2IECA

Crystal structure of uncharacterized conserved archael protein from methanopyrus kandleri
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
LSDRERAIFEAGITLGAIYHQFCGTPVSPGTAEEVAKCIERAALLQPCVIDARVEVDVSSEDTDNYGGYTEVSGRNLRVTIVTRCGEWEAVGKLEFIEELNYPLMWVEEIRRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein conserved in archaea
publication title Crystal Structure of uncharacterized conserved archael protein from Methanopyrus kandleri
rcsb
source organism Methanopyrus kandleri
molecule tags Structural genomics, unknown function
total genus 27
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.25: Dihydroneopterin aldolase.
pdb deposition date 2006-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04038 DHNA Dihydroneopterin aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.20 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 7,8-dihydroneopterin aldolase (MptD) 2iecA00
2OGFA 2I52A 2IECA
chains in the Genus database with same CATH superfamily
2OGFA 3CI0I 4MUJA 3CFHL 4MUEA 3UY4A 1N2IA 3COYA 2A88A 3CFIA 2GR8A 4DE5A 3LE8A 1N2BA 4MULA 3IUBA 3CFFL 2X3FA 4MUHA 3INNA 4DDMA 4FZJA 1N2HA 1MOPA 3IOEA 3AG6A 1N2JA 3IODA 2G16A 1V8FA 3COZA 4MQ6A 3LF4A 1IHOA 2A52A 4MUGA 5EXCA 4EFKA 3CI0K 4G5FA 2G5ZA 1N2GA 3ISJA 5BW0B 2I52A 4DDKA 3UA0A 3IVXA 4MUIA 3IVGA 4MUKA 2EJCA 3IMGA 3IOCA 4EF6A 2A84A 2A86A 3MUEA 3Q12A 5KWVA 4BHRA 4G5YA 2GR7A 4IXJA 2LMEA 3UK2A 5G2FA 1UFVA 2A56A 2A53A 3MXTA 2G3DA 3HL6A 3IMCA 2RETA 3IUEA 3EMOA 4DDHA 1N2EA 3IMEA 3COWA 3Q10A 3IVCA 3AG5A 4MUNA 5HG0A 3COVA 3IOBA 1N2OA 2G2SA 2A50A 3CFAL 3QTTA 3N8HA 2GW4A 4MUFA 2A7XA 2IECA 2A54A
chains in the Genus database with same CATH topology
2OGFA 2I52A 2IECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OGF A;  2I52 A;  2IEC A; 
#chains in the Genus database with same CATH topology
 2OGF A;  3CI0 I;  4MUJ A;  3CFH L;  4MUE A;  3UY4 A;  1N2I A;  3COY A;  2A88 A;  3CFI A;  2GR8 A;  4DE5 A;  3LE8 A;  1N2B A;  4MUL A;  3IUB A;  3CFF L;  2X3F A;  4MUH A;  3INN A;  4DDM A;  4FZJ A;  1N2H A;  1MOP A;  3IOE A;  3AG6 A;  1N2J A;  3IOD A;  2G16 A;  1V8F A;  3COZ A;  4MQ6 A;  3LF4 A;  1IHO A;  2A52 A;  4MUG A;  5EXC A;  4EFK A;  3CI0 K;  4G5F A;  2G5Z A;  1N2G A;  3ISJ A;  5BW0 B;  2I52 A;  4DDK A;  3UA0 A;  3IVX A;  4MUI A;  3IVG A;  4MUK A;  2EJC A;  3IMG A;  3IOC A;  4EF6 A;  2A84 A;  2A86 A;  3MUE A;  3Q12 A;  5KWV A;  4BHR A;  4G5Y A;  2GR7 A;  4IXJ A;  2LME A;  3UK2 A;  5G2F A;  1UFV A;  2A56 A;  2A53 A;  3MXT A;  2G3D A;  3HL6 A;  3IMC A;  2RET A;  3IUE A;  3EMO A;  4DDH A;  1N2E A;  3IME A;  3COW A;  3Q10 A;  3IVC A;  3AG5 A;  4MUN A;  5HG0 A;  3COV A;  3IOB A;  1N2O A;  2G2S A;  2A50 A;  3CFA L;  3QTT A;  3N8H A;  2GW4 A;  4MUF A;  2A7X A;  2IEC A;  2A54 A; 
#chains in the Genus database with same CATH homology
 2OGF A;  2I52 A;  2IEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...