 3KEGA 2NGRA 2QI9F 1QU2A 2W7TA 1JR3E 4D9KA 5CA1B 4K6MA 1JDUA 1IY9A 1HZZC 2O2ZA 3PDUA 4G0VA 2REOA 4C0XA 4KE8A 4UDNA 4PCVA 5BR1A 4ZHQB 2ST1A 3HU3A 5FHQA 2DQ4A 2ID9A 3HN6A 1G19A 4XUEA 1EBBA 1M1NA 2I2AA 2JAXA 2VSYA 3Q15C 5AVXA 1Y5NA 2I6GA 3KB6A 4UEJA 2IUYA 5LUAA 3QE2A 4KITB 1X1DA 3D7NA 3TZCA 3K92A 4EB8A 4OG2A 1Q0HA 4BQQA 4B4KA 1L4UA 1NXQA 1MMFB 1FU8A 4G36A 3SDBA 2YYSA 4DCGA 2WPDD 1BQEA 2QL7A 3GJ3A 2JLSA 3ZDXB 3PHHA 4BUCA 1X39A 4LSZA 3UUWA 3TEFA 4DQDA 4Z4FA 4MUAA 1HE1C 3G5LA 4NBUA 2H2AA 1F2UB 1Z12A 3I76A 1DOZA 2XUIA 1D4ZA 1ZOPA 2W6ZA 3B5EA 3M6FA 3PR1A 1DADA 3FBGA 2GPBA 4YCCA 1V11A 3BFVA 3G5UA 5DCWA 4FB5A 2CMDA 2EDAA 1GZUA 2X4DA 1IXSB 4P4UA 3ZHVA 3JYOA 3MWEA 5L3ZA 4HVCA 2AI3A 1LV8A 4ZZIA 1KMQA 3B2NA 1JZTA 1WXEA 2J4FA 5JVDF 1DJMA 5FA8A 5FIUA 1K6JA 1QPBA 3AUAA 2GVDC 4FX2A 1QBKC 3CO5A 3QOFA 3WGHA 2R68A 8ADHA 4DR1B 4YIKA 1O94A 5DNYB 1QDUA 3NBYC 2QMOA 5DT9A 3CIOA 1ZRMA 3FNEA 1HFWA 1FXWA 3FR7A 1L1FA 2Z43A 1S02A 4YJ3B 1NVWQ 4EY8A 2XQKA 4X1KB 5HM6A 1FDWA 3DV0A 3OQJA 2J48A 5DYTA 2JAHA 3V2GA 4DLRA 1MCZA 3TZBA 3OY2A 4PNZA 3ZGZA 3L6BA 1KO5A 1I33A 3KXKA 1BW9B 3DDUA 4I2VA 4RGVA 2VPTA 4U2BA 4XYBA 3W79A 1OXMA 4EJ2A 4B7XA 5IM4A 4YRIA 2HAEA 1P3DA 4RF4A 5FPQA 3TNLA 1WETA 2X13A 1Y1RA 2JFHA 4MVJD 1E9RA 3BZWA 4X84A 3SQDA 3GRAA 4A7PA 3PGA1 3QVLA 2QU7A 4TZKA 3RUHA 1E8NA 4B3GA 1YBHA 1C9NA 3L04A 2BFPA 3KQVA 5DI3B 4AJKA 5A9SA 4HAVA 2CLHB 4P4SB 1ATZA 5BT9A 2O8FB 2AFVA 1SPBS 1UDCA 2OCAA 2XH8A 3ABZA 5TEWA 3V4LA 3WBJA 4WOJA 3ZE6A 5BY2A 2D2VA 4LRYA 1UINA 3BREA 2P6OA 4TZ0A 4L76A 2HA0A 4DIOA 4BE9A 2BTOA 4AYWA 2AUMA 3WZMA 4QWWA 5BNZA 2W4IA 4QU0A 1PVOA 2QE6A 1LBHA 2YUIA 2G0AA 3JY6A 5BSHA 1L4LA 2CZQA 2IYNA 4J1TC 5J9FA 2XW6A 1JL3A 1A9XB 3DDCA 4IS3A 1MW9X 2CHEA 4OJMX 1FPQA 2A52A 2G80A 2OLKA 1U2GC 4KBFA 2B34A 2Q2NA 1G2OA 4R9SA 4EENA 3U1BA 2UYOA 4WJZA 1XEXB 4K9KA 4PYRA 1V3TA 4KO1S 9LDTA 3DP9A 4YY3B 1C0EA 1RAIA 2NOAA 1XCBA 3GJ0A 5TNXA 4TTPA 2DULA 2QRNA 4F45A 3AUUA 3DKKA 4FXOA 4PTZA 4JI5B 3SE7A 2FPIB 3GU3A 1F8YA 2PX0A 5B3JA 1N8KA 5JAQA 3S2ZA 2OV3A 4LHVA 5YASA 2I80A 1VSBA 1S9HA 3WNCA 2R8YA 1Q84A 4HQ6A 5EEGA 1KSFX 1ADYA 2G88A 2XADA 4NZPA 5FUXA 1I9GA 2AOUA 2A9KA 3ONFA 5FOUA 2EQAA 3ZE2B 4ZYLA 4RK1A 1IULA 1I3MA 2PLRA 3WRXC 3MMXA 5AK5A 2RBEA 4C43A 2EW2A 4OVKA 2X0EA 2EYUA 1P77A 1AS3A 2JC3A 1WXIA 2M1ZA 4LHWA 4DNXA 3ROTA 2FX3A 1AK2A 2I71A 3FPSA 4FDAA 3KZVA 5DZSA 3CLVA 1MOZA 1QMGA 1NQWA 1R9MA 3AGQA 1D2RA 3AWDA 3HWWA 3QHAA 4TLMB 3WLQA 1G6KA 1WB4A 1US8B 3FFAA 3G2PA 2CLSA 1TF5A 1XVTA 2O2IA 3O75A 4QXMA 2GF0A 4X85A 4ZOCA 3BGDA 4LCBA 5DP1A 5JBIA 5L3QB 1KOJA 2OFFA 4RF5A 2Q6VA 5A0FA 4RZ2A 4P4NA 4QYTA 3HJCA 3OFJA 1RLTA 4FBGA 4QUAA 1X94A 5LUBA 3DP7A 1V5GA 1C3JA 2QD2A 1U7DA 3W9SA 2EQBA 4CCWA 4IDHA 2UDPA 4JYCA 2WF7A 4NPCA 3HFSA 1G2IA 4LPSA 3SJZA 2AMFA 5FNVB 1VJRA 3TM4A 1N2HA 1NVAA 5DISB 5GWXA 1YQUA 3K9HA 1XJQA 4JA0A 3KQYA 1XVAA 3G8CA 3QXGA 1EXDA 2BJWA 4XIYA 2ZJZA 3WADA 2GCPA 3AEXA 2GJAA 4L0DA 3FJ1A 3U3ZA 3KEQA 1EYZA 5T4EA 2Q0QA 4IIUA 4AKHA 4J4BA 5T8KC 5IJ0A 1SU4A 5EYPA 1A77A 1XAJA 4RJTA 2C99A 1ZONA 3IPLA 1T1EA 2WNIA 4R1QA 4H1VA 3GLHE 1D6SA 1JKJA 4BMPB 5GM2A 1OJLA 1UBHS 2VAPA 1VB3A 5CLFA 2HNBA 3F6EX 1Y9EA 1QFYA 1CUEA 1LPMA 2GEKA 1SC9A 3PHJA 4LJ7A 4PX9A 4E22A 5I4BA 4MUIA 2BVNA 2W2VA 3LBIA 4HWRA 1NZJA 3PQEA 1NU6A 4HWOA 4YP9A 1TK2A 3CR3C 4RKQA 3CF4A 5E4TA 2HTFA 4JVSB 3L7BA 4WOKA 621PA 5MN4A 1KZHA 4JWTA 1J5EB 2O8EA 4HX2A 1OBVA 1WQ4A 4GGMX 4ZYUA 4EPRA 2QZSA 5JYDA 2FF7A 5DHQA 5EJ6A 1AKMA 2RDMA 3K0EA 4HWSA 3PT5A 3EEYA 5JBQA 2A56A 1VFNA 4RVGA 4ETIA 1JPVA 3L6CA 1RD4A 2Y68A 3AB8A 4G2NA 5GONF 2H54A 5BR7A 3VJKA 2NYUA 2R25B 3X1XA 1OAKA 4LYHA 2BDEA 3FOWA 5AKEA 2ACVA 1JU4A 2FK7A 3Q0TA 3WYDA 3SQNA 4CQMA 5D6OA 1USKA 3UB2A 5JWHA 2X4GA 4RZ3A 3NEJA 4H7EA 1IN5A 3DPIA 1ZEJA 2XTJA 3LT0A 3L8YA 2G3YA 4AG5A 4DR3B 4JJGA 1ZK2A 1J8YF 1QH1A 2EC5A 3CH4B 5BRNA 2WTXA 2ACKA 1FRQA 3W1WA 4PO9A 4PXSA 5KWEA 2A7QA 5D00A 1FX0B 5K3AA 5JCJD 5KC9A 1XVUA 1TQDA 3VNRA 3E0QA 1DUSA 1STOA 3I04M 5HQJA 1KJQA 4MVWA 4XFKA 5CDFE 1RLOA 1PDVA 4H0NA 4HNTA 1J2RA 3T9EA 1VGQA 2RE8A 1F8GA 2PM8A 3CHYA 2DJIA 4R3WA 1GLNA 4YP0A 4QM7A 1A5BB 3RDPA 2MR6A 1GTRA 3CR8A 3P9IA 1Y3BE 2BGGA 1KEZA 2RHWA 4OCZA 3BJRA 3LGXA 4M8IA 1AXRA 4TMZA 3UK7A 5B64A 5KWIA 3WKDA 1MJGM 1W4ZA 4D3FA 2XOKD 4H1UA 4RIHA 4CF4A 4HRVA 1LCIA 1VXOA 4UBJA 4MQEA 4B17A 221PA 1NNUA 2AUNA 1GKKA 3ASYA 5EPUA 5HEKA 1PJTA 2QSYA 4FD3A 4RK4A 4I1RA 4CM8A 2O8BB 1N4DA 1WW2A 2IP4A 2OBXA 2ZYHA 1ZINA 4CEJA 3I5UA 4OATA 5TB5A 1B6GA 4I8DA 2QIOA 5ITWA 3N2EA 4OOEA 1PEAA 4YAWA 3OFKA 1KIAA 5KDOA 4Z9AA 2CL0X 1RKXA 1OA1A 1KAHA 1PSZA 2QY9A 4Q16A 3VC2A 4AN1A 1MIOB 4J94A 5DNWA 3W9BA 1R16A 4PR3A 1C7ZA 3AIIA 4BNFA 3GXOA 1U2QA 2I3DA 1P3Y1 4M8KA 4TYNA 3JQAD 2GBLC 2HBRA 4O4JF 2A1IA 3K0FA 1QR6A 1B1CA 4FPXA 3T3DA 2ZYIA 4EUHA 3LIIA 4LI3X 4ZTUB 1VOTA 1BQ4A 1EKXA 1LF0A 2JLQA 2ZRCA 5A04A 4N1AA 4L8GA 4S1TA 2DKNA 3AK4A 4GS5A 2HCFA 5HHTA 4IKEA 3RS5A 3AFOA 4MZDA 4BQIA 3PX2A 3I5AA 3HDVA 5CVUA 1F06A 3NJRA 4O29A 2ATEA 4XUDA 1EG2A 4MGEA 5GIPE 5AM5A 5FWDA 3S1AB 2IPAB 2M6RA 4C4PA 1DMRA 1XEWX 3DFFA 5KX5B 4QU9A 4PX2A 4YUXA 5CA0B 3IERA 1IUOA 3RVNA 1IG0A 2QVXX 2VCHA 3LNCA 5G4KB 4AY2A 4UMFA 1QMPA 3JWJA 3OX1A 2DFLA 4C7JA 2IH4A 3LDAA 3NGXA 1KZ9A 2PJUA 1ZI9A 3IUJA 1R9NA 4AJOA 1PG2A 3BRSA 5JJKA 3OF5A 3B8EA 4V02A 5HKKA 4Z7OB 3FVVA 1JHVA 1LQUA 1O6BA 1E9SA 1WD7A 2NNWB 3LUCA 4LXUA 4MR7B 1W75A 1GQYA 1Z28A 2EXXA 1ZZEA 2NXNA 1GNLA 1U7OA 1W29A 5HGJA 3Q3HA 1MO4A 3EGIA 2JGAA 3EZNA 4IX9A 4PIPA 5ALXA 4D3XA 1M34B 1RWKA 2C9DA 1JEOA 2HWYA 5FBZA 4YRMA 5KTPA 5BWCA 2ADFA 4Z86A 4HGQA 4LJ6A 3LCJA 1TCUA 5AQ1A 3A3PA 4KH1A 1LPPA 3MAAC 4LYFA 4X5OA 3GGSA 2QRVA 2H5LA 3GEGA 1PEKE 1RM5A 4HAZA 4YPOA 2FSVC 1U0JA 1SQ5A 4GHWA 5LYJA 1IN1A 4D3ZA 2WAMA 1PK7A 7GPBA 5C4MA 4JV5B 4U2DA 1U3FA 4UPEA 1W8IA 4KX5A 3ZXSA 1RDFA 1CCWA 2PDAA 4URUR 2ZT7A 3AOEA 4LSMA 1JQAA 4D82A 3DEFA 5F7JA 2BEWA 2WT9A 1QFMA 1YIOA 3IAHA 1UXJA 2R00C 4JYPA 2FSUA 2QYTA 3KOZA 5ER6A 4DR7B 2QDKA 2HL6A 2X9VA 3OPYB 3RF7A 4J49A 5B58C 2Z6VA 4H0FA 4KB5A 2UUCB 2PAFA 1Y6RA 2P2SA 3KQSA 4Z9FA 3P0JA 3V7FA 1PWYE 4ALNA 3PD0A 3EXG1 4Z54A 1GYRA 1JIJA 1V41E 2DQKA 4KP7A 4OYHA 1XDSA 3ZVMA 2G40A 1M3SA 2XPCA 4HLQB 4GPBA 4RQTA 3VZRA 5LP1A 1HRKA 3IBFA 1BCSA 3OUUA 2G5PA 1L9KA 1HI9A 3EA4A 2DR0A 3F8TA 4IFBA 4KR3A 4AS3A 3P2KA 2HA3A 1Y8RB 1YTLA 3BGOS 3F67A 3GLSA 2NSDA 2ZSFA 1R4ZA 3NB0A 1E3IA 1HE5A 1PHPA 1W5EA 1D9XA 1EA7A 3FWZA 3KUUA 4N7JA 4YAGA 2GETA 4MI9A 5EI5A 5JAUA 1DAMA 2BT4A 2ZIXA 5BSEA 5HP4A 1ZGHA 2J3HA 1Z6GA 1TC2A 3LUFA 5SY9A 1N3IA 3F9IA 1P45A 4NDZA 4PFSA 1MABB 1QHYA 4QVKA 3IPYA 4WLEA 3D8UA 2AEJA 4ZCIA 3I72A 4JK3A 1XNHA 3G0IA 3VR3D 2A0UA 4EFMA 4NCNA 3M2PA 4JT8A 1NVDA 4QM6A 4LJYA 4HAOA 3E1GA 5E2AA 3TK1A 2FPGA 2IEBA 1L4NA 2ZSAA 4R4JA 1WLSA 2HMAA 1UJMA 1U5BA 2XZDA 4O5AA 1KZYC 5DNVA 5FOWA 3FI9A 3DLPX 5EXPA 5I7RA 4WNAB 3HXLA 2BBSA 3OTOB 1EFDN 3PC3A 4TUYA 4AYTA 2H5JA 4N6NA 1KI2A 2Y1DA 2XUPA 3KLBA 3QHQA 5TQ2A 4BO3A 4C08A 1HT2E 2DLNA 2Y0EA 3ENWA 4MB2A 3IUQA 4DMFA 1NQ5A 1BJTA 1GZ4A 1XMPA 3IVCA 4KQEA 2Z4SA 4LGCA 2NYVA 4K40A 5HFNA 3MD9A 4L5CA 1PN3A 1T9GR 5C1DA 4G5HA 4RDCA 5EJ7A 1SGWA 1Y1LA 2ZWOA 4MEJA 3UWDA 3VDRA 2YDXA 4E94A 1N2SA 5ALZA 4C7OA 3KHKA 4L85A 2B94A 4E33A 4PZ9A 1Z35A 4MWSA 2IYVA 4MPPA 3VPXA 1UDWA 121PA 3T4UA 2QLBA 4YRKA 4M2LA 3VR2A 1M5TA 2GPNA 3JQFA 4PY2A 2Q1YA 2Z1DA 1M6WA 2ECOA 3AJRA 3DCJA 4DQLA 3HWRA 3K9GA 4NU8X 2H06A 1OLXA 5KOJA 2BEVA 1KU6A 1W6RA 4OH7A 3N74A 2Y1XA 4YMLA 3E22A 1EVLA 1W5TA 3IR6A 5AIAA 4G0XA 1PCXA 1TJYA 3OEWA 1C8BA 4CG3A 2ZT8A 4NRDA 5F2EA 2K5UA 5IVIA 3WQQA 1HORA 5K9ZA 1BOOA 1BVUA 1HFEL 2X58A 3AU9A 1AV7A 1B0ZA 4FDTA 1SZJG 1V25A 4MQMA 3AC0A 4OBEA 1GAXA 4HMOA 3LTNC 1PJBA 3AWIA 3O4VA 1JEYA 3MOIA 1ZG3A 1V8DA 1J21A 1XX6A 1Z5OA 5HUJA 1V96A 4PN3A 3JRNA 4L51A 3JAKA 5E2IA 1KQOA 4BCCA 3WGNA 4Q0MA 6CHYA 1DTWB 3QW4B 1GG8A 4P54A 3OA0A 1I7PA 1NXPA 2Q28A 2XCSB 2I55A 1Z5PA 3FYHA 3JWEA 1P7CA 2GJ8A 3EBOA 4FW9A 4WXRA 5DI9A 4FNMA 1X1CA 4INPA 3UOGA 3TXYA 3VYWA 1FB5A 4AP6A 2VJKA 4WX2B 4TKUB 2PE5A 1I6KA 2BGNA 3N6RA 3P27A 4IOKA 3IC5A 1VLZA 4LBYA 1E6CA 1BN6A 3PF8A 1EAMA 3H2KA 1ZOSA 5EUMA 1VYTA 1KVQA 2F8MA 1C9JA 4BEBA 4EUNA 2YH2A 4GUAA 2CYCA 3CX6A 4Q7LA 1XTJA 4UVHA 3QEOA 3C41J 4Q3LA 5TVGA 5CXUA 2AOVA 4O8ZA 1RBMA 1W44A 3HCDA 3W90A 4EHJA 2YZMA 4YMUA 5F33A 4BASA 1SCNE 2QX4A 2ZROA 1BROA 2Y67A 3PUZA 3WLFA 1OXSC 3HR4A 1X7XB 1D2AA 3NIWA 8ABPA 2ZLBA 2ZKIA 2EG5A 4A2WA 1MB9A 1JJBA 2NXJA 1LLFA 1OROA 4PNHA 3EJ6A 4DSTA 4ZJZA 3DUFB 5AW3A 3NC4A 2QN8A 3T7JA 2ZR7A 1QGZA 3R7AA 3JD2A 3EVEA 3FTCA 4OU5A 2IZZA 2DWOA 2OO5C 1TFUA 1ML4A 2F1KA 3ACDA 1BC5A 3MLEA 3MERA 3O4GA 4WACA 1QF7A 2JD2A 3KAPA 2UU9B 4NEGA 2C4HA 1K8XB 3UH1A 4N0DA 1D5CA 2O48X 4DCUA 4V1CB 5EXCA 3L7AA 1CB7A 3LHKA 3F3SA 3CIFA 3N7UA 1ZD1A 3PEUA 4FJ2A 1YR9A 2CUZA 3IHKA 3L8MA 3EXFA 2HD4A 4QYXA 3T52A 3V55A 2D54A 2ZAOA 3O26A 1CUCA 2Q1TA 2XBLA 1WKCA 3RTCA 1U98A 3A26A 3HCNA 3HKBB 4AN4A 1MHTA 4HDRB 1ZISA 4DCSA 3DZCA 1GUFA 1MXHA 4N5LA 4D56A 2WKRA 5DTEA 1PJ3A 1V7ZA 2R84A 5AVTA 1IEWA 4IICA 1NRIA 3IMGA 1AD2A 1N5IA 1SVMA 2HIGA 3N2YA 3OCYA 1FLVA 2HWXA 2B4TO 4JOCA 1LC3A 4X24A 2FEMA 3AV3A 1F8FA 3I2KA 5EIWA 2FMFA 2OXIA 2F43B 3M5WA 4ETWA 2QTVA 3ZTWA 4DADA 5C2JB 1IAQA 3OQPA 1G7RA 4NOMA 3SX0A 2HXSA 2PH7A 4FIDA 1E9BA 1RJFA 1SH7A 4R8RA 2Y6UA 2BN4A 1A3CA 1TZ2A 2DT8A 3LMKA 4LECA 4AZ3B 1OAOC 2HNKA 1LPOA 4L1KA 3M6IA 2FG7C 4CV1A 4DB4A 3A1VA 4ZMBA 3O9MA 3A32A 4A16A 3E3LA 1GGHA 4KR7A 3THXB 1KI6A 3OZCA 4L9WA 3QPCA 4ZZ3A 5CLQA 2PU7A 3K5HA 1W52X 2A0FA 2XE4A 3LGSA 5UKDA 4CMCA 3QITA 4D3DA 1FJXA 1J1UA 3EARA 4OQMA 4HPXB 3T95A 1ZW6A 5DN6D 1M1YB 1RI4A 5BURA 4CIAA 5I45A 2NU7A 3ANLA 1T4GA 2BW0A 2VBCA 4QBIA 2P5YA 4JIMA 3MBKA 5DXFA 1R00A 2AN1A 3NP7A 1K7YA 3E03A 2GAJA 5KVQA 4JY7A 5HQ3A 1T8WA 3NAQA 1E79D 3MQ2A 1U0LA 3AY7A 4JBXA 1F38A 4LJAA 4MDHA 1Q22A 2GYVA 4YAOA 4YLYA 1ZN9A 5HK9A 3U0BA 5JY1A 5D01A 3J7AC 1K27A 1PS0A 4UNNA 3H1GA 4UQPA 1I36A 4DCTA 3M81A 9GPBA 1QYVA 5TXGA 3MGBA 4OJQA 3RG8A 4Z1MD 3K1ZA 4TTAA 4AKGA 1LI4A 3Q5EA 2GVNA 2B7CA 2P2LA 5CNIA 5J2UF 2VR1A 4RPKA 4UZSA 2VPYA 4P7BA 2VTDA 4FGKA 1R8QA 4TSFD 5DEOA 1IUKA 1HQKA 3L84A 4KQKA 3TQOA 4ARBA 2IPNA 1P29A 4V0LA 4DN6A 2QLFA 5BMVB 1S4QA 3LFUA 1ES9A 2C97A 1U2TA 4MW6A 1GOTA 1QK4A 4I7EA 3H5AA 2D7JA 3K3PA 1QGED 4WBXC 2OBLA 2XOEA 2W22A 2F2TA 4WFQA 3BM5A 1X7WA 2NAFA 4GPEA 1NP3A 1G9TA 1TMGE 1YGPA 4QXPA 3PYXA 1T9ZA 3I6YA 1B76A 2X15A 3PDWA 4KLRA 4WBNB 4KYTA 5D3MB 4OXRA 2HMVA 4F4JA 1H1TA 2W6MA 1XE3A 5I8WA 5AHWA 3IP5A 4GLFA 1HDXA 1ECGA 1M2GA 1Y5LA 3KKKA 4JGBA 4QRHA 4UHJA 3WVNA 4CJXA 5THQA 4R71A 1IWOA 2Q9AA 4JXJA 4YMTA 4F7DA 2OGFA 1GZDA 2Q29A 1RBZA 4EG7A 1XDDA 2R2AA 5HF8A 1FYFA 1SQ6A 4F04A 1V6SA 3ESAA 1N6HA 2NUPB 1VSTA 3LXUX 4M7RA 13PKA 2GZ1A 1N33B 4YUAA 2CJPA 3RC7A 1I0IA 2PL3A 1G3QA 2OBFA 3QLEA 2NXEA 4NY1A 2R85A 2TSYB 2WABA 4PC6A 3F98A 4ANFA 4E15A 3L02A 4F85A 4U7PB 3AUSA 3IQHX 2HSEA 4MP6A 4Y7CA 1LDYA 3LSYA 3MGAA 1XQ6A 5IHPA 1Z56C 1Z7BA 3EGXA 1XMJA 2WMNB 3O8LA 3BVPA 3MTQA 4AWXA 3GG9A 1GG9A 2IWRA 1OYWA 3AHDA 5BSVA 1CB0A 3D1JA 3WL3A 2GFQA 3BGSA 2WE7A 2JFOA 1DKRA 3LZ6A 3NEPX 3LLVA 4UBMA 2VEDA 3EWAA 4JUBA 1JR3D 3K1YA 3LWNA 4K9DA 3DC2A 1CLEA 1VTKA 2EBFX 4X3CA 5T6BA 2GD1O 4C0QC 3QYFA 3GDHA 1XP8A 4M9ZA 3U4DA 3M4YA 4BMSA 1TVKB 1TKCA 2LVBA 5K20A 3BHMA 3N6VA 2DM6A 1L7EA 4OGWA 2QTLA 3TSAA 1ZJJA 4X8MA 1TMOA 4QGSA 4H3HB 2F6RA 2JCBA 4JYZA 1YFJA 3JU3A 1FFDA 2ATXA 3C1UA 4UBIA 1A0OA 3UHOA 2IH2A 3K2QA 3ORFA 4HEA1 3KSRA 1NJ5A 4RE6A 3T8YA 3K20A 1YUBA 1A9RA 1J6UA 1GZ6A 4FSXA 4W63A 4X7BA 5GOZA 3WQBA 4AM8A 8AT1A 3HSYA 3WP0A 5ITZB 4LF9B 3OOHA 2ZE5A 3O90A 3W5JA 4E03A 2PWBA 5KKCA 1KH3A 4PYLA 2GN8A 1V47A 2QTCA 3O0DA 3U3RA 5HCIA 2OGTA 1T1JA 4V2UA 1CSEE 1CTQA 4X0EA 3TQCA 4KLNA 4JUFA 4F6LA 5F7XA 3NDBB 2V96A 4IAOA 3HL0A 2G70A 3DYVA 3VPSA 2OQIA 1PR6A 2BKVA 4P5DA 1QE5A 1E5DA 2FRDC 1ESMA 3GCGA 3LCCA 1N7GA 4I50A 4KQ2A 3NHMA 4KVGA 4O08A 4B6EA 5AO9A 4ZCRA 2DFTA 4HNSA 2VPWA 1K6EA 1KMMA 2XXBA 3GP3A 1K92A 3ZU2A 5LA6B 3UQYS 3AF3A 1E3EA 2PGLA 3ZGLA 1EVIA 1TO1E 1Y42X 2JFVA 4TLEA 1WZCA 1T2DA 4U9IS 3RVBA 4BY9E 1CJKC 4YJHA 2O50A 1CLUA 3OJFA 1KYYA 2HF7A 3HZOA 3R3UA 1U0EA 1XFDA 1VIYA 2DCMA 3WWDA 2Y1OA 3RYTC 2XMCA 4COKA 1YRWA 4XPIB 3FBWA 4DSAA 5CP8A 3S3TA 3F74A 2CEKA 4DA0A 3HABA 3A6ZA 1R6AA 2VOEA 2C20A 4ENSA 3QEKA 2VJMB 4Y9UA 2POCA 3KPYA 5AOVA 3R6TA 1L5RA 2ZP1A 3I6MA 3DZFA 2HZ7A 2Q7OE 3UWKA 2C7RA 3PI6A 1XNQB 2BHLA 3N2IA 2ABWA 3NWJA 4X63A 3T12A 3OZTA 4BP1A 5B4TA 1J0CA 1QHEA 5FHRA 4UCFA 4IJQA 5KTNA 3AEKA 3FETA 1XU9A 4GPTA 3ENKA 4OLFA 1XTVA 1ODKA 1I4TD 1JX6A 2EFDB 5FEMA 3QIVA 3ZTYA 4BLPA 3Q8KA 1RYZA 2C9MA 2XX3A 1W8DA 1VZ3A 4XR9A 1RCFA 3PFFA 4ODIA 2PT9A 4P1ZA 2BGLA 5FFFA 2OHHA 4C89A 2HU2A 2ZRHA 4N0PA 1IRIA 2Z98A 2VAWA 3LRTA 1W19A 1XALA 2AZMA 4KAXA 1I4EB 2ES4A 1CJBA 5E38A 2UYHA 2VH5R 1M33A 3AFGA 4EL5A 5C1BA 1TLTA 3KXPA 3FFWA 2O8CB 3ZHRA 2AT1A 3BKXA 1P5RA 4IEIA 1B73A 2OCDA 4KOEC 1DIBA 4A5SA 3DE4X 5LQMA 3KYDA 3T1QA 2BCJQ 4KXNA 3K9FC 4RQUA 1V8PA 1KJIA 4R9VA 1SCBA 2W2MA 4Y2SA 2PX2A 2ZAGA 3P9QA 5E6UA 1OGYA 1UP7A 4RBNA 1SOVA 4I5DA 5CYPA 5G0VA 2H2IA 3BHJA 3VYRB 3OE5A 2ECQA 1RFLA 2HLDD 2DT5A 2QPTA 3N70A 1Q92A 1GITA 2YMMA 3VKFA 2WAOA 4BV9A 3FCXA 1CDZA 1U2PA 4HN9A 2VA8A 1I1OA 2B2XA 4W1PA 4B8WA 1Z8FA 3EVFA 1SELA 1U3DA 4R2LA 4CL3A 1RYEA 3DOCA 3UMRA 1ZI6A 3VNQA 4CLXA 2QLTA 4LV5B 2GOYA 1BKSB 3AQ4A 3B82A 3D59A 1YVDA 5PGMA 1M67A 1F0NA 5BSTA 2FKNA 2Z9CA 4DV3B 3CFHL 1DAEA 1ZX1A 1ESDA 3KSMA 3VO1A 2OZLA 4JOBA 4PRKA 5FNVF 2VOJA 1ANKA 1VBFA 2E21A 3OH8A 2P2NA 1B74A 2OBYA 1W581 1XP5A 1Y33E 1SC4A 2COEA 2ZB2A 4OSPA 1SB9A 1KARA 4H7PA 1W49A 1P1FA 3E0XA 3LUPA 4EEZA 5JJ5A 5ALNA 4HQNA 1FFBA 2E55A 521PA 4QYSA 3O8NA 4Q3AA 2IRWA 5IJAA 4V0SA 2E0IA 2OM6A 4D1YA 1M7HA 4BKPA 3H99A 1S2MA 1C1HA 3R77A 4BNHA 3PSAA 2JEOA 1NX6A 2YQ5A 4HZUA 5BUCA 1ZFNA 4PYMA 3W6ZA 2D2XA 3UAYA 4NFYA 3T1YB 2ZYTX 3UANA 1Z4OA 1I2AA 7MDHA 1AQJA 3W3AD 4TVKA 2SCUB 3TZHA 5JLJA 4Z3OA 1Z2CA 1WWKA 1Z63A 4LJLA 4TTJA 3D2AA 5K99A 4AY6A 3LY9A 2KLHA 1SHLA 2HK9A 3RK1A 5KYXA 2YZKA 1XMSA 3ZH9B 2C4VA 2M9MA 3P0EA 1OQAA 3E58A 5LBTA 4N0MA 5IK2A 4GPIB 1NJ2A 1HSOA 3PCTA 4GVPA 3UXMA 4B3CA 3LL7A 3RHZA 4BGIA 5AK6A 2PT6A 4IIGA 5BSWA 1F2DA 1UPFA 3U9SA 1O03A 2XNDA 1RYYA 4GL4A 4O4IA 1NJ1A 1O5TA 1VDZA 2RH4A 4YP1A 4ZVNA 2XDWA 5CFQA 4EFDA 4GM0A 5FD8A 2PU5A 2EBWA 3QE0A 1NW4A 5HX7A 3K53A 1LPAB 1RAHA 3BCUA 1FNCA 5I47A 2PMCA 3ROXA 2V5AA 2VJLA 3UJPA 3O8QB 1ZRSA 5CFOA 3AF1A 3RT7A 5LWQA 2AKEA 5F7ZA 4YV7A 3KO8A 4HUJA 5KYVA 5C5EA 4LMAA 4POAA 5BWLA 3PUKA 4MMZB 2G2SA 5HMMA 4U5QA 1E3SA 2ZQ5A 1E7YA 3HVKA 5KNBH 2Z8YA 2I1LA 1ESNA 2GPSA 3F6BX 3KAKA 4IV5A 4QE3A 3KHUA 4J91A 3BS4A 3KQOA 1E7QA 4IIBA 2X3YA 1E2BA 2JLUA 2N46A 4Q12A 1YV9A 4GYJA 4BNIA 1J9ZA 2JIZD 3QW2A 2WFMA 4DMMA 3ZD7A 1W30A 1LK0A 5EMLA 5C52B 2Z83A 1QG2A 4O4LA 3RRXA 2HGSA 5EMKA 3UUFA 4EUSA 2OOSA 1QNLA 1VJ5A 4MLPA 3NOXA 2QROA 1Z2AA 3UATA 4AVYA 1GIAA 2CXTA 4Q24A 1CYDA 5SICE 2Z2XA 3WG9A 4UXHA 5FWAA 3NM4A 4FSDA 4R1NA 2DTEA 4HDMB 4Q4AA 6ABPA 3EIOA 1Q1NA 2PS9A 4HYQA 2VBIA 3V4FA 2RJOA 5DWVA 1PT6A 2IYTA 3HP1A 3EZXA 4BN4A 4Z4GA 4QBFA 2V7WA 1OLSA 3KUDA 3WL5A 1EVZA 3MFYA 3SYNA 4CM5A 4WA8A 1WUJS 2PZMA 1TEVA 4RQAA 3V8BA 3RANA 1EB9A 2AVNA 4B1FA 3L77A 2ZSDA 3VSDA 3AEZA 3W7VA 4BDSA 2BKUA 3V97A 2MIIA 5EP4A 4YBRA 4YC7A 4HATA 4MUJA 5IU6A 4WSOA 3W04A 2ID7A 3N9IA 1Y3HA 1NGSA 2IECA 4HT3B 4UHCA 3KQKA 4QELA 5IT4A 4P3XA 2Z04A 3GCDA 2XAAA 1GGJA 1P19A 3QBVA 2Q3DA 4FD2A 4GM4A 2OGUA 5DMXA 3L8ZA 2W11A 2DUMA 5AW1A 3DBOB 1LW6E 2R0QC 1X80A 1OH5A 1NJGA 4PW0A 1PSWA 2OO3A 4KE9A 4TV9B 1JFRA 3GGJA 4FK8A 1B41A 2V97A 3A4MA 3X43A 2R6CA 2ERCA 2W6JD 3IBYA 3Q6IA 2ESRA 5FBLB 4HH3C 4Y6GB 4K3VA 3S68A 3GLGB 1PHRA 5KNBA 1PDWA 2GNAA 4A0FA 1FTYA 2VJCA 4PRLA 3JWIA 4EVRA 2PS3A 2Q6IA 1C81A 2XY4A 3FOBA 3LOQA 3O2QB 2FOXA 4DOMA 3UNXA 4ON9A 3S0JA 2GB4A